FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29434

FusionGeneSummary for PTPN1_PREX1

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPN1_PREX1
Fusion gene ID: 29434
HgeneTgene
Gene symbol

PTPN1

PREX1

Gene ID

5770

57580

Gene nameprotein tyrosine phosphatase, non-receptor type 1phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1
SynonymsPTP1BP-REX1
Cytomap

20q13.13

20q13.13

Type of geneprotein-codingprotein-coding
Descriptiontyrosine-protein phosphatase non-receptor type 1protein tyrosine phosphatase, placentalprotein-tyrosine phosphatase 1Bphosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 proteinPIP3 dependent Rac exchange factor 1ptdIns(3,4,5)-dependent Rac exchanger 1
Modification date2018052220180523
UniProtAcc

P18031

Q8TCU6

Ensembl transtripts involved in fusion geneENST00000371621, ENST00000541713, 
ENST00000371941, ENST00000396220, 
ENST00000496915, 
Fusion gene scores* DoF score7 X 4 X 5=1404 X 5 X 2=40
# samples 86
** MAII scorelog2(8/140*10)=-0.807354922057604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/40*10)=0.584962500721156
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PTPN1 [Title/Abstract] AND PREX1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPN1

GO:0030100

regulation of endocytosis

21135139

HgenePTPN1

GO:0030968

endoplasmic reticulum unfolded protein response

22169477

HgenePTPN1

GO:0035335

peptidyl-tyrosine dephosphorylation

21135139

HgenePTPN1

GO:0061098

positive regulation of protein tyrosine kinase activity

21216966

HgenePTPN1

GO:1903898

negative regulation of PERK-mediated unfolded protein response

21216966


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E2-A15E-06APTPN1chr20

49191191

+PREX1chr20

47361684

-
TCGALDBRCATCGA-E2-A15E-01APTPN1chr20

49191191

+PREX1chr20

47361684

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371621ENST00000371941PTPN1chr20

49191191

+PREX1chr20

47361684

-
In-frameENST00000371621ENST00000396220PTPN1chr20

49191191

+PREX1chr20

47361684

-
5CDS-intronENST00000371621ENST00000496915PTPN1chr20

49191191

+PREX1chr20

47361684

-
In-frameENST00000541713ENST00000371941PTPN1chr20

49191191

+PREX1chr20

47361684

-
In-frameENST00000541713ENST00000396220PTPN1chr20

49191191

+PREX1chr20

47361684

-
5CDS-intronENST00000541713ENST00000496915PTPN1chr20

49191191

+PREX1chr20

47361684

-

Top

FusionProtFeatures for PTPN1_PREX1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPN1

P18031

PREX1

Q8TCU6

Tyrosine-protein phosphatase which acts as a regulatorof endoplasmic reticulum unfolded protein response. Mediatesdephosphorylation of EIF2AK3/PERK; inactivating the protein kinaseactivity of EIF2AK3/PERK. May play an important role in CKII- andp60c-src-induced signal transduction cascades. May regulate theEFNA5-EPHA3 signaling pathway which modulates cell reorganizationand cell-cell repulsion. May also regulate the hepatocyte growthfactor receptor signaling pathway through dephosphorylation ofMET. {ECO:0000269|PubMed:18819921, ECO:0000269|PubMed:21135139,ECO:0000269|PubMed:22169477}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePREX1chr20:49191191chr20:47361684ENST00000371941-140271_392971660DomainPH
TgenePREX1chr20:49191191chr20:47361684ENST00000371941-140421_496971660DomainDEP 1
TgenePREX1chr20:49191191chr20:47361684ENST00000371941-140523_597971660DomainDEP 2
TgenePREX1chr20:49191191chr20:47361684ENST00000371941-140625_703971660DomainPDZ
TgenePREX1chr20:49191191chr20:47361684ENST00000396220-139271_392972042DomainPH
TgenePREX1chr20:49191191chr20:47361684ENST00000396220-139421_496972042DomainDEP 1
TgenePREX1chr20:49191191chr20:47361684ENST00000396220-139523_597972042DomainDEP 2
TgenePREX1chr20:49191191chr20:47361684ENST00000396220-139625_703972042DomainPDZ

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPN1chr20:49191191chr20:47361684ENST00000371621+5103_277164436DomainTyrosine-protein phosphatase
HgenePTPN1chr20:49191191chr20:47361684ENST00000371621+510215_221164436RegionSubstrate binding
TgenePREX1chr20:49191191chr20:47361684ENST00000371941-14049_240971660DomainDH
TgenePREX1chr20:49191191chr20:47361684ENST00000396220-13949_240972042DomainDH


Top

FusionGeneSequence for PTPN1_PREX1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_1727aa
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLPN
TCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENLTVLFSNIEDILEVHKDF
LAALETCLHPEPQSQHELGNVFLKFKDKFCVYEETCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYP
LLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFL
FDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGTTVTNGWKIHNTAKNKWFVCMAKTAEEKQKW
LDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLEN
GIIHHVSDKHQFKNEQVMTRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQTREE
AVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDTGFDIEEKNKAVVVKSVQR
GSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGAAPPYVTAVGRGSEAMAA
GLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRL
SLCEDSPMVTLTVDNVHLEHGVVTETVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSAIVTMPHFEFRNIC
DTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLN
PMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQTVTQINRL
LSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSTRDSYSECNSNRDSVLSYTSVRSNSSYL
GSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRGRSLIQISIQEDPW
NLPNSIKTLVDNIQRTVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAA
TGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENTVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRL
HTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQTYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPK
PGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNLRVKDQMPQG

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_164aa
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLPN

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_1654aa
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENL
TVLFSNIEDILEVHKDFLAALETCLHPEPQSQHELGNVFLKFKDKFCVYEETCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDI
PLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQG
TLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGTTVTNGWKIHNTAK
NKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGE
ISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMTRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGS
KLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDTG
FDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGA
APPYVTAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQE
EDQADSAFPLLSLGPRLSLCEDSPMVTLTVDNVHLEHGVVTETVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMA
LSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRF
GRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKL
DVALKEMKQTVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSTRDSYSECNSN
RDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEEC
TIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRTVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEY
EESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENTVANTNVFYHIEGSRQALKVIFYLDSY
HFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQTYRKLRAFYLERSNLPTDASTTAVKIDQLIRPI
NALDELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPR

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_91aa
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENL

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_1727aa
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLPN
TCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENLTVLFSNIEDILEVHKDF
LAALETCLHPEPQSQHELGNVFLKFKDKFCVYEETCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYP
LLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFL
FDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGTTVTNGWKIHNTAKNKWFVCMAKTAEEKQKW
LDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLEN
GIIHHVSDKHQFKNEQVMTRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQTREE
AVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDTGFDIEEKNKAVVVKSVQR
GSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGAAPPYVTAVGRGSEAMAA
GLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRL
SLCEDSPMVTLTVDNVHLEHGVVTETVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSAIVTMPHFEFRNIC
DTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLN
PMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQTVTQINRL
LSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSTRDSYSECNSNRDSVLSYTSVRSNSSYL
GSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEECTIRGRSLIQISIQEDPW
NLPNSIKTLVDNIQRTVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAA
TGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENTVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRL
HTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQTYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPK
PGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILAKNLRVKDQMPQG

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_164aa
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDTINASLIKMEEAQRSYILTQGPLPN

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_1654aa
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENL
TVLFSNIEDILEVHKDFLAALETCLHPEPQSQHELGNVFLKFKDKFCVYEETCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDI
PLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQG
TLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGTTVTNGWKIHNTAK
NKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGE
ISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMTRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGS
KLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILPQEEDTG
FDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRLLVATKAKEIIKIPDQPDTLCFQIRGA
APPYVTAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQE
EDQADSAFPLLSLGPRLSLCEDSPMVTLTVDNVHLEHGVVTETVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMA
LSSAIVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVSYPKTTPSVGRSFSIRF
GRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSFGPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKL
DVALKEMKQTVTQINRLLSTITEPTSGGSCDASLAEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSTRDSYSECNSN
RDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEFKQKEEC
TIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRTVEDGKNQLLLALLKCTDTELQLRRDAIFCQALVAAVCTFSKQLLAALGYRYNNNGEY
EESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIWVTLSELDNVTFSFKQLDENTVANTNVFYHIEGSRQALKVIFYLDSY
HFSKLPSRLEGGASLRLHTALFTKVLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQTYRKLRAFYLERSNLPTDASTTAVKIDQLIRPI
NALDELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPR

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_91aa
MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSTTTVRQLELENL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_5181nt
ATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTC
CCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACAT
CAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAAC
ACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAA
TGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAG
TCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTC
TTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGC
GTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTG
AGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCG
CTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTT
TGCTCCAACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCC
AACCTCACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTC
TTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCC
CTCTACATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTAT
ACCGTCACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGG
CTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGG
GAGAAGCTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTT
GGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAAT
GGCATCATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCC
CGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGAT
TACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAG
GCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTC
CGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCC
AAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGG
GGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAG
GTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCC
GACCAGCCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCA
GGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCA
TTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAG
GCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTG
AGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCA
GGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAAT
GACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGT
GACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAA
CAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAG
ACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAAC
CCCATGTCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAG
GGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGT
GAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTG
CTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAG
AGCGAGATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACC
ATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTG
GGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAG
CACCTCTTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATG
AACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGG
AACCTCCCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAG
TGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTG
GCGGCCCTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCC
ACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTG
TCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGC
CGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTG
CACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATC
AACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGC
ACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAG
CCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGT
GGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATC
ATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGT

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_492nt
ATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTC
CCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACAT
CAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAAC
ACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAA
TGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAG

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_4962nt
ATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAA
AGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATG
ATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTT
ACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCGCAG
TCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCCCTG
AGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGACATC
CCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAG
CACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAGAAG
CTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAAGGG
ACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCCAGG
GTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTCATG
GAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCCAAG
AATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAGAGC
CTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTGAAC
CTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAA
ATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTCAAG
AATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTGAGG
CTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGGAGC
AAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGCTTC
ATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGCAGC
AAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTATGGC
TTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGG
AAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGCCGC
CCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGAGCT
GCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAATGGC
AGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAG
TGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAG
GAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACTGTG
GACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAGCCC
CGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATGGCC
CTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCCTGC
TACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTGGAC
TTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTT
GGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATGGCT
GCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGGACC
CTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAGCTG
GATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCCTGC
GACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAGAAG
GTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGCAAT
CGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCCTGT
GACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTCCTC
AAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAGTGT
ACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAACATT
CAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCGATC
TTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAGTAC
GAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCA
GCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAGCTG
GACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGCTAC
CACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTGGAG
GGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGC
AAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATC
AATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCC
ATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTG
GAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGG
GTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTGGAT

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_273nt
ATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAA
AGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATG
ATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTT

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_5181nt
ATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTC
CCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACAT
CAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAAC
ACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAA
TGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAG
TCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTC
TTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGC
GTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTG
AGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCG
CTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTT
TGCTCCAACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCC
AACCTCACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTC
TTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCC
CTCTACATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTAT
ACCGTCACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGG
CTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGG
GAGAAGCTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTT
GGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAAT
GGCATCATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCC
CGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGAT
TACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAG
GCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTC
CGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCC
AAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGG
GGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAG
GTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCC
GACCAGCCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCA
GGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCA
TTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAG
GCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTG
AGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCA
GGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAAT
GACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGT
GACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAA
CAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAG
ACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAAC
CCCATGTCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAG
GGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGT
GAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTG
CTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAG
AGCGAGATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACC
ATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTG
GGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAG
CACCTCTTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATG
AACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGG
AACCTCCCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAG
TGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTG
GCGGCCCTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCC
ACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTG
TCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGC
CGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTG
CACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATC
AACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGC
ACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAG
CCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGT
GGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATC
ATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGT

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_492nt
ATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTC
CCATGTAGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACAT
CAAGAAGATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAAC
ACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAA
TGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAG

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_4962nt
ATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAA
AGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATG
ATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTT
ACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCGCAG
TCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCCCTG
AGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGACATC
CCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAG
CACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAGAAG
CTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAAGGG
ACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCCAGG
GTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTCATG
GAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCCAAG
AATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAGAGC
CTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTGAAC
CTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAA
ATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTCAAG
AATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTGAGG
CTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGGAGC
AAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGCTTC
ATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGCAGC
AAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTATGGC
TTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGG
AAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGCCGC
CCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGAGCT
GCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAATGGC
AGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAG
TGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAG
GAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACTGTG
GACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAGCCC
CGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATGGCC
CTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCCTGC
TACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTGGAC
TTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTT
GGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATGGCT
GCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGGACC
CTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAGCTG
GATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCCTGC
GACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAGAAG
GTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGCAAT
CGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCCTGT
GACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTCCTC
AAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAGTGT
ACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAACATT
CAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCGATC
TTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAGTAC
GAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCA
GCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAGCTG
GACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGCTAC
CACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTGGAG
GGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGC
AAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATC
AATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCC
ATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTG
GAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGG
GTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTGGAT

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_273nt
ATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAGAAA
AGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAGATG
ATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAACCTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_6988nt
GTGATGCGTAGTTCCGGCTGCCGGTTGACATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCC
TCGGGGCTAAGAGCGCGACGCGGCCTAGAGCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAG
ATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTCCCATGT
AGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAA
GATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGC
GGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCA
CAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATAT
TATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCC
GCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTAC
GAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGC
ATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTC
CTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCC
AACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTC
ACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGAC
AACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTAC
ATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTC
ACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGAT
GCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAG
CTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAAT
GAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATC
ATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGT
GAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCAC
CTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTG
GCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTT
CATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGC
CTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCG
CTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAG
TCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAG
CCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTC
TGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGG
AGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCC
ACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTG
TGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTC
AGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGC
GTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACC
AAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCC
CCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACC
CCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATG
TCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTC
CATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATC
CAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCC
ACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAG
ATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGT
TATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGC
GACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTC
TTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCAC
AGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTC
CCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACA
GACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCC
CTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGC
GTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAG
CTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAG
GCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACA
GCGCTGTTCACGAAAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCG
CAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACG
GCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGT
GCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACA
GGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAG
GCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCG
CGCCTCTACCGCCTCTGCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGAT
TTGGGAGGACACAGCAGGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTC
CCTGCCTCCTTCCGGGACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTG
CCAGAAGCTGGAGGGGTGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGG
AACGTCATGGAGGCCACATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACAT
TCCAGGTGACCACACGTGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAG
ACTTGGCTCTGTCGGGAAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACC
GCCCCTGGAACTGGGGCCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTT
TTTGTTGTTGGTGTTGTCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCT
AACAGGGGACCAACAGAAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAA
ATTAAAAAATGTCATTGTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTC
CATTCTCCAGCGGTTGGCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCT
GGAGGGGATGGAGCCCCACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTT
CTTGATGGTAACTTCTCAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCAC
ACAAGCCCCCTCGGCAGTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCAC
CCCTGGCAGGTGGTGAGTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTC
CCGCCCTCCAGGGTGCGCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAG
GAGGACCCGCTTTAGCCCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCT

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_7089nt
GTGATGCGTAGTTCCGGCTGCCGGTTGACATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCC
TCGGGGCTAAGAGCGCGACGCGGCCTAGAGCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAG
ATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTCCCATGT
AGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAA
GATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGC
GGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCA
CAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATAT
TATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCC
GCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTAC
GAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGC
ATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTC
CTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCC
AACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTC
ACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGAC
AACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTAC
ATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTC
ACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGAT
GCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAG
CTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAAT
GAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATC
ATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGT
GAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCAC
CTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTG
GCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTT
CATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGC
CTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCG
CTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAG
TCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAG
CCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTC
TGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGG
AGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCC
ACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTG
TGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTC
AGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGC
GTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACC
AAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCC
CCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACC
CCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATG
TCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTC
CATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATC
CAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCC
ACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAG
ATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGT
TATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGC
GACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTC
TTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCAC
AGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTC
CCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACA
GACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCC
CTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGC
GTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAG
CTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAG
GCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACA
GCGCTGTTCACGAAAGGTGAGCTTCAGGCCTGGGGCAGGGAGGACCACGGGGGCCGGGCCAAGGCCACCAAGCACACCGGCTCCCAACCG
CCTGCCCGCCCCCGACATCTCCCCTCCCAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGC
AGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGG
ATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCC
ACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGG
TCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCA
AGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGC
CCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCC
TCTGGAGCTGGGATTTGGGAGGACACAGCAGGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACC
TGCCCAGCGTCCTCCCTGCCTCCTTCCGGGACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCAT
TCTTCACACGCCTGCCAGAAGCTGGAGGGGTGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCC
CCAGAACCCAAGGGAACGTCATGGAGGCCACATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCC
TTCAACGTCCACATTCCAGGTGACCACACGTGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGG
TGGACTTGGAAAAGACTTGGCTCTGTCGGGAAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAG
CTCTGGACATCACCGCCCCTGGAACTGGGGCCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGT
TTATTTTGGGATTTTTTGTTGTTGGTGTTGTCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGA
AAGGTATGTTGTCTAACAGGGGACCAACAGAAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAAC
TAAATTATTGAAAAATTAAAAAATGTCATTGTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTC
CTTCCCCCACCCTCCATTCTCCAGCGGTTGGCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAG
CCAGGGTTGGAGCTGGAGGGGATGGAGCCCCACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTT
CTGTGATTTATTTTCTTGATGGTAACTTCTCAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGG
GAGGAGGGACCCACACAAGCCCCCTCGGCAGTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGG
GGGACGCCTGTCACCCCTGGCAGGTGGTGAGTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCT
GGCATCCGAGCCTCCCGCCCTCCAGGGTGCGCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTG
CATCAGAGACAAAGGAGGACCCGCTTTAGCCCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAA

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_6868nt
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCGGGGCTAAGAGCGCGACGCGGCCTAGA
GCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAA
GTCCGGGAGCTGGGCGGCCATTTACCAGTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAACGCTAGTTTGATA
AAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAG
AAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAG
ATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAAC
CTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCG
CAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCC
CTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGAC
ATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGC
AAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAG
AAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAA
GGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCC
AGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTC
ATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCC
AAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAG
AGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTG
AACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGT
GAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTC
AAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTG
AGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGG
AGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGC
TTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGC
AGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTAT
GGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGG
AGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGC
CGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGA
GCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAAT
GGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTAC
CAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAG
GAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACT
GTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAG
CCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATG
GCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCC
TGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTG
GACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGC
TTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATG
GCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGG
ACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAG
CTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCC
TGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAG
AAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGC
AATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCC
TGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTC
CTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAG
TGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAAC
ATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCG
ATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAG
TACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCG
CCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAG
CTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGC
TACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTG
GAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTAC
CGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCC
ATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATC
CCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCC
CTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCA
AGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTG
GATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGATTTGGGAGGACACAGCAGGCAGCGCTGGCCT
TCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTCCCTGCCTCCTTCCGGGACAAGCCTGGCCAC
CCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTGCCAGAAGCTGGAGGGGTGCTGGAGACCCAT
AGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGGAACGTCATGGAGGCCACATGGGGCCACCCG
GCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACATTCCAGGTGACCACACGTGTCTCCTCCTCCT
CATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAGACTTGGCTCTGTCGGGAAAGGAGAGACGGG
GCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACCGCCCCTGGAACTGGGGCCACCAGCCCTGGG
CACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTTTTTGTTGTTGGTGTTGTCAAAGTTTGTTTT
TTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCTAACAGGGGACCAACAGAAGGTAGTATTGAC
AACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAAATTAAAAAATGTCATTGTTTCCTGTTTGTT
AATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTCCATTCTCCAGCGGTTGGCCGGTGTTAGAAC
TCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCTGGAGGGGATGGAGCCCCACCTGAGGTGCCG
TGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTTCTTGATGGTAACTTCTCAGAGCAGGGCGAT
TGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCACACAAGCCCCCTCGGCAGTTTGTCCCCCCAG
CTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCACCCCTGGCAGGTGGTGAGTTCAGGTGGGGGC
TCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTCCCGCCCTCCAGGGTGCGCTTCCCTCTCTTG
CCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAGGAGGACCCGCTTTAGCCCTGCTGCGGGAAA
TGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCTTCTCGTTAAATTCTTGATAGATTTTTTATT

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_6969nt
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCGGGGCTAAGAGCGCGACGCGGCCTAGA
GCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAA
GTCCGGGAGCTGGGCGGCCATTTACCAGTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAACGCTAGTTTGATA
AAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAG
AAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAG
ATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAAC
CTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCG
CAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCC
CTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGAC
ATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGC
AAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAG
AAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAA
GGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCC
AGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTC
ATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCC
AAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAG
AGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTG
AACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGT
GAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTC
AAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTG
AGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGG
AGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGC
TTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGC
AGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTAT
GGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGG
AGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGC
CGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGA
GCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAAT
GGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTAC
CAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAG
GAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACT
GTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAG
CCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATG
GCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCC
TGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTG
GACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGC
TTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATG
GCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGG
ACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAG
CTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCC
TGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAG
AAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGC
AATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCC
TGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTC
CTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAG
TGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAAC
ATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCG
ATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAG
TACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCG
CCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAG
CTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGC
TACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGGTGAGCTTCAGGCC
TGGGGCAGGGAGGACCACGGGGGCCGGGCCAAGGCCACCAAGCACACCGGCTCCCAACCGCCTGCCCGCCCCCGACATCTCCCCTCCCAG
TGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAG
TTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACC
AGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGG
GCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCA
CCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGC
GGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCT
GCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGATTTGGGAGGACACAGCA
GGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTCCCTGCCTCCTTCCGGG
ACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTGCCAGAAGCTGGAGGGG
TGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGGAACGTCATGGAGGCCA
CATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACATTCCAGGTGACCACACG
TGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAGACTTGGCTCTGTCGGG
AAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACCGCCCCTGGAACTGGGG
CCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTTTTTGTTGTTGGTGTTG
TCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCTAACAGGGGACCAACAG
AAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAAATTAAAAAATGTCATT
GTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTCCATTCTCCAGCGGTTG
GCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCTGGAGGGGATGGAGCCC
CACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTTCTTGATGGTAACTTCT
CAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCACACAAGCCCCCTCGGCA
GTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCACCCCTGGCAGGTGGTGA
GTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTCCCGCCCTCCAGGGTGC
GCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAGGAGGACCCGCTTTAGC
CCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCTTCTCGTTAAATTCTTG

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_6988nt
GTGATGCGTAGTTCCGGCTGCCGGTTGACATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCC
TCGGGGCTAAGAGCGCGACGCGGCCTAGAGCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAG
ATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTCCCATGT
AGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAA
GATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGC
GGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCA
CAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATAT
TATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCC
GCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTAC
GAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGC
ATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTC
CTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCC
AACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTC
ACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGAC
AACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTAC
ATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTC
ACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGAT
GCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAG
CTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAAT
GAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATC
ATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGT
GAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCAC
CTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTG
GCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTT
CATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGC
CTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCG
CTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAG
TCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAG
CCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTC
TGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGG
AGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCC
ACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTG
TGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTC
AGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGC
GTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACC
AAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCC
CCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACC
CCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATG
TCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTC
CATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATC
CAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCC
ACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAG
ATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGT
TATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGC
GACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTC
TTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCAC
AGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTC
CCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACA
GACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCC
CTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGC
GTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAG
CTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAG
GCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACA
GCGCTGTTCACGAAAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCG
CAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACG
GCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGT
GCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACA
GGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAG
GCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCG
CGCCTCTACCGCCTCTGCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGAT
TTGGGAGGACACAGCAGGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTC
CCTGCCTCCTTCCGGGACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTG
CCAGAAGCTGGAGGGGTGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGG
AACGTCATGGAGGCCACATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACAT
TCCAGGTGACCACACGTGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAG
ACTTGGCTCTGTCGGGAAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACC
GCCCCTGGAACTGGGGCCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTT
TTTGTTGTTGGTGTTGTCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCT
AACAGGGGACCAACAGAAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAA
ATTAAAAAATGTCATTGTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTC
CATTCTCCAGCGGTTGGCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCT
GGAGGGGATGGAGCCCCACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTT
CTTGATGGTAACTTCTCAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCAC
ACAAGCCCCCTCGGCAGTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCAC
CCCTGGCAGGTGGTGAGTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTC
CCGCCCTCCAGGGTGCGCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAG
GAGGACCCGCTTTAGCCCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCT

>In-frame_PTPN1_ENST00000371621_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_7089nt
GTGATGCGTAGTTCCGGCTGCCGGTTGACATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCC
TCGGGGCTAAGAGCGCGACGCGGCCTAGAGCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAG
ATGGAAAAGGAGTTCGAGCAGATCGACAAGTCCGGGAGCTGGGCGGCCATTTACCAGGATATCCGACATGAAGCCAGTGACTTCCCATGT
AGAGTGGCCAAGCTTCCTAAGAACAAAAACCGAAATAGGTACAGAGACGTCAGTCCCTTTGACCATAGTCGGATTAAACTACATCAAGAA
GATAATGACTATATCAACGCTAGTTTGATAAAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGC
GGTCACTTTTGGGAGATGGTGTGGGAGCAGAAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCA
CAATACTGGCCACAAAAAGAAGAAAAAGAGATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATAT
TATACAGTGCGACAGCTAGAATTGGAAAACCTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCC
GCCTTGGAGTATTGTTTACACCCGGAGCCGCAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTAC
GAGGAGTATTGCAGCAACCATGAGAAAGCCCTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGC
ATGCTTCTGGGAGGCCGGAAGACCACGGACATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTC
CTTAAGGAGCTGGCCAAGAGGACTCCCGGCAAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCC
AACATCAATGAGACCAAGCGGCAGATGGAGAAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTC
ACAGACATCTGCACTCAGCTCCTCCTGCAAGGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGAC
AACCTTCTCGTCTACTGCAAGCGGAAATCCAGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTAC
ATCTTCAGGGGTCGAATCAACACTGAAGTCATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTC
ACCAACGGCTGGAAGATCCACAACACGGCCAAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGAT
GCCATCATCCGCGAGCGGGAGCAGCGCGAGAGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAG
CTGTACCACATGATGATGAACAAGAAGGTGAACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAAT
GAGTTCGTTGCCTGGCTCCTAGAAATTGGTGAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATC
ATCCACCATGTTTCCGACAAGCACCAGTTCAAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGT
GAGCTGGAGGACATCATGTCCAAGGGTGTGAGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCAC
CTGAAGACCTACAAGTCAGTGCTTCCCGGGAGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTG
GCGCTCGGCGTGGGTCTGTGCAACAATGGCTTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTT
CATGCTGACGAGGAGATGGAGGGGACCAGCAGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGC
CTGCTGATCCTGCCCCAGGAGGAGGACTATGGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCG
CTGGCTGAGGTGGCTGGCCTGCAGGTGGGGAGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAG
TCCATCCTCAACCAGTCCTTCTGCTCCCGCCGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAG
CCGGACACACTGTGCTTCCAGATTCGTGGAGCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTC
TGTGCTGGTCAGTGCATTCTGAAGGTCAATGGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGG
AGTCGGCGCGAAGAGGCCCTGGGCCTGTACCAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCC
ACTGAGGACCCCAGTGGCGAGCAGGCCCAGGAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTG
TGTGAGGACAGCCCCATGGTCACCCTGACTGTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTC
AGGTGCCATGTGCTGGAGAAGATCGTGGAGCCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGC
GTCTTCGTGGAGAACTGCAGGCGGCTCATGGCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACC
AAGCTGGAGAGCATTGGCCAGAGGATTGCCTGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCC
CCCCTGGAGCCCCACCCGCTGTGTGGCCTGGACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACC
CCCTCAGTGGGCAGGTCCTTCAGCATCCGCTTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATG
TCGTACACCCAGCACTGCATCACCACCATGGCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTC
CATGATGGCAGCTTCGGGCCAGCCAGTGGGACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATC
CAGGATGCCTACCTGCAGCTCTTCACCAAGCTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCC
ACCATCACAGAGCCCACCTCGGGTGGGTCCTGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAG
ATGGACAGGAGTGACCATGGGGGCATCAAGAAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGT
TATCGCGACTCCTACAGCGAGTGTAACAGCAATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGC
GACGAGATGGGGTCTGGAGATGAGCTGCCCTGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTC
TTTAACCAGGTGGACTCCATCAATGCTCTCCTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCAC
AGCTTACAAGAGTTTAAACAGAAAGAAGAGTGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTC
CCCAACTCCATCAAGACCCTGGTGGACAACATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACA
GACACGGAGCTGCAGCTGCGCAGAGACGCGATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCC
CTGGGCTACCGCTACAACAACAATGGCGAGTACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGC
GTCCTGCTGCACTGCCAGTCCCTGCTCTCGCCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAG
CTGGACAATGTCACCTTCTCCTTTAAGCAGCTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAG
GCGCTGAAGGTCATCTTCTACCTCGACAGCTACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACA
GCGCTGTTCACGAAAGGTGAGCTTCAGGCCTGGGGCAGGGAGGACCACGGGGGCCGGGCCAAGGCCACCAAGCACACCGGCTCCCAACCG
CCTGCCCGCCCCCGACATCTCCCCTCCCAGTGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGC
AGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGG
ATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCC
ACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGG
TCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCA
AGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGC
CCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCC
TCTGGAGCTGGGATTTGGGAGGACACAGCAGGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACC
TGCCCAGCGTCCTCCCTGCCTCCTTCCGGGACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCAT
TCTTCACACGCCTGCCAGAAGCTGGAGGGGTGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCC
CCAGAACCCAAGGGAACGTCATGGAGGCCACATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCC
TTCAACGTCCACATTCCAGGTGACCACACGTGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGG
TGGACTTGGAAAAGACTTGGCTCTGTCGGGAAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAG
CTCTGGACATCACCGCCCCTGGAACTGGGGCCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGT
TTATTTTGGGATTTTTTGTTGTTGGTGTTGTCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGA
AAGGTATGTTGTCTAACAGGGGACCAACAGAAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAAC
TAAATTATTGAAAAATTAAAAAATGTCATTGTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTC
CTTCCCCCACCCTCCATTCTCCAGCGGTTGGCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAG
CCAGGGTTGGAGCTGGAGGGGATGGAGCCCCACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTT
CTGTGATTTATTTTCTTGATGGTAACTTCTCAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGG
GAGGAGGGACCCACACAAGCCCCCTCGGCAGTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGG
GGGACGCCTGTCACCCCTGGCAGGTGGTGAGTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCT
GGCATCCGAGCCTCCCGCCCTCCAGGGTGCGCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTG
CATCAGAGACAAAGGAGGACCCGCTTTAGCCCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAA

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000371941_chr20_47361684_-_6868nt
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCGGGGCTAAGAGCGCGACGCGGCCTAGA
GCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAA
GTCCGGGAGCTGGGCGGCCATTTACCAGTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAACGCTAGTTTGATA
AAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAG
AAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAG
ATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAAC
CTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCG
CAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCC
CTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGAC
ATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGC
AAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAG
AAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAA
GGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCC
AGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTC
ATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCC
AAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAG
AGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTG
AACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGT
GAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTC
AAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTG
AGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGG
AGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGC
TTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGC
AGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTAT
GGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGG
AGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGC
CGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGA
GCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAAT
GGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTAC
CAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAG
GAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACT
GTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAG
CCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATG
GCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCC
TGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTG
GACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGC
TTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATG
GCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGG
ACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAG
CTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCC
TGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAG
AAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGC
AATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCC
TGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTC
CTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAG
TGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAAC
ATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCG
ATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAG
TACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCG
CCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAG
CTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGC
TACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGTGCTGGAGAACGTG
GAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAGTTCAGCAGTATTAC
CGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACCAGCTGATCCGCCCC
ATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGGGCGCCGGCCTCATC
CCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCACCCTGAGCGTGTCC
CTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGCGGAAGCAGGGCCCA
AGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCTGCCAGCCGCCGGTG
GATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGATTTGGGAGGACACAGCAGGCAGCGCTGGCCT
TCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTCCCTGCCTCCTTCCGGGACAAGCCTGGCCAC
CCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTGCCAGAAGCTGGAGGGGTGCTGGAGACCCAT
AGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGGAACGTCATGGAGGCCACATGGGGCCACCCG
GCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACATTCCAGGTGACCACACGTGTCTCCTCCTCCT
CATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAGACTTGGCTCTGTCGGGAAAGGAGAGACGGG
GCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACCGCCCCTGGAACTGGGGCCACCAGCCCTGGG
CACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTTTTTGTTGTTGGTGTTGTCAAAGTTTGTTTT
TTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCTAACAGGGGACCAACAGAAGGTAGTATTGAC
AACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAAATTAAAAAATGTCATTGTTTCCTGTTTGTT
AATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTCCATTCTCCAGCGGTTGGCCGGTGTTAGAAC
TCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCTGGAGGGGATGGAGCCCCACCTGAGGTGCCG
TGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTTCTTGATGGTAACTTCTCAGAGCAGGGCGAT
TGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCACACAAGCCCCCTCGGCAGTTTGTCCCCCCAG
CTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCACCCCTGGCAGGTGGTGAGTTCAGGTGGGGGC
TCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTCCCGCCCTCCAGGGTGCGCTTCCCTCTCTTG
CCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAGGAGGACCCGCTTTAGCCCTGCTGCGGGAAA
TGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCTTCTCGTTAAATTCTTGATAGATTTTTTATT

>In-frame_PTPN1_ENST00000541713_chr20_49191191_+_PREX1_ENST00000396220_chr20_47361684_-_6969nt
ATGAAGAAGCAGCAGCGGCTAGGGCGGCGGTAGCTGCAGGGGTCGGGGATTGCAGCGGGCCTCGGGGCTAAGAGCGCGACGCGGCCTAGA
GCGGCAGACGGCGCAGTGGGCCGAGAAGGAGGCGCAGCAGCCGCCCTGGCCCGTCATGGAGATGGAAAAGGAGTTCGAGCAGATCGACAA
GTCCGGGAGCTGGGCGGCCATTTACCAGTTGACCATAGTCGGATTAAACTACATCAAGAAGATAATGACTATATCAACGCTAGTTTGATA
AAAATGGAAGAAGCCCAAAGGAGTTACATTCTTACCCAGGGCCCTTTGCCTAACACATGCGGTCACTTTTGGGAGATGGTGTGGGAGCAG
AAAAGCAGGGGTGTCGTCATGCTCAACAGAGTGATGGAGAAAGGTTCGTTAAAATGCGCACAATACTGGCCACAAAAAGAAGAAAAAGAG
ATGATCTTTGAAGACACAAATTTGAAATTAACATTGATCTCTGAAGATATCAAGTCATATTATACAGTGCGACAGCTAGAATTGGAAAAC
CTTACAGTCCTGTTCTCGAACATCGAAGACATCCTGGAAGTTCATAAGGATTTCTTGGCCGCCTTGGAGTATTGTTTACACCCGGAGCCG
CAGTCTCAGCATGAACTTGGGAATGTTTTCTTAAAATTCAAGGACAAGTTCTGCGTGTACGAGGAGTATTGCAGCAACCATGAGAAAGCC
CTGAGGCTGCTGGTGGAGCTGAACAAGATCCCTACCGTGCGCGCCTTCCTTTTGAGCTGCATGCTTCTGGGAGGCCGGAAGACCACGGAC
ATCCCTTTGGAAGGCTACCTGTTGTCTCCGATCCAGAGGATCTGCAAGTACCCGCTCCTCCTTAAGGAGCTGGCCAAGAGGACTCCCGGC
AAGCACCCAGACCACCCCGCGGTCCAGAGTGCCCTGCAGGCCATGAAGACCGTTTGCTCCAACATCAATGAGACCAAGCGGCAGATGGAG
AAGCTGGAAGCCCTGGAGCAGCTGCAGTCCCACATCGAAGGCTGGGAGGGTTCCAACCTCACAGACATCTGCACTCAGCTCCTCCTGCAA
GGGACTTTGTTAAAGATCTCTGCGGGCAACATCCAGGAAAGGGCCTTCTTCCTCTTCGACAACCTTCTCGTCTACTGCAAGCGGAAATCC
AGGGTCACCGGGAGCAAGAAGTCCACCAAGAGGACCAAATCCATCAACGGCTCCCTCTACATCTTCAGGGGTCGAATCAACACTGAAGTC
ATGGAGGTGGAGAATGTGGAAGATGGGACAGCGGATTACCATAGCAACGGCTATACCGTCACCAACGGCTGGAAGATCCACAACACGGCC
AAGAATAAGTGGTTTGTCTGCATGGCCAAGACGGCAGAGGAGAAGCAGAAGTGGCTGGATGCCATCATCCGCGAGCGGGAGCAGCGCGAG
AGCCTGAAGCTGGGCATGGAGCGTGATGCCTACGTCATGATTGCGGAGAAGGGGGAGAAGCTGTACCACATGATGATGAACAAGAAGGTG
AACCTCATCAAGGACCGCCGGAGAAAGCTGAGCACTGTCCCCAAGTGCTTTCTTGGCAATGAGTTCGTTGCCTGGCTCCTAGAAATTGGT
GAAATCAGCAAGACGGAAGAAGGAGTCAACTTGGGCCAAGCCCTGTTGGAGAATGGCATCATCCACCATGTTTCCGACAAGCACCAGTTC
AAGAATGAGCAGGTGATGTATCGCTTCCGCTACGACGATGGCACCTACAAGGCCCGAAGTGAGCTGGAGGACATCATGTCCAAGGGTGTG
AGGCTTTACTGCCGTCTTCACAGCCTCTACACCCCGGTGATCAAAGACCGTGATTACCACCTGAAGACCTACAAGTCAGTGCTTCCCGGG
AGCAAGCTGGTGGACTGGCTGCTGGCTCAGGGAGACTGCCAGACTCGGGAGGAGGCAGTGGCGCTCGGCGTGGGTCTGTGCAACAATGGC
TTCATGCACCACGTGCTGGAGAAGAGCGAGTTCAGGGATGAGTCCCAGTACTTCCGCTTTCATGCTGACGAGGAGATGGAGGGGACCAGC
AGCAAGAACAAACAGCTTCGCAACGACTTCAAGCTGGTGGAGAACATTCTGGCCAAGCGCCTGCTGATCCTGCCCCAGGAGGAGGACTAT
GGCTTTGACATCGAGGAGAAGAACAAGGCTGTGGTGGTGAAGTCCGTCCAGAGGGGCTCGCTGGCTGAGGTGGCTGGCCTGCAGGTGGGG
AGGAAGATCTACTCCATCAATGAGGACCTGGTGTTCCTGCGGCCGTTTTCAGAGGTGGAGTCCATCCTCAACCAGTCCTTCTGCTCCCGC
CGCCCTCTGCGCCTCCTGGTGGCCACGAAGGCCAAAGAGATCATCAAAATCCCCGACCAGCCGGACACACTGTGCTTCCAGATTCGTGGA
GCTGCCCCACCGTACGTCTATGCTGTGGGGAGAGGCTCTGAGGCCATGGCTGCAGGGCTCTGTGCTGGTCAGTGCATTCTGAAGGTCAAT
GGCAGCAACGTGATGAACGATGGTGCCCCTGAGGTCCTGGAGCACTTCCAGGCATTCCGGAGTCGGCGCGAAGAGGCCCTGGGCCTGTAC
CAGTGGATCTACCACACCCATGAGGATGCCCAGGAAGCACGAGCCAGTCAGGAGGCCTCCACTGAGGACCCCAGTGGCGAGCAGGCCCAG
GAGGAAGACCAGGCTGATTCAGCCTTCCCACTGCTGTCCCTGGGTCCCCGGCTGAGCCTGTGTGAGGACAGCCCCATGGTCACCCTGACT
GTGGACAACGTGCACCTGGAACACGGCGTGGTGTATGAGTATGTGAGCACGGCAGGCGTCAGGTGCCATGTGCTGGAGAAGATCGTGGAG
CCCCGCGGCTGCTTCGGCCTCACCGCCAAGATCCTCGAGGCCTTTGCTGCCAATGACAGCGTCTTCGTGGAGAACTGCAGGCGGCTCATG
GCCCTGAGCAGCGCCATCGTGACCATGCCCCACTTTGAGTTCCGCAACATCTGTGACACCAAGCTGGAGAGCATTGGCCAGAGGATTGCC
TGCTACCAGGAGTTTGCAGCCCAACTGAAGAGCAGGGTCAGCCCACCCTTCAAACAAGCCCCCCTGGAGCCCCACCCGCTGTGTGGCCTG
GACTTCTGCCCCACCAATTGCCACATCAACCTCATGGAAGTGTCCTACCCCAAGACCACCCCCTCAGTGGGCAGGTCCTTCAGCATCCGC
TTTGGACGCAAACCCTCCCTCATCGGCCTTGACCCGGAGCAAGGCCACCTGAACCCCATGTCGTACACCCAGCACTGCATCACCACCATG
GCTGCTCCCTCCTGGAAGTGCTTGCCTGCTGCAGAGGGTGATCCCCAAGGCCAGGGTCTCCATGATGGCAGCTTCGGGCCAGCCAGTGGG
ACCCTTGGTCAGGAAGACCGGGGCCTCAGCTTCCTACTCAAGCAGGAGGACCGTGAGATCCAGGATGCCTACCTGCAGCTCTTCACCAAG
CTGGATGTGGCCCTGAAGGAGATGAAGCAATATGTCACCCAGATCAACAGGCTGCTGTCCACCATCACAGAGCCCACCTCGGGTGGGTCC
TGCGACGCATCCTTGGCTGAGGAGGCCTCCTCCCTGCCCCTGGTCAGTGAAGAGAGCGAGATGGACAGGAGTGACCATGGGGGCATCAAG
AAGGTGTGCTTCAAGGTGGCCGAGGAGGACCAGGAGGACTCAGGCCACGACACCATGAGTTATCGCGACTCCTACAGCGAGTGTAACAGC
AATCGAGACTCGGTCCTGTCCTACACCAGCGTGAGAAGTAACAGCTCCTACTTGGGCAGCGACGAGATGGGGTCTGGAGATGAGCTGCCC
TGTGACATGCGGATCCCATCTGACAAGCAGGACAAGCTTCATGGCTGCCTGGAGCACCTCTTTAACCAGGTGGACTCCATCAATGCTCTC
CTCAAGGGGCCAGTCATGAGCCGGGCTTTCGAAGAGACCAAGCATTTCCCTATGAACCACAGCTTACAAGAGTTTAAACAGAAAGAAGAG
TGTACAATCCGTGGCCGGAGCCTGATCCAGATTAGCATCCAGGAGGACCCCTGGAACCTCCCCAACTCCATCAAGACCCTGGTGGACAAC
ATTCAGAGATATGTGGAAGATGGGAAGAACCAGCTGCTCCTGGCCTTGCTGAAGTGCACAGACACGGAGCTGCAGCTGCGCAGAGACGCG
ATCTTCTGCCAGGCCCTGGTGGCCGCCGTGTGCACCTTCTCCAAGCAGCTGCTGGCGGCCCTGGGCTACCGCTACAACAACAATGGCGAG
TACGAGGAGAGCAGCCGCGACGCCAGCCGCAAGTGGCTGGAGCAGGTGGCGGCCACGGGCGTCCTGCTGCACTGCCAGTCCCTGCTCTCG
CCAGCCACAGTGAAGGAGGAACGGACCATGCTGGAGGACATCTGGGTGACGCTGTCAGAGCTGGACAATGTCACCTTCTCCTTTAAGCAG
CTGGACGAGAACTATGTGGCCAACACCAACGTCTTCTACCACATTGAGGGCAGCCGGCAGGCGCTGAAGGTCATCTTCTACCTCGACAGC
TACCACTTCTCCAAGCTGCCCTCCCGCCTGGAGGGTGGGGCCAGCCTGAGGCTGCACACAGCGCTGTTCACGAAAGGTGAGCTTCAGGCC
TGGGGCAGGGAGGACCACGGGGGCCGGGCCAAGGCCACCAAGCACACCGGCTCCCAACCGCCTGCCCGCCCCCGACATCTCCCCTCCCAG
TGCTGGAGAACGTGGAGGGGCTGCCTTCTCCAGGCAGCCAGGCCGCGGAGGATTTGCAGCAGGACATCAACGCGCAGTCCCTGGAGAAAG
TTCAGCAGTATTACCGCAAACTCAGGGCATTTTACCTGGAGCGGTCTAACCTGCCCACGGATGCCAGCACCACGGCGGTAAAGATAGACC
AGCTGATCCGCCCCATCAATGCCCTGGATGAGCTCTGCCGCCTCATGAAGTCCTTTGTCCACCCAAAGCCTGGTGCTGCTGGGAGTGTGG
GCGCCGGCCTCATCCCCATCTCCTCGGAGCTCTGCTACCGCCTGGGGGCCTGCCAGATGGTCATGTGTGGCACAGGCATGCAGAGGAGCA
CCCTGAGCGTGTCCCTGGAGCAGGCGGCCATCTTGGCACGGAGCCACGGGTTGCTGCCCAAGTGCATCATGCAGGCCACGGACATCATGC
GGAAGCAGGGCCCAAGGGTGGAGATTCTGGCCAAAAACCTGCGAGTCAAGGACCAGATGCCCCAGGGTGCTCCGCGCCTCTACCGCCTCT
GCCAGCCGCCGGTGGATGGGGACCTCTGAACACCCAAATGCCCCACGCTGGGCCGCGGCCTCTGGAGCTGGGATTTGGGAGGACACAGCA
GGCAGCGCTGGCCTTCTCCAGGGATGGCCCAAGGCTTCCGCAGCCGCCCGTTCCGGGACCTGCCCAGCGTCCTCCCTGCCTCCTTCCGGG
ACAAGCCTGGCCACCCTCGCTGTGATGACGAGCTGGCTGATTGGCCCTGGGCCGGCCCATTCTTCACACGCCTGCCAGAAGCTGGAGGGG
TGCTGGAGACCCATAGAGCTGATGGGAGCAGCTGGTGCCTGGCCTTCGGCTCCTGCGTCCCCAGAACCCAAGGGAACGTCATGGAGGCCA
CATGGGGCCACCCGGCTCCCTCGGGATGGCTCCGCCTGCACTTTTGAAACCCCGGTTTCCTTCAACGTCCACATTCCAGGTGACCACACG
TGTCTCCTCCTCCTCATCTTAGCTTCCAGGTTCACCCTAACCCTGTACTAACCTGCTTGGTGGACTTGGAAAAGACTTGGCTCTGTCGGG
AAAGGAGAGACGGGGCCTCCATCACGCCTGTTACCAGAGGATCCCCGAGAGCCACACCAGCTCTGGACATCACCGCCCCTGGAACTGGGG
CCACCAGCCCTGGGCACGAGATTTGCTCTGACTTTATTTATATGGCATGAAATCTCTGGTTTATTTTGGGATTTTTTGTTGTTGGTGTTG
TCAAAGTTTGTTTTTTCTAAAGTTGTGTGATTATATATTTGACATTTTACATTTCAAAGAAAGGTATGTTGTCTAACAGGGGACCAACAG
AAGGTAGTATTGACAACTGTTCCTGCTTCTACTAAAAAAAAAAGAGCACAAAAGAAAAACTAAATTATTGAAAAATTAAAAAATGTCATT
GTTTCCTGTTTGTTAATATTAGGGTTGTAAGGTGTCGTTTTGAGGTATCGACTGTGATTCCTTCCCCCACCCTCCATTCTCCAGCGGTTG
GCCGGTGTTAGAACTCGCTCTCTTTGAGTGACTGGCTACAAGGGCCTGAGAGGTGGCCAGCCAGGGTTGGAGCTGGAGGGGATGGAGCCC
CACCTGAGGTGCCGTGTCACACGGGTTAGAGGGTCACTGGGAAACACCGGGCGGTGGCTTCTGTGATTTATTTTCTTGATGGTAACTTCT
CAGAGCAGGGCGATTGGGACATCACCAGCCAGAGCACAGGAAGCCACCCTGCCTGCTGGGGAGGAGGGACCCACACAAGCCCCCTCGGCA
GTTTGTCCCCCCAGCTTCGGTATGCCTTCAGGGAAAGGTCACAGCTGGGGAGGAAGCGGGGGGACGCCTGTCACCCCTGGCAGGTGGTGA
GTTCAGGTGGGGGCTCCCTGCTGCCCCCAGGCCTGGGAGCTTGAAGCCCTCCCGGCATCTGGCATCCGAGCCTCCCGCCCTCCAGGGTGC
GCTTCCCTCTCTTGCCGCAGCATACACGAGGGCAGGCAGTGGCCTTGTCACTGTATCTTGCATCAGAGACAAAGGAGGACCCGCTTTAGC
CCTGCTGCGGGAAATGGGGGAGGGCCCAGGGCCAGCGCATTGTGCACTGGTTTACTTTAAAATGTACAGATTCTTCTCGTTAAATTCTTG


Top

FusionGenePPI for PTPN1_PREX1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPN1GSK3B, GRB2, IRS1, CAV1, EGFR, CRK, BCAR1, CTNNB1, STAT5A, STAT5B, NTRK1, NTRK2, NTRK3, LTK, TYK2, JAK2, INSR, IGF1R, GHR, STAM2, ILF3, SLC25A3, MCAT, MARCKSL1, LAMTOR3, HNRNPU, ZMPSTE24, STAT3, ATF2, CSNK2A1, SRC, ATP4A, ASS1, RFWD2, IL1B, ASGR2, HMOX2, SLC39A4, LYPD3, ENPP6, ZACN, PLTP, LYPD6, KRAS, AGR3, BCAS3, CASC3, CASZ1, CCL5, CDH13, DIRAS3, FAM84B, KLK7, MRC2, RHOBTB2, SNAI1, THRSP, VPS45, HERC2, TCTN2, TCTN3, EVC2, TMEM17, TMEM216, ATP6V1B2, ATP6V0A1, COL5A1, STOM, FLOT2, GALNT2, MSN, PHB, ABCD3, SMARCD2, ATP6V0D1, GOSR1, MVP, FLOT1, PHB2, LTN1, GOLIM4, BCOR, WRAP53, MREG, PCNP, KIDINS220, RNF213, ARHGAP39, PTRF, CDH1, ACTB, APLP2, CASC4, SNRPD2, TOMM70A, CTDNEP1, C5AR2, TMEM63A, C3AR1, GPR21, GHITM, SLCO6A1, TMPRSS3, AMTN, MRAP2, GPR114, KIAA1467, SLC39A12, APLNR, DUSP1, DCUN1D5, PISD, COX11, NDUFAF4, NARS, PTRH2, TBC1D15, NPPC, PFN2, ARL1, DHCR24, AIP, RAB5C, PGRMC1, SEC61A1, CDIPT, SLC27A4, ILVBL, DHCR7, TRIP13, ARF4, HEATR3, PCMT1, ARF1, CCDC47, CDK4, FLAD1, RMDN3, CLK2, LATPREX1BZW1, PPP1CA, ITSN1, MTOR, RPTOR, RICTOR, AKT1, KRAS, NRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPN1_PREX1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePTPN1P18031DB01133Tiludronic acidTyrosine-protein phosphatase non-receptor type 1small moleculeapproved|investigational|vet_approved

Top

RelatedDiseases for PTPN1_PREX1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTPN1C0019829Hodgkin Disease1CTD_human
HgenePTPN1C0021655Insulin Resistance1CTD_human
HgenePTPN1C0023893Liver Cirrhosis, Experimental1CTD_human
HgenePTPN1C0025063Mediastinal Neoplasms1CTD_human
HgenePTPN1C0028754Obesity1CTD_human
HgenePTPN1C0035372Rett Syndrome1CTD_human
HgenePTPN1C0036341Schizophrenia1PSYGENET
HgenePTPN1C0079731B-Cell Lymphomas1CTD_human