FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29478

FusionGeneSummary for PTPRA_N4BP1

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPRA_N4BP1
Fusion gene ID: 29478
HgeneTgene
Gene symbol

PTPRA

N4BP1

Gene ID

5786

9683

Gene nameprotein tyrosine phosphatase, receptor type ANEDD4 binding protein 1
SynonymsHEPTP|HLPR|HPTPA|HPTPalpha|LRP|PTPA|PTPRL2|R-PTP-alpha|RPTPA-
Cytomap

20p13

16q12.1

Type of geneprotein-codingprotein-coding
Descriptionreceptor-type tyrosine-protein phosphatase alphaLeukocyte common antigen-related peptide (protein tyrosine phosphate)PTPLCA-related phosphatasePTPase-alphaprotein tyrosine phosphatase, receptor type, alpha polypeptideprotein-tyrosine phosphatase alphNEDD4-binding protein 1
Modification date2018052720180522
UniProtAcc

P18433

O75113

Ensembl transtripts involved in fusion geneENST00000380393, ENST00000216877, 
ENST00000358719, ENST00000399903, 
ENST00000425918, ENST00000318266, 
ENST00000356147, 
ENST00000262384, 
ENST00000565423, 
Fusion gene scores* DoF score13 X 10 X 8=10402 X 2 X 2=8
# samples 145
** MAII scorelog2(14/1040*10)=-2.89308479608349
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/8*10)=2.64385618977472
Context

PubMed: PTPRA [Title/Abstract] AND N4BP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A2-A3Y0-01APTPRAchr20

2998559

+N4BP1chr16

48596355

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000380393ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000380393ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000216877ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000216877ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000358719ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000358719ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000399903ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000399903ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000425918ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000425918ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000318266ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000318266ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-
In-frameENST00000356147ENST00000262384PTPRAchr20

2998559

+N4BP1chr16

48596355

-
5CDS-intronENST00000356147ENST00000565423PTPRAchr20

2998559

+N4BP1chr16

48596355

-

Top

FusionProtFeatures for PTPRA_N4BP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPRA

P18433

N4BP1

O75113

Inhibitor of the E3 ubiquitin-protein ligase ITCH. Actsby interacting with the second WW domain of ITCH, leading tocompete with ITCH's substrates and impairing ubiquitination ofsubstrates (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+122320_151338794Topological domainExtracellular
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+132420_151338794Topological domainExtracellular
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+122320_151338794Topological domainExtracellular
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+172820_151347803Topological domainExtracellular
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+132420_151347803Topological domainExtracellular
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+1223152_174338794TransmembraneHelical
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+1324152_174338794TransmembraneHelical
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+1223152_174338794TransmembraneHelical
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+1728152_174347803TransmembraneHelical
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+1324152_174347803TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+1223241_501338794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+1223533_791338794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+1324241_501338794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+1324533_791338794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+1223241_501338794DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+1223533_791338794DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+1728241_501347803DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+1728533_791347803DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+1324241_501347803DomainTyrosine-protein phosphatase 1
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+1324533_791347803DomainTyrosine-protein phosphatase 2
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+1223442_448338794RegionSubstrate binding
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+1324442_448338794RegionSubstrate binding
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+1223442_448338794RegionSubstrate binding
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+1728442_448347803RegionSubstrate binding
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+1324442_448347803RegionSubstrate binding
HgenePTPRAchr20:2998559chr16:48596355ENST00000216877+1223175_802338794Topological domainCytoplasmic
HgenePTPRAchr20:2998559chr16:48596355ENST00000318266+1324175_802338794Topological domainCytoplasmic
HgenePTPRAchr20:2998559chr16:48596355ENST00000356147+1223175_802338794Topological domainCytoplasmic
HgenePTPRAchr20:2998559chr16:48596355ENST00000380393+1728175_802347803Topological domainCytoplasmic
HgenePTPRAchr20:2998559chr16:48596355ENST00000399903+1324175_802347803Topological domainCytoplasmic


Top

FusionGeneSequence for PTPRA_N4BP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPRA_ENST00000380393_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1178aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEETIKGICEPELEE
RECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHAD
NYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSP
DVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNI
LVNFFKTMGYSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMV
EKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQ
PEPLLPNNMKSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKH
IVIDGSNVAITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLL
HLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRV
PGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQQNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNA

>In-frame_PTPRA_ENST00000216877_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1169aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEETIKGICEPELEERECYPKDMH
CIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLIL
PTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPING
LTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMG
YSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFK
VEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNM
KSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVA
ITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGI
IVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTS

>In-frame_PTPRA_ENST00000358719_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1034aa
MVALSSLLVIVFIIIVLYMLRRFRKAELMSRNTEKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRM
ADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDF
WRMIWEQNTATIVMVTNLKERKEETIKGICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSH
IQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGL
NISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDA
KTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVT
PETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLS
PSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPS
DHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVT
EQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRS
GPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQQNLPMPAQRSSAE

>In-frame_PTPRA_ENST00000399903_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1178aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNR
TVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEETIKGICEPELEE
RECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHAD
NYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSP
DVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNI
LVNFFKTMGYSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMV
EKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQ
PEPLLPNNMKSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKH
IVIDGSNVAITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLL
HLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRV
PGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQQNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQILVAHPYMKDLNA

>In-frame_PTPRA_ENST00000425918_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1189aa
MDDAVQITKISMDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTV
NSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFII
IVLYMLRFKKYKQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEA
ASKEENKEKNRTVNILPTDHSRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEET
IKGICEPELEERECYPKDMHCIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKR
EFKQFVEAHADNYTMDLLILPTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELT
KQMDTVLSSSPDVLFDPINGLTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDI
KETTEEMEYNILVNFFKTMGYSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPK
KTQAHTQQNMVEKFSQLPFKVEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRV
PLFPENGLHQQPEPLLPNNMKSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLEL
KNEPGRTDLKHIVIDGSNVAITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGE
RIASHDDRFLLHLADKTGGIIVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALP
NVGMFDPSFRVPGTQAASTSHQPPTRIQGAPSSHWLPQQPHFPLLPALPSLQQNLPMPAQRSSAETNELREALLKIFPDSEQRLKIDQIL

>In-frame_PTPRA_ENST00000318266_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1169aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEETIKGICEPELEERECYPKDMH
CIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLIL
PTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPING
LTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMG
YSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFK
VEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNM
KSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVA
ITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGI
IVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTS

>In-frame_PTPRA_ENST00000356147_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_1169aa
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNITLGPTTLTTVNSSDSDNGTTR
TASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNS
FRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRTVNILPTDH
SRVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKEETIKGICEPELEERECYPKDMH
CIFVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLIL
PTSLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPING
LTPDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMG
YSQEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFK
VEAKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNM
KSACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVA
ITHGLKKFFSCRGIAIAVETFWKLGNRNITVFVPQWRTRRDPNVTEQHFLTQLQELGILSLTPARMVFGERIASHDDRFLLHLADKTGGI
IVTNDNFREFVNESVSWREIITKRLLQYTFVGDIFMVPDDPLGRSGPRLEEFLQKEVCLRDMQPLLSALPNVGMFDPSFRVPGTQAASTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPRA_ENST00000380393_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3534nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAA
AGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGAC
CTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAG
CTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGAC
AATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACA
GGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAA
ACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCA
GATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGAT
TCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAAT
GTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATC
CTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTG
CTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACC
AAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTA
GAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAA
CAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCA
AGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAG
CCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCA
ACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCA
GTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACAC
ATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTT
TGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACC
CAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTA
CACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATT
ACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAG
TTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTC
CCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCAC
TTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAA
GCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAGATCTAAATGCG

>In-frame_PTPRA_ENST00000216877_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3507nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCAC
TGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTT
GGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCC
AGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTG
CCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGA
GATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAAT
AAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGT
CTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAG
TTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCT
GCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGC
TACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAAT
AAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACA
AATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAA
GTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAAC
CAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCA
AGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATG
AAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCC
CAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGAT
ACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCA
ATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACT
GTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCT
TTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATA
ATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTC
GTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGA
GATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGC
CACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGT
CTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCA

>In-frame_PTPRA_ENST00000358719_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3102nt
ATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGCGATTTAGAAAGGCTGAATTGATGAGC
AGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGT
GTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATG
GCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAA
AACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGAT
TACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTC
TGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGT
GAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATT
CAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCAC
ATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTT
GTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAG
GAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTG
AATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACA
GTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAG
AAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCT
AAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAG
GAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCA
TCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTAT
CCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCAC
ACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTC
AGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCA
CCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAA
AATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCAT
TCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCT
GATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGG
AGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCA
ATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACA
GAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCAT
GATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTC
TCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGT
GGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTT
GACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGG
CTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAA
ACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATAC

>In-frame_PTPRA_ENST00000399903_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3534nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACA
CCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATAC
AAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGA
TCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTC
TTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGA
TATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTC
ATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAA
CAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAA
AGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGAC
CTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAG
CTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGAC
AATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACA
GGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAA
ACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCA
GATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGAT
TCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAAT
GTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATC
CTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTG
CTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACC
AAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTA
GAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAA
CAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCA
AGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAG
CCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCA
ACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCA
GTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACAC
ATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTT
TGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACC
CAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTA
CACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATT
ACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAG
TTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTC
CCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCAC
TTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAA
GCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAGATCTAAATGCG

>In-frame_PTPRA_ENST00000425918_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3567nt
ATGGATGATGCAGTTCAAATAACTAAGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCC
AACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACT
TCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTC
AATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCA
GATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGT
AATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATC
ATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGAT
GTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAA
ATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCT
GCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGG
GTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAA
ACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATAT
ATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTT
CTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTC
ATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGG
GAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACA
CTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAAT
GCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACA
AAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAAT
GAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAG
ATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATA
AAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATT
AAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCA
GCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAG
AAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGT
AGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAA
ACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTT
CCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGT
TGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGG
TCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTA
AAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCT
TGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGT
GATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAA
AGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTT
GTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGAT
CCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCA
AATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCC
CCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAG
AGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTG

>In-frame_PTPRA_ENST00000318266_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3507nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCAC
TGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTT
GGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCC
AGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTG
CCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGA
GATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAAT
AAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGT
CTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAG
TTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCT
GCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGC
TACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAAT
AAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACA
AATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAA
GTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAAC
CAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCA
AGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATG
AAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCC
CAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGAT
ACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCA
ATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACT
GTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCT
TTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATA
ATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTC
GTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGA
GATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGC
CACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGT
CTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCA

>In-frame_PTPRA_ENST00000356147_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_3507nt
ATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGA
ATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCT
GTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGA
ACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCC
TGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTG
TCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCT
TTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCA
CCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCT
GCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCAC
TCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAA
TTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTT
ACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCAC
TGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTT
GGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCC
AGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTG
CCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGA
GATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAAT
AAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGT
CTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAG
TTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCT
GCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGC
TACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAAT
AAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACA
AATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAA
GTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAAC
CAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCA
AGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATG
AAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCC
CAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGAT
ACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCA
ATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACT
GTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCT
TTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATA
ATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTC
GTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGA
GATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGC
CACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGT
CTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPRA_ENST00000380393_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_8398nt
GGAGTATGAGCCACGCTCAGGGGAGCAGGTACCCCTTCTCCTAAAGATGAAGAGGAGCAAACTGGCACTAAGCAAGGCCATCGAGAGCGG
GGACACTGACCTGGTGTTCACGGTGTTGCTGCACCTGAAGAACGAGCTGAACCGAGGAGATTTTTTCATGACCCTTCGGAATCAGCCCAT
GGCCCTCAGTTTGTACCGACAGTTCTGTAAGCATCAGGAGCTAGAGACGCTGAAGGACCTTTACAATCAGGATGACAATCACCAGGAATT
GGGCAGCTTCCACATCCGAGCCAGCTATGCTGCAGAAGAGCGTATTGAGGGGCGAGTAGCAGCTCTGCAGACAGCCGCCGATGCCTTCTA
CAAGGCCAAGAATGAGTTTGCAGCCAAGGCTACAGAGGATCAAATGCGGCTCCTACGGCTGCAGCGGCGCCTAGAAGACGAGCTGGGGGG
CCAGTTCCTAGACCTGTCTCTACATGACACAGTTACCACCCTCATTCTTGGCGGTCACAACAAGCGTGCAGAGCAGCTGGCACGTGACTT
CCGCATCCCTGACAAGAGGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAAT
AACTAAGGACACATGTTCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCA
GTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAAC
CAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGG
GACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTT
CACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTC
CAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTC
TGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCT
TATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGC
CCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTC
CTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAG
TCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTG
CTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACC
TGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTT
TTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCA
GAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTC
AGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTT
CCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTC
AACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTG
GGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCC
CAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTT
TGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATT
CTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCC
AAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGAT
TCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGC
TTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAG
CTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACT
ACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAG
CTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTG
CCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGT
TACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAA
AAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCC
ATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTG
TCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTC
CTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGA
CAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGG
ACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGC
AGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGC
CTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGC
AGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAA
GACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAGATCTAAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCT
GAGCGCTGAGCTTGCGCTCAGGGCTGGCTGATCAAACTCAAGCTCACACCTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATT
TCCCAGTGTAAACGCAGTTGTACAGAAAAAAAATGTTTTGGGTATAAATCTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATG
CTGCTATTACAGATTTAACATTTTCTGTTAAAGGAAAGTCTACATTTTCTGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGT
ATTTACCTTTTTATGTTTTTTAAACTATTTTCCTTAAAGCCGAAAATATTGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAA
AAAAGTGTTGCTTTCTTAAGGAAAGCAAGACGTCTTAAAGTATATTTTCTTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCA
CCCTTCCAGCCTCCTCTGCCCTCACCCCCGGAGTTAAAGTGGGTAAGAGTTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGT
GGACCCGCGGTGCCACTAGATGGCACTTGGTGCCTAGCCATGGTGAATGACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAG
ACATCGTGGAGCCCATGGAGTCCCACCCTCCTTCCCCCTTCCACCCTGCGCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGC
CCACAGCCACAGCCACAGCTGAGGAGTGGCCGGGCAGGCAGCAGGCTCCCCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACA
TGCCTGGCCTGGCTCTGGAAGTCACGTCTTAGCTTCTGAACACCGTAGCGGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGC
CATCTTGTGTCCCCAACTGCAGGAGACGCCCTGATGTGGAGTTTGTACAGCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCA
AGCCAATAAATAGCATTAGTAGCTTCTGTGGGGGGATCCCAGAGCCCCTGTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAA
CAGCCTTTCCTGTGAGTCTTTCTCAGAATTGATATCTTAATATTGTCTGTTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTT
CCTGGGCAATCTTAACATCTTTACTCTTATTGTCTGGACCTTCAAAGGGCTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCG
GCTTGCTGCCTGTCCTGCCTGTCCGGATCTTGTCTCCTAGTCCTGAGGAGCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGG
GGACTTGGGGGCATCCCAGAGTGCTCCCTCCAGGCCTGCTTCTTGGTTTTGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCC
TCCATGAGGCCAAGCTTGTCCTTCAATCATGTTTCCTCTCAGATGCGTCCGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGG
GCCTATGGCCAAGTCACCCAGCTGTGGAAGCAGAGGTAGAAGACGAGGCCAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAG
CTTTGTACCTGTTTTCAAAAGCACAACTGAGGTGTGCGGGCTGGAGCTGTCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCA
GCAGCCTGGCTGACCCACTATTTCTCCTCTGCTTCAGAGGAAACCCAGGAAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGT
TGGTGCTGGCTAGGCTGAGGGGGCCACCACTTTTCCTGGCTAGAAGCTACTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCT
GACTTACTGCTTCAGAGGGATTGGCCTGTCCCCTTTCCCTTTCTCGGCTATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTA
CAGCATGAGACGGAATTCATCATTCCTTCCGAAACCCCTGATATTTAATATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAAC
TCATTACTGGTTCTCAGCCTCCTCCAGTACTAGCCTCAGTGTGGCTGCTGCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCC
GCTCGCCTCTTCCCTGTCTACTGCTCAGGCTCTCCCACTTCGTGGCATCCATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTC
AACAGGGAGGATGTCTGTTGCTCAGAGAGGTTGTCCTGAGGGGCTGGGTGATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTG
TCTCTGGAAGTAAAAGAGCCTTGTCTGACCTTAATGCAAGCAGTCTGTTTGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTG
GGCCATCCTGGGCGGCCGGTCAGCGTTGCTAGGCAGGCTCGGCTGTCTGGCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGA
AGGGAGAGCCGGCCTCATGCCGATGCGGCTTGTGGCACGGCTGGGATGTGAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCC
CCGCCCTCCCCCAGCTCCTACCTGCCTCCCACGCCTCAGGTGTGGCTGCCTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTG
TCCTCACCCAGTTCCTGCAGTGTCTCTGACCCACGCCTCCCGCCTCCTGGCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTG
TTCATCACCTTCCTCCCCAGTGTTTCCACTTATCTTGGATGTTTTAGATTGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTG
CTAGTGCTTCCCCTCACCTCCCACTCTCCACTTCCCAGTTTGCAAATGTGGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCT
TGGGGACGGCCCGGTGCCTGGCTGCAAGGCCGCGCTGGGGCTCTGTCTTGGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCAC
TTCCCTCACTCCCAGACCTCCCTCATTCTTTTTGTCTCTTCTTTTTGCCTAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGG
CTTGCAGACTTTTCCCCACCTTTGGGGCTCGTGGTGGTGGAGAGGGCAGCTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGA
TGCTTGCCCAGTAGTTCTGGAGGAAGGCCCGGGAATCTGCAAATGAGCGCATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCAC
ATGTTGAGAAACTGCAGTCACCCTTAGGGCCACACCGTCCCTCTCCTCGCTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGT
GCACTTTCCACTCTACCAGGAAGCCCTATGACATCCTCAGGCTCCCCAGACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCA
CCCTCCGTATGGTCCCCTGCTCTGCCCTCGTGCTTTGCTGGCCCCTGCCCGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTA
ACTGGCTGGCCCCTCCCAGCGCTGCCCTCTGCCGTCCAGATGCTGCAGTGTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCC
CTCCTCCTGCGAAGTGATCTGCAGTGGCTGTTTGACCAGACCACAAAGTTCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCC
AGCCATACTTGACTGTCCCCAAACTCTCCCTGCAGCCACATGTTTCCCATGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGA
TGCCCTTCTCCCAAATGGCTTCCCTCCTGGAAGGCCCAGCCTGAGTCCTCGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGAT
GTTGTGACCGCACAGCACTTTGTGTCTCGCTTTGAGCACTTGCCACTCTGGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCC
CTTTCTAGACTGTGAGCTCCTCGTGGGCAGGGACCGCCTGTGTTCTCTGTATTTCCCACGGCGCCTAGCACAGTGCCTTGCACTTGATAG

>In-frame_PTPRA_ENST00000216877_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_8085nt
AGCGAGGCTGCGGCGAGTGCGGCGCTGACAGAGACGCGCGCGCGCGCGATCGCGCTCGGACCCCGGCCGCTGCCGCCATCACTGTCGCCC
GCCCAGTCGCCCCTCAGCCGCTTCCCCTCGCCATGGAGGCGAGGCCGCCGCCGCCGCCGCGGGGCTCGGAGCCGCGGGCCGGGCGGCGGC
CCTGAGGGCTAGTGGCGGCCCGAAACGCCGCCGCGGAGCCGAGGCGGAGCCGCTGTCCTCGTCCCCAGCGGTCCCGCCCAACGCCCGACT
CTGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAAGGACACATGT
TCAAAGAGCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGT
CAGTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGC
CAAAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAAC
CACTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTG
GCTTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCC
TTCAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAG
GTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCC
ACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGA
CGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAA
GGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACAT
CAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCG
GATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACC
TGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGA
TACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCA
ACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGA
AGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAA
TCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATAT
TTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCT
TTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAG
GAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGAC
ATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAAT
GGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTAC
TGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGA
GACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACA
GCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAAC
AGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTC
TGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGG
TTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAA
GCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCA
TATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAAC
GGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGC
AGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACA
GCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGA
CAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTG
GAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACC
TCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCC
CAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCC
TCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAA
CGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAA
AGATCTAAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGCTCAGGGCTGGCTGATCAAACTCAAGC
TCACACCTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAGTTGTACAGAAAAAAAATGTTTTGGGT
ATAAATCTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTAACATTTTCTGTTAAAGGAAAGTCTAC
ATTTTCTGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTTTTTTAAACTATTTTCCTTAAAGCCGA
AAATATTGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTTAAGGAAAGCAAGACGTCTTAAAGTAT
ATTTTCTTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCTGCCCTCACCCCCGGAGTTAAAGTGGG
TAAGAGTTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACTAGATGGCACTTGGTGCCTAGCCATGG
TGAATGACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATGGAGTCCCACCCTCCTTCCCCCTTCCA
CCCTGCGCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACAGCTGAGGAGTGGCCGGGCAGGCAGCA
GGCTCCCCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTGGAAGTCACGTCTTAGCTTCTGAACAC
CGTAGCGGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAACTGCAGGAGACGCCCTGATGTGGAGTT
TGTACAGCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATTAGTAGCTTCTGTGGGGGGATCCCAGA
GCCCCTGTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGTCTTTCTCAGAATTGATATCTTAATAT
TGTCTGTTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACATCTTTACTCTTATTGTCTGGACCTTC
AAAGGGCTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTGCCTGTCCGGATCTTGTCTCCTAGTCC
TGAGGAGCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCCAGAGTGCTCCCTCCAGGCCTGCTTCT
TGGTTTTGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTTGTCCTTCAATCATGTTTCCTCTCAGA
TGCGTCCGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCACCCAGCTGTGGAAGCAGAGGTAGAAGA
CGAGGCCAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCAAAAGCACAACTGAGGTGTGCGGGCTG
GAGCTGTCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCACTATTTCTCCTCTGCTTCAGAGGAAA
CCCAGGAAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTGAGGGGGCCACCACTTTTCCTGGCTAG
AAGCTACTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAGGGATTGGCCTGTCCCCTTTCCCTTTC
TCGGCTATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATTCATCATTCCTTCCGAAACCCCTGATA
TTTAATATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAGCCTCCTCCAGTACTAGCCTCAGTGTG
GCTGCTGCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGTCTACTGCTCAGGCTCTCCCACTTCGT
GGCATCCATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTGTTGCTCAGAGAGGTTGTCCTGAGGGG
CTGGGTGATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGAGCCTTGTCTGACCTTAATGCAAGCAG
TCTGTTTGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCCGGTCAGCGTTGCTAGGCAGGCTCGGC
TGTCTGGCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCATGCCGATGCGGCTTGTGGCACGGCTG
GGATGTGAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTCCTACCTGCCTCCCACGCCTCAGGTGT
GGCTGCCTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTGCAGTGTCTCTGACCCACGCCTCCCGC
CTCCTGGCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCCCAGTGTTTCCACTTATCTTGGATGTT
TTAGATTGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCACCTCCCACTCTCCACTTCCCAGTTTGC
AAATGTGGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGCCTGGCTGCAAGGCCGCGCTGGGGCTC
TGTCTTGGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGACCTCCCTCATTCTTTTTGTCTCTTCTT
TTTGCCTAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCCACCTTTGGGGCTCGTGGTGGTGGAGA
GGGCAGCTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTCTGGAGGAAGGCCCGGGAATCTGCAAA
TGAGCGCATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAGTCACCCTTAGGGCCACACCGTCCCTC
TCCTCGCTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACCAGGAAGCCCTATGACATCCTCAGGCT
CCCCAGACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCCTGCTCTGCCCTCGTGCTTTGCTGGCC
CCTGCCCGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCCAGCGCTGCCCTCTGCCGTCCAGATGC
TGCAGTGTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGATCTGCAGTGGCTGTTTGACCAGACCA
CAAAGTTCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTCCCCAAACTCTCCCTGCAGCCACATGT
TTCCCATGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATGGCTTCCCTCCTGGAAGGCCCAGCCTG
AGTCCTCGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCACTTTGTGTCTCGCTTTGAGCACTTGC
CACTCTGGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGCTCCTCGTGGGCAGGGACCGCCTGTGT

>In-frame_PTPRA_ENST00000358719_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_8111nt
CTGCGGCGAGTGCGGCGCTGACAGAGACGCGCGCGCGCGCGATCGCGCTCGGACCCCGGCCGCTGCCGCCATCACTGTCGCCCGCCCAGT
CGCCCCTCAGCCGCTTCCCCTCGCCATGGAGGCGAGGCCGCCGCCGCCGCCGCGGGGCTCGGAGCCGCGGGCCGGGCGGCGGCCCTGAGG
GCTAGTGGCGGCCCGAAACGCCGCCGCGGAGCCGAGGCGGAGCCGCTGTCCTCGTCCCCAGCGGTCCCGCCCAACGCCCGACTCTGTGAC
ACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAAGGACACATGTTCAAAGA
GCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCC
AACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACT
TCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTC
AATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCA
GATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGAT
GAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGCGATTT
AGAAAGGCTGAATTGATGAGCAGGAATACAGAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACT
GAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAA
GAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGT
GAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTT
GAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAA
GAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAG
GAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGC
CTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCT
GTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTG
AAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTT
TTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACA
CAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAG
CTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTT
TCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAG
GGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCA
GATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAG
GTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAA
TTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACT
CCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCA
AATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGAC
CCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCC
AGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTA
GGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGAT
GCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTG
GAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTC
TTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACA
AGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTT
GGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGA
GAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCC
GATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCC
CTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAG
GGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCA
GCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAG
ATCTTGGTGGCCCACCCATACATGAAAGATCTAAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGC
TCAGGGCTGGCTGATCAAACTCAAGCTCACACCTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAG
TTGTACAGAAAAAAAATGTTTTGGGTATAAATCTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTA
ACATTTTCTGTTAAAGGAAAGTCTACATTTTCTGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTT
TTTTAAACTATTTTCCTTAAAGCCGAAAATATTGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTT
AAGGAAAGCAAGACGTCTTAAAGTATATTTTCTTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCT
GCCCTCACCCCCGGAGTTAAAGTGGGTAAGAGTTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACT
AGATGGCACTTGGTGCCTAGCCATGGTGAATGACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATG
GAGTCCCACCCTCCTTCCCCCTTCCACCCTGCGCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACA
GCTGAGGAGTGGCCGGGCAGGCAGCAGGCTCCCCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTG
GAAGTCACGTCTTAGCTTCTGAACACCGTAGCGGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAAC
TGCAGGAGACGCCCTGATGTGGAGTTTGTACAGCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATT
AGTAGCTTCTGTGGGGGGATCCCAGAGCCCCTGTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGT
CTTTCTCAGAATTGATATCTTAATATTGTCTGTTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACA
TCTTTACTCTTATTGTCTGGACCTTCAAAGGGCTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTG
CCTGTCCGGATCTTGTCTCCTAGTCCTGAGGAGCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCC
AGAGTGCTCCCTCCAGGCCTGCTTCTTGGTTTTGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTT
GTCCTTCAATCATGTTTCCTCTCAGATGCGTCCGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCAC
CCAGCTGTGGAAGCAGAGGTAGAAGACGAGGCCAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCA
AAAGCACAACTGAGGTGTGCGGGCTGGAGCTGTCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCA
CTATTTCTCCTCTGCTTCAGAGGAAACCCAGGAAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTG
AGGGGGCCACCACTTTTCCTGGCTAGAAGCTACTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAG
GGATTGGCCTGTCCCCTTTCCCTTTCTCGGCTATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATT
CATCATTCCTTCCGAAACCCCTGATATTTAATATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAG
CCTCCTCCAGTACTAGCCTCAGTGTGGCTGCTGCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGT
CTACTGCTCAGGCTCTCCCACTTCGTGGCATCCATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTG
TTGCTCAGAGAGGTTGTCCTGAGGGGCTGGGTGATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGA
GCCTTGTCTGACCTTAATGCAAGCAGTCTGTTTGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCC
GGTCAGCGTTGCTAGGCAGGCTCGGCTGTCTGGCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCA
TGCCGATGCGGCTTGTGGCACGGCTGGGATGTGAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTC
CTACCTGCCTCCCACGCCTCAGGTGTGGCTGCCTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTG
CAGTGTCTCTGACCCACGCCTCCCGCCTCCTGGCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCC
CAGTGTTTCCACTTATCTTGGATGTTTTAGATTGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCAC
CTCCCACTCTCCACTTCCCAGTTTGCAAATGTGGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGC
CTGGCTGCAAGGCCGCGCTGGGGCTCTGTCTTGGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGAC
CTCCCTCATTCTTTTTGTCTCTTCTTTTTGCCTAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCC
ACCTTTGGGGCTCGTGGTGGTGGAGAGGGCAGCTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTC
TGGAGGAAGGCCCGGGAATCTGCAAATGAGCGCATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAG
TCACCCTTAGGGCCACACCGTCCCTCTCCTCGCTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACC
AGGAAGCCCTATGACATCCTCAGGCTCCCCAGACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCC
TGCTCTGCCCTCGTGCTTTGCTGGCCCCTGCCCGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCC
AGCGCTGCCCTCTGCCGTCCAGATGCTGCAGTGTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGA
TCTGCAGTGGCTGTTTGACCAGACCACAAAGTTCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTC
CCCAAACTCTCCCTGCAGCCACATGTTTCCCATGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATG
GCTTCCCTCCTGGAAGGCCCAGCCTGAGTCCTCGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCA
CTTTGTGTCTCGCTTTGAGCACTTGCCACTCTGGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGC
TCCTCGTGGGCAGGGACCGCCTGTGTTCTCTGTATTTCCCACGGCGCCTAGCACAGTGCCTTGCACTTGATAGGTGCTTAATAAATGTCT

>In-frame_PTPRA_ENST00000399903_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_8105nt
CTGCGGCGAGTGCGGCGCTGACAGAGACGCGCGCGCGCGCGATCGCGCTCGGACCCCGGCCGCTGCCGCCATCACTGTCGCCCGCCCAGT
CGCCCCTCAGCCGCTTCCCCTCGCCATGGAGGCGAGGCCGCCGCCGCCGCCGCGGGGCTCGGAGCCGCGGGCCGGGCGGCGGCCCTGAGG
GCTAGTGGCGGCCCGAAACGCCGCCGCGGAGCCGAGGCGGAGCCGCTGTCCTCGTCCCCAGCGGTCCCGCCCAACGCCCGACTCTGTGAC
ACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAAGGACACATGTTCAAAGA
GCATAATTAACTTTTTAAAAGAAGCTAATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCC
AACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACT
TCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTC
AATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCA
GATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGT
AATTCTGACTCGAAGGACAGAAGAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATC
ATAGTTTTGTACATGTTAAGGTTTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGAT
GTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAA
ATTAACCGGAGAATGGCAGACGACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCT
GCTTCCAAGGAGGAAAACAAGGAAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGG
GTTCCAGATTCTGATTACATCAATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAA
ACGGTGAATGATTTCTGGCGGATGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATAT
ATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTT
CTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTC
ATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGG
GAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACA
CTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAAT
GCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACA
AAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAAT
GAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAG
ATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATA
AAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATT
AAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCA
GCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAG
AAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGT
AGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAA
ACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTT
CCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGT
TGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGG
TCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTA
AAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCT
TGTCGTGGAATTGCAATTGCAGTTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGT
GATCCTAATGTCACAGAACAGCACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAA
AGAATTGCTTCTCATGATGACAGGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTT
GTGAATGAGTCAGTCTCTTGGAGAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGAT
CCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCA
AATGTGGGCATGTTTGACCCCAGCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCC
CCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAG
AGATCTTCTGCAGAAACCAACGAGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTG
GTGGCCCACCCATACATGAAAGATCTAAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGCTCAGGG
CTGGCTGATCAAACTCAAGCTCACACCTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAGTTGTAC
AGAAAAAAAATGTTTTGGGTATAAATCTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTAACATTT
TCTGTTAAAGGAAAGTCTACATTTTCTGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTTTTTTAA
ACTATTTTCCTTAAAGCCGAAAATATTGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTTAAGGAA
AGCAAGACGTCTTAAAGTATATTTTCTTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCTGCCCTC
ACCCCCGGAGTTAAAGTGGGTAAGAGTTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACTAGATGG
CACTTGGTGCCTAGCCATGGTGAATGACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATGGAGTCC
CACCCTCCTTCCCCCTTCCACCCTGCGCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACAGCTGAG
GAGTGGCCGGGCAGGCAGCAGGCTCCCCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTGGAAGTC
ACGTCTTAGCTTCTGAACACCGTAGCGGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAACTGCAGG
AGACGCCCTGATGTGGAGTTTGTACAGCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATTAGTAGC
TTCTGTGGGGGGATCCCAGAGCCCCTGTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGTCTTTCT
CAGAATTGATATCTTAATATTGTCTGTTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACATCTTTA
CTCTTATTGTCTGGACCTTCAAAGGGCTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTGCCTGTC
CGGATCTTGTCTCCTAGTCCTGAGGAGCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCCAGAGTG
CTCCCTCCAGGCCTGCTTCTTGGTTTTGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTTGTCCTT
CAATCATGTTTCCTCTCAGATGCGTCCGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCACCCAGCT
GTGGAAGCAGAGGTAGAAGACGAGGCCAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCAAAAGCA
CAACTGAGGTGTGCGGGCTGGAGCTGTCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCACTATTT
CTCCTCTGCTTCAGAGGAAACCCAGGAAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTGAGGGGG
CCACCACTTTTCCTGGCTAGAAGCTACTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAGGGATTG
GCCTGTCCCCTTTCCCTTTCTCGGCTATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATTCATCAT
TCCTTCCGAAACCCCTGATATTTAATATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAGCCTCCT
CCAGTACTAGCCTCAGTGTGGCTGCTGCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGTCTACTG
CTCAGGCTCTCCCACTTCGTGGCATCCATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTGTTGCTC
AGAGAGGTTGTCCTGAGGGGCTGGGTGATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGAGCCTTG
TCTGACCTTAATGCAAGCAGTCTGTTTGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCCGGTCAG
CGTTGCTAGGCAGGCTCGGCTGTCTGGCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCATGCCGA
TGCGGCTTGTGGCACGGCTGGGATGTGAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTCCTACCT
GCCTCCCACGCCTCAGGTGTGGCTGCCTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTGCAGTGT
CTCTGACCCACGCCTCCCGCCTCCTGGCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCCCAGTGT
TTCCACTTATCTTGGATGTTTTAGATTGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCACCTCCCA
CTCTCCACTTCCCAGTTTGCAAATGTGGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGCCTGGCT
GCAAGGCCGCGCTGGGGCTCTGTCTTGGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGACCTCCCT
CATTCTTTTTGTCTCTTCTTTTTGCCTAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCCACCTTT
GGGGCTCGTGGTGGTGGAGAGGGCAGCTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTCTGGAGG
AAGGCCCGGGAATCTGCAAATGAGCGCATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAGTCACCC
TTAGGGCCACACCGTCCCTCTCCTCGCTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACCAGGAAG
CCCTATGACATCCTCAGGCTCCCCAGACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCCTGCTCT
GCCCTCGTGCTTTGCTGGCCCCTGCCCGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCCAGCGCT
GCCCTCTGCCGTCCAGATGCTGCAGTGTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGATCTGCA
GTGGCTGTTTGACCAGACCACAAAGTTCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTCCCCAAA
CTCTCCCTGCAGCCACATGTTTCCCATGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATGGCTTCC
CTCCTGGAAGGCCCAGCCTGAGTCCTCGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCACTTTGT
GTCTCGCTTTGAGCACTTGCCACTCTGGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGCTCCTCG
TGGGCAGGGACCGCCTGTGTTCTCTGTATTTCCCACGGCGCCTAGCACAGTGCCTTGCACTTGATAGGTGCTTAATAAATGTCTGCTCAA

>In-frame_PTPRA_ENST00000425918_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_7989nt
ACTGTCGCCCGCCCAGTCGCCCCTCAGCCGCTTCCCCTCGCCATGGAGGCGAGGCCGCCGCCGCCGCCGCGGGGCTCGGAGCCGCGGGCC
GGGCGGCGGCCCTGAGGGCTAGTGGCGGCCCGAAACGCCGCCGCGGAGCCGAGGCGGAGCCGCTGTCCTCGTCCCCAGCGGTCCCGCCCA
ACGCCCGACTCTGTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAA
GATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATGCTACCACAGTTGCACCTTC
TGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATCCAACTTCTTCACTAACTTC
TCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTTCAGACTCTGACAATGGGAC
CACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACCAGTTCACGGATGCCAGAAC
AGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGGTAATTCTGACTCGAAGGACAGAAGAGA
TGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAA
GAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCT
GGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAA
TAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAA
AAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGC
TTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGAT
CTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACT
AGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTG
TGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATT
TGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCA
TGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTT
TGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAG
AGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAG
CTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATT
TTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGC
TGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATA
CAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACC
ATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAA
CAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAA
TATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCC
AATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGC
CTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACA
CCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAA
TTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGA
TTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTT
GAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGA
ATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTT
CTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTT
TCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGA
AATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATT
AGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTT
CAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCA
GCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCT
GAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAGATCT
AAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGCTCAGGGCTGGCTGATCAAACTCAAGCTCACAC
CTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAGTTGTACAGAAAAAAAATGTTTTGGGTATAAAT
CTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTAACATTTTCTGTTAAAGGAAAGTCTACATTTTC
TGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTTTTTTAAACTATTTTCCTTAAAGCCGAAAATAT
TGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTTAAGGAAAGCAAGACGTCTTAAAGTATATTTTC
TTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCTGCCCTCACCCCCGGAGTTAAAGTGGGTAAGAG
TTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACTAGATGGCACTTGGTGCCTAGCCATGGTGAATG
ACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATGGAGTCCCACCCTCCTTCCCCCTTCCACCCTGC
GCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACAGCTGAGGAGTGGCCGGGCAGGCAGCAGGCTCC
CCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTGGAAGTCACGTCTTAGCTTCTGAACACCGTAGC
GGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAACTGCAGGAGACGCCCTGATGTGGAGTTTGTACA
GCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATTAGTAGCTTCTGTGGGGGGATCCCAGAGCCCCT
GTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGTCTTTCTCAGAATTGATATCTTAATATTGTCTG
TTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACATCTTTACTCTTATTGTCTGGACCTTCAAAGGG
CTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTGCCTGTCCGGATCTTGTCTCCTAGTCCTGAGGA
GCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCCAGAGTGCTCCCTCCAGGCCTGCTTCTTGGTTT
TGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTTGTCCTTCAATCATGTTTCCTCTCAGATGCGTC
CGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCACCCAGCTGTGGAAGCAGAGGTAGAAGACGAGGC
CAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCAAAAGCACAACTGAGGTGTGCGGGCTGGAGCTG
TCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCACTATTTCTCCTCTGCTTCAGAGGAAACCCAGG
AAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTGAGGGGGCCACCACTTTTCCTGGCTAGAAGCTA
CTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAGGGATTGGCCTGTCCCCTTTCCCTTTCTCGGCT
ATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATTCATCATTCCTTCCGAAACCCCTGATATTTAAT
ATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAGCCTCCTCCAGTACTAGCCTCAGTGTGGCTGCT
GCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGTCTACTGCTCAGGCTCTCCCACTTCGTGGCATC
CATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTGTTGCTCAGAGAGGTTGTCCTGAGGGGCTGGGT
GATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGAGCCTTGTCTGACCTTAATGCAAGCAGTCTGTT
TGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCCGGTCAGCGTTGCTAGGCAGGCTCGGCTGTCTG
GCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCATGCCGATGCGGCTTGTGGCACGGCTGGGATGT
GAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTCCTACCTGCCTCCCACGCCTCAGGTGTGGCTGC
CTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTGCAGTGTCTCTGACCCACGCCTCCCGCCTCCTG
GCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCCCAGTGTTTCCACTTATCTTGGATGTTTTAGAT
TGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCACCTCCCACTCTCCACTTCCCAGTTTGCAAATGT
GGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGCCTGGCTGCAAGGCCGCGCTGGGGCTCTGTCTT
GGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGACCTCCCTCATTCTTTTTGTCTCTTCTTTTTGCC
TAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCCACCTTTGGGGCTCGTGGTGGTGGAGAGGGCAG
CTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTCTGGAGGAAGGCCCGGGAATCTGCAAATGAGCG
CATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAGTCACCCTTAGGGCCACACCGTCCCTCTCCTCG
CTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACCAGGAAGCCCTATGACATCCTCAGGCTCCCCAG
ACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCCTGCTCTGCCCTCGTGCTTTGCTGGCCCCTGCC
CGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCCAGCGCTGCCCTCTGCCGTCCAGATGCTGCAGT
GTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGATCTGCAGTGGCTGTTTGACCAGACCACAAAGT
TCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTCCCCAAACTCTCCCTGCAGCCACATGTTTCCCA
TGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATGGCTTCCCTCCTGGAAGGCCCAGCCTGAGTCCT
CGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCACTTTGTGTCTCGCTTTGAGCACTTGCCACTCT
GGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGCTCCTCGTGGGCAGGGACCGCCTGTGTTCTCTG

>In-frame_PTPRA_ENST00000318266_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_7981nt
GCGGCCCGAAACGCCGCCGCGGAGCCGAGGCGGAGCCGCTGTCCTCGTCCCCAGCGGTCCCGCCCAACGCCCGACTCTGTGACACAACTA
AAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAAGGACACATGTTCAAAGAGCATAAT
TAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGATTTCTCTCACTGGCAACTCTTCAGAGTGCTGTTCC
TACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCAGTGCCAACAATG
CTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCAAAACTTCAAATC
CAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCACTGTCAATTCTT
CAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGCTTCCAGATAACC
AGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTTCAGATGAGACAC
CAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGTTTAAGAAATACA
AGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCACTTCTGGCCAGAT
CCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACGACAATAAGCTCT
TCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGGAAAAAAATCGAT
ATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCAATGCTTCATTCA
TCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGATGATCTGGGAAC
AAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAA
GAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACC
TCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGC
TCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACA
ATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAG
GAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAA
CTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAG
ATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATT
CTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATG
TAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCC
TCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGC
TCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCA
AAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAG
AAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAAC
AGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAA
GTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGC
CAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAA
CCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAG
TTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACA
TTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAGTTGAATATTTTT
GGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGCACTTCTTAACCC
AGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACAGGTTTCTACTAC
ACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGAGAGAAATTATTA
CAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTCGATTAGAGGAGT
TTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCAGCTTCAGAGTCC
CTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTCAGCAGCCCCACT
TCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACGAGCTGAGGGAAG
CCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAGATCTAAATGCGC
TTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGCTCAGGGCTGGCTGATCAAACTCAAGCTCACACCTGTACCT
GATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAGTTGTACAGAAAAAAAATGTTTTGGGTATAAATCTGGGTTT
TCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTAACATTTTCTGTTAAAGGAAAGTCTACATTTTCTGCCTGTT
CAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTTTTTTAAACTATTTTCCTTAAAGCCGAAAATATTGACAAAT
GGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTTAAGGAAAGCAAGACGTCTTAAAGTATATTTTCTTGAGATG
AGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCTGCCCTCACCCCCGGAGTTAAAGTGGGTAAGAGTTGGTTTG
TTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACTAGATGGCACTTGGTGCCTAGCCATGGTGAATGACCAGGGC
GAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATGGAGTCCCACCCTCCTTCCCCCTTCCACCCTGCGCAAAAGG
GGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACAGCTGAGGAGTGGCCGGGCAGGCAGCAGGCTCCCCAGCCAG
GGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTGGAAGTCACGTCTTAGCTTCTGAACACCGTAGCGGGTTATG
AGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAACTGCAGGAGACGCCCTGATGTGGAGTTTGTACAGCTTTGCC
AAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATTAGTAGCTTCTGTGGGGGGATCCCAGAGCCCCTGTATTTAT
TTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGTCTTTCTCAGAATTGATATCTTAATATTGTCTGTTCTAGGT
GTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACATCTTTACTCTTATTGTCTGGACCTTCAAAGGGCTTTGTAT
TTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTGCCTGTCCGGATCTTGTCTCCTAGTCCTGAGGAGCGGAGGC
TGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCCAGAGTGCTCCCTCCAGGCCTGCTTCTTGGTTTTGTTTGAT
CACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTTGTCCTTCAATCATGTTTCCTCTCAGATGCGTCCGTGATGC
CTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCACCCAGCTGTGGAAGCAGAGGTAGAAGACGAGGCCAGCCAGG
AGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCAAAAGCACAACTGAGGTGTGCGGGCTGGAGCTGTCTTGCAG
TGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCACTATTTCTCCTCTGCTTCAGAGGAAACCCAGGAAATGCCC
TTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTGAGGGGGCCACCACTTTTCCTGGCTAGAAGCTACTTGACCT
TTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAGGGATTGGCCTGTCCCCTTTCCCTTTCTCGGCTATGGGAAG
GAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATTCATCATTCCTTCCGAAACCCCTGATATTTAATATTTAATA
TTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAGCCTCCTCCAGTACTAGCCTCAGTGTGGCTGCTGCATAAGT
ATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGTCTACTGCTCAGGCTCTCCCACTTCGTGGCATCCATGTAAA
GTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTGTTGCTCAGAGAGGTTGTCCTGAGGGGCTGGGTGATTCCTG
GGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGAGCCTTGTCTGACCTTAATGCAAGCAGTCTGTTTGAACCCC
TGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCCGGTCAGCGTTGCTAGGCAGGCTCGGCTGTCTGGCCGGGAC
TTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCATGCCGATGCGGCTTGTGGCACGGCTGGGATGTGAGGGAGG
ACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTCCTACCTGCCTCCCACGCCTCAGGTGTGGCTGCCTGTGGGA
CCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTGCAGTGTCTCTGACCCACGCCTCCCGCCTCCTGGCCGACTT
GCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCCCAGTGTTTCCACTTATCTTGGATGTTTTAGATTGAAACAG
CCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCACCTCCCACTCTCCACTTCCCAGTTTGCAAATGTGGCTTTCG
CCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGCCTGGCTGCAAGGCCGCGCTGGGGCTCTGTCTTGGTGCACA
TGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGACCTCCCTCATTCTTTTTGTCTCTTCTTTTTGCCTAAAGCCA
GTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCCACCTTTGGGGCTCGTGGTGGTGGAGAGGGCAGCTGGTGTT
AAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTCTGGAGGAAGGCCCGGGAATCTGCAAATGAGCGCATTCCCC
AGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAGTCACCCTTAGGGCCACACCGTCCCTCTCCTCGCTGTCCCC
TCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACCAGGAAGCCCTATGACATCCTCAGGCTCCCCAGACCTGCAG
CTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCCTGCTCTGCCCTCGTGCTTTGCTGGCCCCTGCCCGCTACTC
CCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCCAGCGCTGCCCTCTGCCGTCCAGATGCTGCAGTGTGGCCAG
ATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGATCTGCAGTGGCTGTTTGACCAGACCACAAAGTTCACATCT
CCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTCCCCAAACTCTCCCTGCAGCCACATGTTTCCCATGACCTGT
GGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATGGCTTCCCTCCTGGAAGGCCCAGCCTGAGTCCTCGTCTCCT
TTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCACTTTGTGTCTCGCTTTGAGCACTTGCCACTCTGGCTGGTG
CTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGCTCCTCGTGGGCAGGGACCGCCTGTGTTCTCTGTATTTCCC

>In-frame_PTPRA_ENST00000356147_chr20_2998559_+_N4BP1_ENST00000262384_chr16_48596355_-_7903nt
GTGACACAACTAAAAAAAAACAAAGGTATTTATGGAATTCCACTGAGTGGTAATGGATGATGCAGTTCAAATAACTAAGGACACATGTTC
AAAGAGCATAATTAACTTTTTAAAAGAAGCTAGACTTCTTCAGAAGCTTGCCAGTTTTTCAAGCTGATTTCTCTCACTGGCAACTCTTCA
GAGTGCTGTTCCTACTCCACCCTCCCCTGGTGATAAGCATGGATTCCTGGTTCATTCTTGTTCTGCTCGGCAGTGGTCTGATATGTGTCA
GTGCCAACAATGCTACCACAGTTGCACCTTCTGTAGGAATTACAAGATTAATTAACTCATCAACGGCAGAACCAGTTAAAGAAGAGGCCA
AAACTTCAAATCCAACTTCTTCACTAACTTCTCTTTCTGTGGCACCAACATTCAGCCCAAATATAACTCTGGGACCCACCTATTTAACCA
CTGTCAATTCTTCAGACTCTGACAATGGGACCACAAGAACAGCAAGCACCAATTCTATAGGCATTACAATTTCACCAAATGGAACGTGGC
TTCCAGATAACCAGTTCACGGATGCCAGAACAGAACCCTGGGAGGGGAATTCCAGCACCGCAGCAACCACTCCAGAAACTTTCCCTCCTT
CAGATGAGACACCAATTATTGCGGTGATGGTGGCCCTGTCCTCTCTGCTAGTGATCGTGTTTATTATCATAGTTTTGTACATGTTAAGGT
TTAAGAAATACAAGCAAGCTGGGAGCCATTCCAATTCTTTCCGCTTATCCAACGGCCGCACTGAGGATGTGGAGCCCCAGAGTGTGCCAC
TTCTGGCCAGATCCCCAAGCACCAACAGGAAATACCCACCCCTGCCCGTGGACAAGCTGGAAGAGGAAATTAACCGGAGAATGGCAGACG
ACAATAAGCTCTTCAGGGAGGAATTCAACGCTCTCCCTGCATGTCCTATCCAGGCCACCTGTGAGGCTGCTTCCAAGGAGGAAAACAAGG
AAAAAAATCGATATGTAAACATCTTGCCTTATGACCACTCTAGAGTCCACCTGACACCGGTTGAAGGGGTTCCAGATTCTGATTACATCA
ATGCTTCATTCATCAACGGCTACCAAGAAAAGAACAAATTCATTGCTGCACAAGGACCAAAAGAAGAAACGGTGAATGATTTCTGGCGGA
TGATCTGGGAACAAAACACAGCCACCATCGTCATGGTTACCAACCTGAAGGAGAGAAAGGAGGAATATATTAAAGGAATCTGTGAACCTG
AACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATA
CTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAAC
AATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAG
CCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATC
TCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTT
CTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTT
CTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGA
GATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACAT
TGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGG
AATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTG
AACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGA
CCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGC
AAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAG
TGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTG
TTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTT
TACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGC
CAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATA
TTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGG
ATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCCATGGTCTGAAAAAGTTCTTTTCTTGTCGTGGAATTGCAATTGCAG
TTGAATATTTTTGGAAGCTTGGCAACAGAAACATCACTGTATTTGTCCCTCAGTGGAGAACAAGGCGTGATCCTAATGTCACAGAACAGC
ACTTCTTAACCCAGCTCCAGGAGCTCGGAATATTATCTTTAACTCCTGCCCGGATGGTCTTTGGAGAAAGAATTGCTTCTCATGATGACA
GGTTTCTACTACACTTAGCGGACAAAACTGGTGGCATAATTGTGACAAATGATAATTTCAGAGAATTTGTGAATGAGTCAGTCTCTTGGA
GAGAAATTATTACAAAAAGGCTGCTGCAGTACACGTTCGTGGGGGACATATTTATGGTTCCCGATGATCCTCTGGGAAGAAGTGGACCTC
GATTAGAGGAGTTTCTTCAGAAGGAAGTCTGTCTTAGAGATATGCAGCCCCTACTCAGTGCCCTGCCAAATGTGGGCATGTTTGACCCCA
GCTTCAGAGTCCCTGGCACCCAGGCAGCCAGCACCAGCCACCAGCCTCCGACCCGGATTCAGGGAGCCCCTTCAAGCCACTGGCTCCCTC
AGCAGCCCCACTTCCCACTGCTGCCAGCCCTCCCCAGTCTCCAGCAGAACCTGCCCATGCCAGCTCAGAGATCTTCTGCAGAAACCAACG
AGCTGAGGGAAGCCCTTCTGAAGATCTTCCCTGACTCAGAGCAAAGACTGAAAATAGACCAGATCTTGGTGGCCCACCCATACATGAAAG
ATCTAAATGCGCTTTCTGCCATGGTGTTGGATTGAAGATTGTGCTGAGCGCTGAGCTTGCGCTCAGGGCTGGCTGATCAAACTCAAGCTC
ACACCTGTACCTGATGGGAATGAACATAATGTGAAGAAACTTATTTCCCAGTGTAAACGCAGTTGTACAGAAAAAAAATGTTTTGGGTAT
AAATCTGGGTTTTCAAAACCAGCTTTTTTCTATATATAAATTATGCTGCTATTACAGATTTAACATTTTCTGTTAAAGGAAAGTCTACAT
TTTCTGCCTGTTCAGAACTGTTTAATAGCAGTTACTCTTGAGTGTATTTACCTTTTTATGTTTTTTAAACTATTTTCCTTAAAGCCGAAA
ATATTGACAAATGGATATGGTTAGCCTTTATAAATAAATAAAAAAAAAAGTGTTGCTTTCTTAAGGAAAGCAAGACGTCTTAAAGTATAT
TTTCTTGAGATGAGTATGTCCCATCACTACCATGAAGTGTGCTCACCCTTCCAGCCTCCTCTGCCCTCACCCCCGGAGTTAAAGTGGGTA
AGAGTTGGTTTGTTCTGCAGTCTTTGGTTGGAGTGTTGTGAAAGTGGACCCGCGGTGCCACTAGATGGCACTTGGTGCCTAGCCATGGTG
AATGACCAGGGCGAAGTTAGTCTCACAGAATACCAGGGCTAGAAGACATCGTGGAGCCCATGGAGTCCCACCCTCCTTCCCCCTTCCACC
CTGCGCAAAAGGGGACGGCCCAGTGTGCACGCCGTCCGGCCATGCCCACAGCCACAGCCACAGCTGAGGAGTGGCCGGGCAGGCAGCAGG
CTCCCCAGCCAGGGCTTGACACGCCCACAGTCAGGGGCCTCCACATGCCTGGCCTGGCTCTGGAAGTCACGTCTTAGCTTCTGAACACCG
TAGCGGGTTATGAGGAAGTTTAATGAAGAGCCCGGTCACTGTGGCCATCTTGTGTCCCCAACTGCAGGAGACGCCCTGATGTGGAGTTTG
TACAGCTTTGCCAAAAAATGGTTTTCTATTCTCAAAAGTGACCCAAGCCAATAAATAGCATTAGTAGCTTCTGTGGGGGGATCCCAGAGC
CCCTGTATTTATTTTCCCTGTGTTTGTCTCTAGTGTCCTCCTAAACAGCCTTTCCTGTGAGTCTTTCTCAGAATTGATATCTTAATATTG
TCTGTTCTAGGTGTTGCCCAAATTCAGTGTCAGTGAAGTTCTTTTCCTGGGCAATCTTAACATCTTTACTCTTATTGTCTGGACCTTCAA
AGGGCTTTGTATTTTACACCTGCGCCCCCAGGCTGCTCACAGTCGGCTTGCTGCCTGTCCTGCCTGTCCGGATCTTGTCTCCTAGTCCTG
AGGAGCGGAGGCTGAGAACTCAGTGCTGGTTTGTAAATGGTGAGGGGACTTGGGGGCATCCCAGAGTGCTCCCTCCAGGCCTGCTTCTTG
GTTTTGTTTGATCACTGCGTTCTTCAAGGGATGAATCCAGAGCCCTCCATGAGGCCAAGCTTGTCCTTCAATCATGTTTCCTCTCAGATG
CGTCCGTGATGCCTCCTAATGTGGAACTGGTTGTCCATTGTTTGGGCCTATGGCCAAGTCACCCAGCTGTGGAAGCAGAGGTAGAAGACG
AGGCCAGCCAGGAGGGCGACTTCAGTCACAGCTCCCATGCCTCAGCTTTGTACCTGTTTTCAAAAGCACAACTGAGGTGTGCGGGCTGGA
GCTGTCTTGCAGTGATTCTGGCCTTCTGGCTCATGGTTCAGTCCAGCAGCCTGGCTGACCCACTATTTCTCCTCTGCTTCAGAGGAAACC
CAGGAAATGCCCTTACTGCCAGGCTGAGTCTCCACCCATGCTGGTTGGTGCTGGCTAGGCTGAGGGGGCCACCACTTTTCCTGGCTAGAA
GCTACTTGACCTTTGATGTTTGAGTTCTGTAAGTCTTCGTGTTCTGACTTACTGCTTCAGAGGGATTGGCCTGTCCCCTTTCCCTTTCTC
GGCTATGGGAAGGAAGGATTGCTCATTGGTTGCCTTCATCAGTTACAGCATGAGACGGAATTCATCATTCCTTCCGAAACCCCTGATATT
TAATATTTAATATTTAAAAACCCAAATTATCAAACCATTAAGAACTCATTACTGGTTCTCAGCCTCCTCCAGTACTAGCCTCAGTGTGGC
TGCTGCATAAGTATCTGTAGCCTGTCTACCTCCTGCAGTGGGGCCGCTCGCCTCTTCCCTGTCTACTGCTCAGGCTCTCCCACTTCGTGG
CATCCATGTAAAGTAGGTGGCAGGGCAGAGATGTCACTCTCATTCAACAGGGAGGATGTCTGTTGCTCAGAGAGGTTGTCCTGAGGGGCT
GGGTGATTCCTGGGCCTACATTCTTCCCGAGGCTCCAGGCCGCTGTCTCTGGAAGTAAAAGAGCCTTGTCTGACCTTAATGCAAGCAGTC
TGTTTGAACCCCTGTAGGCTGCATTCAGGAGACAGAAGGTGTCTGGGCCATCCTGGGCGGCCGGTCAGCGTTGCTAGGCAGGCTCGGCTG
TCTGGCCGGGACTTGGGCCTGGGTGGCTTTTGAGACCAGTGAAGAAGGGAGAGCCGGCCTCATGCCGATGCGGCTTGTGGCACGGCTGGG
ATGTGAGGGAGGACTCAGATCTACACACAGAAACCCCTCTTCTCCCCGCCCTCCCCCAGCTCCTACCTGCCTCCCACGCCTCAGGTGTGG
CTGCCTGTGGGACCATCCCCCAACCCCTTTCCTCGCACCTCCTTGTCCTCACCCAGTTCCTGCAGTGTCTCTGACCCACGCCTCCCGCCT
CCTGGCCGACTTGCCCAGGAGGTGTCTCTGGCTCACCTCCGTCTGTTCATCACCTTCCTCCCCAGTGTTTCCACTTATCTTGGATGTTTT
AGATTGAAACAGCCTGATTCCCGGAAGAATCCTCTTCATTCATTGCTAGTGCTTCCCCTCACCTCCCACTCTCCACTTCCCAGTTTGCAA
ATGTGGCTTTCGCCCACCAAGTGAAAGCGGACTGAGAGCAGCCCTTGGGGACGGCCCGGTGCCTGGCTGCAAGGCCGCGCTGGGGCTCTG
TCTTGGTGCACATGGCTTGACCGGACTTTCCCTGCTTCCCACCACTTCCCTCACTCCCAGACCTCCCTCATTCTTTTTGTCTCTTCTTTT
TGCCTAAAGCCAGTCCTTAACACCCTATTCTTCCTCTGCAGGTGGCTTGCAGACTTTTCCCCACCTTTGGGGCTCGTGGTGGTGGAGAGG
GCAGCTGGTGTTAAGAATGTAGGTTACCGGGCATGACCCGGCAGATGCTTGCCCAGTAGTTCTGGAGGAAGGCCCGGGAATCTGCAAATG
AGCGCATTCCCCAGGCAGTTCCCATGCAGGTGATCCACGGACCACATGTTGAGAAACTGCAGTCACCCTTAGGGCCACACCGTCCCTCTC
CTCGCTGTCCCCTCTCTGTAGTGACTGGCCCTGACCTTCAGGAGTGCACTTTCCACTCTACCAGGAAGCCCTATGACATCCTCAGGCTCC
CCAGACCTGCAGCTTGCATGGGGCCCCTCCCTTCTTCCACACCCACCCTCCGTATGGTCCCCTGCTCTGCCCTCGTGCTTTGCTGGCCCC
TGCCCGCTACTCCCACTCTCAGACACCCAGGGGTGGTGGGCCCTAACTGGCTGGCCCCTCCCAGCGCTGCCCTCTGCCGTCCAGATGCTG
CAGTGTGGCCAGATTTACCTTCCAGTAACATACTTCTAGTCACCCCTCCTCCTGCGAAGTGATCTGCAGTGGCTGTTTGACCAGACCACA
AAGTTCACATCTCCTGAGCTTAGTGTCCGTGGCTGTCCACCTCCCAGCCATACTTGACTGTCCCCAAACTCTCCCTGCAGCCACATGTTT
CCCATGACCTGTGGGCTCTGCAGATGGACCTCTCTCCGCTAGAGATGCCCTTCTCCCAAATGGCTTCCCTCCTGGAAGGCCCAGCCTGAG
TCCTCGTCTCCTTTCCAGTGCTTCTGCCAGAAGCATCCCCATGATGTTGTGACCGCACAGCACTTTGTGTCTCGCTTTGAGCACTTGCCA
CTCTGGCTGGTGCTGCTGCCACTGATTGTGTACTGTCTTGCTGCCCTTTCTAGACTGTGAGCTCCTCGTGGGCAGGGACCGCCTGTGTTC


Top

FusionGenePPI for PTPRA_N4BP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPRAGRB2, KCNA2, SRC, FYN, UVRAG, GABARAPL2, CALM1, LGALS8, FCN1, HSPB1, YWHAZ, SMEK1, EGFR, ERBB2, ARL2, ATXN2, KCNMA1, NCBP1, PSAT1, PTPRE, VPS25, TMEM51, CCDC88A, EPB41L1, PSD3, BASP1, GPRIN3, EXOC3, BAIAP2, RAPH1, NF2, GAB1, ASNSD1, DENND4A, TPCN2, SP4, CYB561, GALNT12, LGALS1, PTPRA, TXNDC5, XPO5, TNPO3, SAAL1, XPO4, B4GAT1, XPO6, PDIA6, NCDN, CSE1L, TNPO1, XPOT, CANX, MBP, PTPRGN4BP1LSM1, ITCH, AZI2, UBC, CUL3, CDK6, FAM114A1, HYPK, CDH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPRA_N4BP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPRA_N4BP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPRAC0036341Schizophrenia2PSYGENET
HgenePTPRAC0151744Myocardial Ischemia1CTD_human