FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29419

FusionGeneSummary for PTPN13_AFF1

check button Fusion gene summary
Fusion gene informationFusion gene name: PTPN13_AFF1
Fusion gene ID: 29419
HgeneTgene
Gene symbol

PTPN13

AFF1

Gene ID

5783

4299

Gene nameprotein tyrosine phosphatase, non-receptor type 13AF4/FMR2 family member 1
SynonymsFAP-1|PNP1|PTP-BAS|PTP-BL|PTP1E|PTPL1|PTPLE|hPTP1EAF4|MLLT2|PBM1
Cytomap

4q21.3

4q21.3-q22.1

Type of geneprotein-codingprotein-coding
Descriptiontyrosine-protein phosphatase non-receptor type 13fas-associated protein-tyrosine phosphatase 1hPTPE1protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase)protein-tyrosine phosphatase 1Eprotein-tyrosine phosphatasAF4/FMR2 family member 1ALL1-fused gene from chromosome 4 proteinmyeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 2pre-B-cell monocytic leukemia partner 1proto-oncogene AF4
Modification date2018051920180523
UniProtAcc

Q12923

P51825

Ensembl transtripts involved in fusion geneENST00000427191, ENST00000436978, 
ENST00000502971, ENST00000411767, 
ENST00000316707, ENST00000511467, 
ENST00000395146, ENST00000307808, 
ENST00000544085, ENST00000511996, 
Fusion gene scores* DoF score5 X 6 X 3=9010 X 25 X 4=1000
# samples 631
** MAII scorelog2(6/90*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/1000*10)=-1.68965987938785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTPN13 [Title/Abstract] AND AFF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTPN13

GO:0006470

protein dephosphorylation

17657516

HgenePTPN13

GO:0014066

regulation of phosphatidylinositol 3-kinase signaling

23604317


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-DS-A0VN-01APTPN13chr4

87695684

+AFF1chr4

87894982

+
TCGALDCESCTCGA-EA-A5ZD-01APTPN13chr4

87610343

+AFF1chr4

88005272

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-intronENST00000427191ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000427191ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000427191ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-3UTRENST00000427191ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000436978ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000436978ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000436978ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-3UTRENST00000436978ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
intron-intronENST00000502971ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
intron-intronENST00000502971ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
intron-intronENST00000502971ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
intron-3UTRENST00000502971ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000411767ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000411767ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000411767ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-3UTRENST00000411767ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000316707ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000316707ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000316707ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-3UTRENST00000316707ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000511467ENST00000395146PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000511467ENST00000307808PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-intronENST00000511467ENST00000544085PTPN13chr4

87695684

+AFF1chr4

87894982

+
5CDS-3UTRENST00000511467ENST00000511996PTPN13chr4

87695684

+AFF1chr4

87894982

+
In-frameENST00000427191ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000427191ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000427191ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000427191ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000436978ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000436978ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000436978ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000436978ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000502971ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000502971ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000502971ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000502971ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000411767ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000411767ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000411767ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000411767ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000316707ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000316707ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000316707ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000316707ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000511467ENST00000395146PTPN13chr4

87610343

+AFF1chr4

88005272

+
In-frameENST00000511467ENST00000307808PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-5UTRENST00000511467ENST00000544085PTPN13chr4

87610343

+AFF1chr4

88005272

+
5CDS-intronENST00000511467ENST00000511996PTPN13chr4

87610343

+AFF1chr4

88005272

+

Top

FusionProtFeatures for PTPN13_AFF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTPN13

Q12923

AFF1

P51825


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+54556_591822295Compositional biasNote=Poly-Leu
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+54856_591822486Compositional biasNote=Poly-Leu
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+54756_591822467Compositional biasNote=Poly-Leu
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+54856_591822491Compositional biasNote=Poly-Leu
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+44756_591822491Compositional biasNote=Poly-Leu
TgeneAFF1chr4:87610343chr4:88005272ENST00000307808+220483_4923461211Compositional biasNote=Poly-Ser
TgeneAFF1chr4:87610343chr4:88005272ENST00000307808+220835_8433461211Compositional biasNote=Poly-Ser
TgeneAFF1chr4:87610343chr4:88005272ENST00000307808+220866_8693461211Compositional biasNote=Poly-Pro
TgeneAFF1chr4:87610343chr4:88005272ENST00000307808+220871_8743461211Compositional biasNote=Poly-Ser
TgeneAFF1chr4:87610343chr4:88005272ENST00000395146+321483_4923531219Compositional biasNote=Poly-Ser
TgeneAFF1chr4:87610343chr4:88005272ENST00000395146+321835_8433531219Compositional biasNote=Poly-Ser
TgeneAFF1chr4:87610343chr4:88005272ENST00000395146+321866_8693531219Compositional biasNote=Poly-Pro
TgeneAFF1chr4:87610343chr4:88005272ENST00000395146+321871_8743531219Compositional biasNote=Poly-Ser

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+545469_5041822295Coiled coilOntology_term=ECO:0000255
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+548469_5041822486Coiled coilOntology_term=ECO:0000255
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+547469_5041822467Coiled coilOntology_term=ECO:0000255
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+548469_5041822491Coiled coilOntology_term=ECO:0000255
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+447469_5041822491Coiled coilOntology_term=ECO:0000255
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451742_17491822295Compositional biasNote=Poly-Ser
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481742_17491822486Compositional biasNote=Poly-Ser
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471742_17491822467Compositional biasNote=Poly-Ser
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481742_17491822491Compositional biasNote=Poly-Ser
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471742_17491822491Compositional biasNote=Poly-Ser
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451093_11781822295DomainPDZ 1
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451368_14521822295DomainPDZ 2
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451501_15881822295DomainPDZ 3
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451788_18681822295DomainPDZ 4
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5451882_19651822295DomainPDZ 5
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5452213_24671822295DomainTyrosine-protein phosphatase
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5453_1901822295DomainKIND
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+545572_8721822295DomainFERM
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481093_11781822486DomainPDZ 1
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481368_14521822486DomainPDZ 2
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481501_15881822486DomainPDZ 3
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481788_18681822486DomainPDZ 4
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5481882_19651822486DomainPDZ 5
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5482213_24671822486DomainTyrosine-protein phosphatase
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5483_1901822486DomainKIND
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+548572_8721822486DomainFERM
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471093_11781822467DomainPDZ 1
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471368_14521822467DomainPDZ 2
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471501_15881822467DomainPDZ 3
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471788_18681822467DomainPDZ 4
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5471882_19651822467DomainPDZ 5
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5472213_24671822467DomainTyrosine-protein phosphatase
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5473_1901822467DomainKIND
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+547572_8721822467DomainFERM
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481093_11781822491DomainPDZ 1
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481368_14521822491DomainPDZ 2
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481501_15881822491DomainPDZ 3
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481788_18681822491DomainPDZ 4
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5481882_19651822491DomainPDZ 5
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5482213_24671822491DomainTyrosine-protein phosphatase
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5483_1901822491DomainKIND
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+548572_8721822491DomainFERM
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471093_11781822491DomainPDZ 1
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471368_14521822491DomainPDZ 2
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471501_15881822491DomainPDZ 3
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471788_18681822491DomainPDZ 4
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4471882_19651822491DomainPDZ 5
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4472213_24671822491DomainTyrosine-protein phosphatase
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4473_1901822491DomainKIND
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+447572_8721822491DomainFERM
HgenePTPN13chr4:87610343chr4:88005272ENST00000316707+5452408_24141822295RegionSubstrate binding
HgenePTPN13chr4:87610343chr4:88005272ENST00000411767+5482408_24141822486RegionSubstrate binding
HgenePTPN13chr4:87610343chr4:88005272ENST00000427191+5472408_24141822467RegionSubstrate binding
HgenePTPN13chr4:87610343chr4:88005272ENST00000436978+5482408_24141822491RegionSubstrate binding
HgenePTPN13chr4:87610343chr4:88005272ENST00000511467+4472408_24141822491RegionSubstrate binding


Top

FusionGeneSequence for PTPN13_AFF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_1048aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIARSTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVL

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_1047aa
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLPSGSVSFTDENISNQDLRAFTAPEVLQNQSL
TSLSDVEKIHITSLGMTLTWGADTEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGQTYSNEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQTDTSSKTHSNSQQGTSSMLEDDLQLSDSED
SDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQ
PAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASAR
AGSRTSLQGEREPGLLPTGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALV
PLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKGSRQRKAEDKQPPAG
KKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSSSSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKR
SRREADTCGQDPPKSASSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKM
KQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFR
CKKDIAIKTSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQNMTSSTVTITSHVLT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_3144nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTG
GGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTT
ACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTG

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_3141nt
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAA
AGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTA
ACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTG
GATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATA
CATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAA
TATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGAC
AGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCA
CATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAA
AATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAG
CCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAG
GAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGC
TGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGG
GCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAG
GTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGC
TCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTT
CCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGC
CGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAG
ATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGG
AAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAAC
AAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGG
CCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGG
TCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAG
CAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCT
TTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATG
AAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCC
ACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCC
TTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGT
TGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGC
ATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGG
AGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACC
GCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8977nt
GAGTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAG
CTCCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCG
TCGAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAG
GAGGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGA
GAAGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAG
CAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATC
ATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGG
GGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAA
CACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCC
GTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCT
TCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTT
GCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTA
CAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTC
CAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAG
TGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGAC
AGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGA
AATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTT
TAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCA
TCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTT
ATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATT
ACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGC
GCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAAT
TTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATT
TGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATC
TGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAA
GTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCT
CAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGA
CCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAA
ACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTG
TCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGA
GGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAA
GGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGT
TCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGAC
CTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCT
GTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAA
TCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCAT
TCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTG
TTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTA
CTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTT
GTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTG
AAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATT
TGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCC
TTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTA
AATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTT
TTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATC
AAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATA
GAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAA
AGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTT
TAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAAT
GTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATT
AACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAA
CCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAG
TTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTT
TGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTT
CATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATT
TTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTT
GAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGG
AAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGC
AATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATG
GTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACT
GAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCT
TGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACC
AGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTT
CAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATG
TGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTT
GCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCT
TGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAAT
TACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCA
ACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGT
ATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGT
GCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAA

>In-frame_PTPN13_ENST00000427191_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8958nt
GAGTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAG
CTCCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCG
TCGAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAG
GAGGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGA
GAAGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAG
CAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATC
ATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGG
GGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAA
CACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTA
GGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCC
TATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCT
CGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAA
GAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAG
ACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGT
GATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGA
AGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAAT
GAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAA
CAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCT
GTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATA
AAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACT
GTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCT
GCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTC
CTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGA
GGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGC
TTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTT
AACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAG
CTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCT
AAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACA
TTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCA
TCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGA
GGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGG
ATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCT
TTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTT
GATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTG
TTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCA
GGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCC
CTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTG
GCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTC
TTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTA
CTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAA
GGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGC
ACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTA
GAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAAT
CTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTA
AAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAA
TTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAA
TCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGA
CCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAA
TTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTT
ACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAAC
AAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCC
AGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTT
GAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGT
TTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCAT
CTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTT
CTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAG
CCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAG
GAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAAT
CCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTG
AGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAA
CGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGT
GAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGG
CAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAG
GCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGT
GTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCC
TTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGG
TATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTAC
TGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACA
CAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATA
GTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCC
ACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAG

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8977nt
GAGTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAG
CTCCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCG
TCGAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAG
GAGGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGA
GAAGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAG
CAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATC
ATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGG
GGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAA
CACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCC
GTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCT
TCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTT
GCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTA
CAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTC
CAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAG
TGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGAC
AGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGA
AATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTT
TAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCA
TCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTT
ATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATT
ACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGC
GCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAAT
TTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATT
TGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATC
TGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAA
GTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCT
CAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGA
CCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAA
ACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTG
TCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGA
GGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAA
GGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGT
TCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGAC
CTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCT
GTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAA
TCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCAT
TCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTG
TTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTA
CTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTT
GTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTG
AAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATT
TGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCC
TTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTA
AATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTT
TTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATC
AAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATA
GAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAA
AGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTT
TAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAAT
GTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATT
AACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAA
CCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAG
TTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTT
TGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTT
CATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATT
TTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTT
GAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGG
AAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGC
AATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATG
GTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACT
GAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCT
TGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACC
AGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTT
CAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATG
TGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTT
GCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCT
TGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAAT
TACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCA
ACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGT
ATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGT
GCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAA

>In-frame_PTPN13_ENST00000436978_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8958nt
GAGTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAG
CTCCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCG
TCGAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAG
GAGGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGA
GAAGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAG
CAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATC
ATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGG
GGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAA
CACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACC
CATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCAT
GTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAA
GACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCA
CAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAG
AGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAG
CTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGT
AAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCA
CCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAA
CCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCC
CGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCC
CCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAG
GACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGC
CGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGAC
ACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGG
AAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGA
AAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCAC
AAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCC
CAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAG
AGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGA
GATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCA
GACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCC
GTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGAT
CTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGC
CAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCT
TCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTA
GGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCC
TATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCT
CGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAA
GAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAG
ACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGT
GATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGA
AGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAAT
GAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAA
CAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCT
GTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATA
AAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACT
GTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCT
GCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTC
CTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGA
GGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGC
TTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTT
AACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAG
CTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCT
AAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACA
TTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCA
TCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGA
GGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGG
ATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCT
TTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTT
GATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTG
TTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCA
GGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCC
CTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTG
GCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTC
TTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTA
CTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAA
GGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGC
ACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTA
GAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAAT
CTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTA
AAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAA
TTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAA
TCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGA
CCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAA
TTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTT
ACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAAC
AAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCC
AGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTT
GAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGT
TTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCAT
CTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTT
CTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAG
CCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAG
GAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAAT
CCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTG
AGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAA
CGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGT
GAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGG
CAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAG
GCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGT
GTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCC
TTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGG
TATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTAC
TGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACA
CAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATA
GTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCC
ACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAG

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8975nt
GTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAGCT
CCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCGTC
GAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAGGA
GGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGAGA
AGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCA
GGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAAT
ATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCAT
TTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGC
ACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGG
GGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTA
CGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACA
CTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCA
TTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGT
CAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGA
CGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACA
GTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAG
CGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCT
GGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAA
GGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACC
CGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACC
CAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCG
AGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCC
CTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGA
CAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCG
CCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACAC
TCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAA
AGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAA
GGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAA
AGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCA
GAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAG
CAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGA
TACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGA
CCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGT
CTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCT
CATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCA
GTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTC
CAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGT
AGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTC
CTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGC
TCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACA
AGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCA
GACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTG
TGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAG
AAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAA
TGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTA
ACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATC
TGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTAT
AAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTAC
TGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGC
TGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTT
CCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTG
AGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTG
CTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGT
TAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCA
GCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACC
TAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAAC
ATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTC
ATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGG
AGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGG
GATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTC
TTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCT
TGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGT
GTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATC
AGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTC
CCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTT
GGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACT
CTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGT
ACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAA
AGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTG
CACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTT
AGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAA
TCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTT
AAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAA
ATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGA
ATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAG
ACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTA
ATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGT
TACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAA
CAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACC
CAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTT
TGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTG
TTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCA
TCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTT
TCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGA
GCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAA
GGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAA
TCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGT
GAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGA
ACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTG
TGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAG
GCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCA
GGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTG
TGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGC
CTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTG
GTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTA
CTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAAC
ACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTAT
AGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGC
CACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGA

>In-frame_PTPN13_ENST00000502971_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8956nt
GTAGCTCCAGCGGCCACGCTGAGGCGAGGGTGACACACCATGCTCACGGCCCCTGGAGACCGTCGTGCTGGCGAGCCGTGCTCCGTAGCT
CCCCGGTCCGCCTCGGCAGCGGTCAGAGTCGCCTACAGGAGTTGAGCCGCCCGCGCCAGAAGGTTTTGGCGAAGCTCTTGGAGAGGCGTC
GAGCACAGTAGGGCGGCGGGGGTGCGTTGAGCGCTCGGGGGTCAGGCAGTCGGCCGGGATCGCCGCTGGGGAGCGTTTCCGAGGCGAGGA
GGAGGAGGAGGAGATGCTGCTCCTCTTCTCCCCCTCCCCAGGCTCCTTCTACAGCTCCTTCAGCCCACGCCCGCAGCCGCTTGTGGGAGA
AGTGGTGGTGGCTCTCGGCGCCCGCGGCGGCTGCCGGCGGCCCGCCCCGACGCCGCGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCA
GGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAAT
ATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCAT
TTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGC
ACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGG
GGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTA
CGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACA
CTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCA
TTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGT
CAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGA
CGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACA
GTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAG
CGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCT
GGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAA
GGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACC
CGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACC
CAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCG
AGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCC
CTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGA
CAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCG
CCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACAC
TCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAA
AGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAA
GGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAA
AGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCA
GAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAG
CAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGA
TACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGA
CCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGT
CTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCT
CATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCA
GTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTC
CAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGG
GTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTA
TGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCG
GCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGA
ATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGAC
ATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGA
TCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAG
TGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGA
GGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACA
ATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGT
AAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAA
ATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGT
GCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGC
CATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCT
CCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGG
TGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTT
CTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAA
CTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCT
AGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAA
AATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATT
ACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATC
TCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGG
GAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGAT
GTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTT
GGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGA
TGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTT
AAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGG
CTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCT
AGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGC
AAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTT
TGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACT
ACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGG
TAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCAC
TTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGA
GTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCT
TGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAA
GTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATT
ATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATC
ACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACC
TTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATT
TCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTAC
TAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAA
AACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAG
TTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGA
GTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTT
TCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCT
GTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCT
CACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCC
AGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGA
GGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCC
AGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAG
TTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACG
TCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGA
GCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCA
GTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGC
CATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGT
ATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTT
TTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTA
TTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTG
TGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACA
AATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGT
CGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCAC
AGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGA

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8560nt
CGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTG
GAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTA
AGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAA
AATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATC
CACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAAC
AGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAAT
AGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGAC
AGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAG
TCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAA
GAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTAT
TCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCC
CCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATC
AGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCC
GAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTG
GTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAAC
TATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCC
AGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCC
CAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTT
TTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCAC
GCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGG
GAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACA
GTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGC
GCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGG
TGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCT
AACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTG
CTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTC
AGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAAC
TAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAAC
TCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATA
GTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCT
TTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAG
TAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCT
ACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGC
AGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGT
GAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAG
AATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCC
TGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTC
CATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTC
CCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCT
ATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCA
GCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCC
TTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAG
TAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTG
TATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGA
TCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAAT
GCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCT
TTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCT
AAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGA
GTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTG
AATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATT
GGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGA
AAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGA
AGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAA
AAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGG
CTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGG
TTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAA
CACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTT
TGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAA
TTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATT
TTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAA
GTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTG
AGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTG
TCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTAC
CTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCA
TAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAG
CAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTAT
ACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATG
TGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTT
GCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAAT
CACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGG
GAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACT
TGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGA
AAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTA
ATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTTCGAGAAATCATTGGG

>In-frame_PTPN13_ENST00000411767_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8541nt
CGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTG
GAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTA
AGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAA
AATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATC
CACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAAC
AGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAAT
AGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGAC
AGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAG
TCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAA
GAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTAT
TCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCT
CTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGC
ACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAG
GCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTG
CACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTAT
TTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGG
ACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAG
AGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTT
TTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCT
AGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAG
AAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTG
GCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCT
GCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGC
CACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAAC
AGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTT
TTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGA
GTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAG
ACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCA
TCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTG
TATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTT
TCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAG
AATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACC
AAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGG
AACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAG
GCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAAT
GACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGG
TCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCAT
CTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCT
TAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATG
CAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCT
CTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTG
AAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAA
CTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTAT
ATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCA
TTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCA
AAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTA
GTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAA
TAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTG
GGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAAT
GGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGA
CCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAA
CTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGC
AAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAA
GAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTC
TTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTT
TTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACAC
TACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGT
GCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTA
TGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTC
CTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTG
ATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGC
ACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCA
GGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTA
AGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAG
TGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAA
TGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACA
CTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGA
TCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCT
TTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCAC
TGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAA
GCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGG
GGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAA
ATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATT

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8560nt
CGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTG
GAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTA
AGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAA
AATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATC
CACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAAC
AGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAAT
AGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGAC
AGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAG
TCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAA
GAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTAT
TCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGAAGCACAGGCACACCATCC
CCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATC
AGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCC
GAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTG
GTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAAC
TATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCC
AGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCC
CAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTT
TTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCAC
GCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGG
GAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACA
GTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGC
GCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGG
TGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCT
AACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTG
CTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTC
AGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAAC
TAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAAC
TCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATA
GTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCT
TTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAG
TAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCT
ACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGC
AGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGT
GAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAG
AATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCC
TGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTC
CATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTC
CCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCT
ATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCA
GCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCC
TTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAG
TAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTG
TATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGA
TCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAAT
GCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCT
TTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCT
AAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGA
GTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTG
AATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATT
GGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGA
AAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGA
AGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAA
AAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGG
CTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGG
TTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAA
CACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTT
TGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAA
TTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATT
TTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAA
GTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTG
AGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTG
TCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTAC
CTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCA
TAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAG
CAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTAT
ACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATG
TGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTT
GCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAAT
CACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGG
GAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACT
TGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGA
AAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTA
ATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAAATTAATAAAAATTTCGAGAAATCATTGGG

>In-frame_PTPN13_ENST00000316707_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8541nt
CGTCCCTGCAGCCCTCGCCCGGCGCTCCAGTAGCAGGACCCGGTCTCGGGACCAGCCGGTAATATGCACGTGTCACTAGCTGAGGCCCTG
GAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTA
AGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCATCTGGTAGTGTGTCATTTACAGATGAA
AATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATC
CACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAACCTATTAAGCTTGGAGATCATCTCAAC
AGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAAT
AGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTTTCTGGGCAGACCTACTCCAATGAAGTC
CATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAGCAATACATACGCCTAGTACAGCTGAGCCATCC
AAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAAAACAATATGATACATCTTCAAAAACTCACTCA
AATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTGAGGACAGTGACAGTGAACAAACCCCAGAGAAG
CCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCATCAGCACATTCCAGCAGTGCAGAGTCAGAAAGC
ACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCGAAGAAAATGAGCCCCTAGAAACCCCAGCTCCG
GAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCAGCCAGCCAGCTGCGCCACCAGAGGGCCCCAGG
AGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGAGTCAGGAGCATTCTGAATCCAAAGATCCTCCC
CCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGAGGAGCTGTCAGAAGTCTCCGGCACAGCAGGAG
CCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTGCCCGGGCAGGTTCACGGACCAGCCTGCAGGGG
GAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGCCCAAGGTGAAGACGAAAGGACGGCCCCGGGCC
GCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACAAGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTC
TCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTCTTGTTCCCCTGACTGAGAGCCAGGGCCCACCC
CACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGGACAGCCGCAAAGACAGACTCCCATTGCCTTTG
AGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGGTGAAGATCACCCTAGACCTGCTCTCTCGGATA
CCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCGCAGGGAAGAAGCACAGCTCTGAGAAGAGGAGC
TCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTGATAACAAGAAAATCAGACTGGAGAAGGAAATC
AAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCTCCAGGCCCTCCTCACAGTCCTCAAAGAAGGAA
ATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTAAGAGGTCAAGGCGGGAAGCAGACACCTGTGGC
CAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTCCCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCC
AGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGCCTTCTTTGCCAAATGGTAACTCTAAACCAGGG
AAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAAAGATGAAGCAGAAAGCAGAGTTAATGACGGAC
AGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAATTGCCACAGAGTCTGAAAGCCAGTCATCCAAG
TCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAAAATCCTTCTCAGATGCCACAGCGCCAACACAA
GAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGTTTCGTTGTAAAAAAGACATAGCAATAAAGTAT
TCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTCCATGCATTGCAAGCACAGGCACACCATCCCCT
CTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGC
ACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAG
GCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTG
CACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGAGCCCCAGGTTGATTCAATGCCTTGGGAACTAT
TTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAACTCTAAAAAAGAAGCACCACGAGATGGCCAGG
ACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAG
AGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGTATGAATGGTCTAGAAACATTTCTATTTTTTTT
TTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAAAGTGAATTTCACGTCATCTCAGTAGCCACGCT
AGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAG
AAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTCCACTGTGCCCCACTTTCTGCCAATGAACAGTG
GCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCT
GCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGC
CACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAAC
AGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAACATTTATACCTGACCAGATGGCTAAAGTGCTT
TTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTATGTGGTAACTCATGTTGTCCAGCCAACTCAGA
GTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTGCTACAAATATTTTATATTTATAGCAAAACTAG
ACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCA
TCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTG
TATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAATCCCATGTGCCCATAAGCACAGATTTTTCTTTT
TCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAG
AATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTTGTCCCATTCTGCCCCTGTACATGTTTCCTACC
AAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATGAAGACATCTAAGATCCCTATGATGAATGCAGG
AACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAG
GCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAAT
GACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTTTCATTTATTCATGTTATAAAGCAAAGCCCTGG
TCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCAT
CTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGTTATTTAACATCTTTCTTTTTTCCTTACTCCCT
TAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATG
CAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCT
CTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCTGAACTTGATATAAAGATTTTATTTGTCCCTTG
AAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTGATCCTTATTGCATTGTACCTAAAGGAGAGTAA
CTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTAT
ATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCA
TTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAATAATAGTACACACTTCAGAGTAAGACAAATGCA
AAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTA
GTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAA
TAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTG
GGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTGTCTGATATTATGATTTGATTACAATACTGAAT
GGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAAAATATGTAGCTATTTCCCTTACACAGATTGGA
CCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAA
CTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTTATTATGATTCATCTTCAGTAATTTTTAGAAGC
AAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGGGATATAAATATATACACTTAAATAGAGAAAAA
GAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGTTTCGCCATGGCTTCAGGGATGCTACATGGCTC
TTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTT
TTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCTTCCTACCACAGATTCTTTATTTTCCCAAACAC
TACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATTAGCAGTATTTAAATCTTGCAAGAATATTTTGT
GCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCATTGCAGCCATGAAGGGATGCTAGGATCAATTA
TGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTCCCACTTAGGATTAATGGATGTAAGGTATTTTC
CTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTG
ATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGACTTGGAGTGTTCATCTCTTCATGAATTGTGAGC
ACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCA
GGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTACTGGGTAGAGAAGTGCCTATACTTCTCTACCTA
AGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCCTGGAGAGGACAAGGGAATAAGACCACTCATAG
TGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAA
TGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATTACTGCATATCCCCCTCAGATATCAAGTATACA
CTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGA
TCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATATATTATATTATATTATATTATATATTTTTTGCT
TTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGGAGTAAATTTTCCAGTTGATAAATGAAAATCAC
TGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCATCAACACAATGATTTTGTACATAGGGTAGGGAA
GCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATTTTACCTACTTCAGCAATGGAACTGCAACTTGG
GGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAA
ATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGAGGATTAATTGCTGTTTAAACAAAAATGTAATT

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000395146_chr4_88005272_+_8502nt
GTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTG
CTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGC
TGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGT
CACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGA
GCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTG
TGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAA
ATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAG
CAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAA
AACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTG
AGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCAT
CAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCG
AAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCA
GCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGA
GTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGA
GGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTG
CCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGC
CCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACA
AGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTC
TTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGG
ACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGG
TGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCG
CAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTG
ATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCT
CCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTA
AGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTC
CCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGC
CTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAA
AGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAA
TTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAA
AATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGT
TTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTC
CATGCATTGCAAGAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCA
GTGTGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATG
TTCTTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCA
CCTTGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAAT
GGAGCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACC
AAACTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGG
TTATGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGG
TGTATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCT
GAAAGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTT
TTGTGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGA
CTCCACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTC
CTGCCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTC
GGAGCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATT
TCCCACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAAC
CAACATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAG
TTATGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTT
CTGCTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAG
ATTTGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGA
GGAACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGA
AATCCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTT
AAAAGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCC
TTTGTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATA
ATGAAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGA
TGCTTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGG
TCTGGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCG
GTTTCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTG
GTAGGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGA
TGTTATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAAT
TGTGAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGA
CTGAAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTC
TCTGAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTT
CTGATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTA
ACGTTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACA
ATTCCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAAC
AATAATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGT
GTGTGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCT
TTCTGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGA
AAACATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGA
CTGTCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGAC
CAAAATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAG
AAAGCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGT
TTTATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAA
AGGGATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTT
TGTTTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAA
AGTAGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTT
GCTTCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTG
ATTAGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTAC
GCATTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGG
GTCCCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCA
TCGTGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGT
GACTTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTG
CTTTTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTG
TACTGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCG
GCCTGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGAC
AACTTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAA
ATTACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCC
CAAATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTA
TATATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAA
AGGAGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTAT
CATCAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGT
ATTTTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGAT
CTGTGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAA
TGAGGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAA

>In-frame_PTPN13_ENST00000511467_chr4_87610343_+_AFF1_ENST00000307808_chr4_88005272_+_8483nt
GTAATATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAAATATGGGCTGTATTAAATCAAAGTG
CTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGCCTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGC
TGCCATCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACTGCACCAGAGGTTCTTCAAAATCAGT
CACTAACTTCTCTCTCAGATGTTGAAAAGATCCACATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGA
GCCAACCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATTTACGCTCGAGTTTCTGTTCGGACTG
TGCTGGATGCTTGCAGTGCCCACATTAGGAATAGCAATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAA
ATCTTTCTGGGCAGACCTACTCCAATGAAGTCCATTGTGTTGAAGAGATTCTGAAGGAAATGACCCATTCATGGCCGCCTCCTTTGACAG
CAATACATACGCCTAGTACAGCTGAGCCATCCAAGTTTCCTTTCCCTACAAAGGACTCTCAGCATGTCAGTTCTGTAACCCAAAACCAAA
AACAATATGATACATCTTCAAAAACTCACTCAAATTCTCAGCAAGGAACGTCATCCATGCTCGAAGACGACCTTCAGCTCAGTGACAGTG
AGGACAGTGACAGTGAACAAACCCCAGAGAAGCCTCCCTCCTCATCTGCACCTCCAAGTGCTCCACAGTCCCTTCCAGAACCAGTGGCAT
CAGCACATTCCAGCAGTGCAGAGTCAGAAAGCACCAGTGACTCAGACAGTTCCTCAGACTCAGAGAGCGAGAGCAGTTCAAGTGACAGCG
AAGAAAATGAGCCCCTAGAAACCCCAGCTCCGGAGCCTGAGCCTCCAACAACAAACAAATGGCAGCTGGACAACTGGCTGACCAAAGTCA
GCCAGCCAGCTGCGCCACCAGAGGGCCCCAGGAGCACAGAGCCCCCACGGCGGCACCCAGAGAGTAAGGGCAGCAGCGACAGTGCCACGA
GTCAGGAGCATTCTGAATCCAAAGATCCTCCCCCTAAAAGCTCCAGCAAAGCCCCCCGGGCCCCACCCGAAGCCCCCCACCCCGGAAAGA
GGAGCTGTCAGAAGTCTCCGGCACAGCAGGAGCCCCCACAAAGGCAAACCGTTGGAACCAAACAACCCAAAAAACCTGTCAAGGCCTCTG
CCCGGGCAGGTTCACGGACCAGCCTGCAGGGGGAAAGGGAGCCAGGGCTTCTTCCCTATGGCTCCCGAGACCAGACTTCCAAAGACAAGC
CCAAGGTGAAGACGAAAGGACGGCCCCGGGCCGCAGCAAGCAACGAACCCAAGCCAGCAGTGCCCCCCTCCAGTGAGAAGAAGAAGCACA
AGAGCTCCCTCCCTGCCCCCTCTAAGGCTCTCTCAGGCCCAGAACCCGCGAAGGACAATGTGGAGGACAGGACCCCTGAGCACTTTGCTC
TTGTTCCCCTGACTGAGAGCCAGGGCCCACCCCACAGTGGCAGCGGCAGCAGGACTAGTGGCTGCCGCCAAGCCGTGGTGGTCCAGGAGG
ACAGCCGCAAAGACAGACTCCCATTGCCTTTGAGAGACACCAAGCTGCTCTCACCGCTCAGGGACACTCCTCCCCCACAAAGCTTGATGG
TGAAGATCACCCTAGACCTGCTCTCTCGGATACCCCAGCCTCCCGGGAAGGGGAGCCGCCAGAGGAAAGCAGAAGATAAACAGCCGCCCG
CAGGGAAGAAGCACAGCTCTGAGAAGAGGAGCTCAGACAGCTCAAGCAAGTTGGCCAAAAAGAGAAAGGGTGAAGCAGAAAGAGACTGTG
ATAACAAGAAAATCAGACTGGAGAAGGAAATCAAATCACAGTCATCTTCATCTTCATCCTCCCACAAAGAATCTTCTAAAACAAAGCCCT
CCAGGCCCTCCTCACAGTCCTCAAAGAAGGAAATGCTCCCCCCGCCACCCGTGTCCTCGTCCTCCCAGAAGCCAGCCAAGCCTGCACTTA
AGAGGTCAAGGCGGGAAGCAGACACCTGTGGCCAGGACCCTCCCAAAAGTGCCAGCAGTACCAAGAGCAACCACAAAGACTCTTCCATTC
CCAAGCAGAGAAGAGTAGAGGGGAAGGGCTCCAGAAGCTCCTCGGAGCACAAGGGTTCTTCCGGAGATACTGCAAATCCTTTTCCAGTGC
CTTCTTTGCCAAATGGTAACTCTAAACCAGGGAAGCCTCAAGTGAAGTTTGACAAACAACAAGCAGACCTTCACATGAGGGAGGCAAAAA
AGATGAAGCAGAAAGCAGAGTTAATGACGGACAGGGTTGGAAAGGCTTTTAAGTACCTGGAAGCCGTCTTGTCCTTCATTGAGTGCGGAA
TTGCCACAGAGTCTGAAAGCCAGTCATCCAAGTCAGCTTACTCTGTCTACTCAGAAACTGTAGATCTCATTAAATTCATAATGTCATTAA
AATCCTTCTCAGATGCCACAGCGCCAACACAAGAGAAAATATTTGCTGTTTTATGCATGCGTTGCCAGTCCATTTTGAACATGGCGATGT
TTCGTTGTAAAAAAGACATAGCAATAAAGTATTCTCGTACTCTTAATAAACACTTCGAGAGTTCTTCCAAAGTCGCCCAGGCACCTTCTC
CATGCATTGCAAGCACAGGCACACCATCCCCTCTTTCCCCAATGCCTTCTCCTGCCAGCTCCGTAGGGTCCCAGTCAAGTGCTGGCAGTG
TGGGGAGCAGTGGGGTGGCTGCCACTATCAGCACCCCAGTCACCATCCAGAATATGACATCTTCCTATGTCACCATCACATCCCATGTTC
TTACCGCCTTTGACCTTTGGGAACAGGCCGAGGCCCTCACGAGGAAGAATAAAGAATTCTTTGCTCGGCTCAGCACAAATGTGTGCACCT
TGGCCCTCAACAGCAGTTTGGTGGACCTGGTGCACTATACACGACAGGGTTTTCAGCAGCTACAAGAATTAACCAAAACACCTTAATGGA
GCCCCAGGTTGATTCAATGCCTTGGGAACTATTTTTGCACATTGGAAGCCTCAAAAACAGTCCAGACATTTGTTTCATCAGGACACCAAA
CTCTAAAAAAGAAGCACCACGAGATGGCCAGGACATTTGTCCACTTAAACTCTCAACAACAGTGTGATCATTGGTTGGACACTGTGGTTA
TGCAGAAGCAGAGATGAGGAGGCTGGCCCCAGAGATGATCTTGCCCTTCCTAACTAAAGGACAGAAGTGCAATTTAGCTTAAATGGGTGT
ATGAATGGTCTAGAAACATTTCTATTTTTTTTTTAAACCAGCAGGATACAAGTTGCAAATGAAATGAGGAGAAACAGTTTCAACTCTGAA
AGTGAATTTCACGTCATCTCAGTAGCCACGCTAGTCCATTCCCAGAAGGAAATTTTTTTTTTTAACAATGACTTTTGGTAAAGGGTTTTG
TGGATGATTTTTTTTCTTTTGAGTTTTGGGAGAAATATTTGTTTAGTAACTTCTAATGGCCATCTGTAAACCATAAGTAATGAAGGACTC
CACTGTGCCCCACTTTCTGCCAATGAACAGTGGCTTGATAATACCAAGTATTGTTGTAATTTATAAAATTGAAGGCAACCCCCGCTCCTG
CCGCCCCCAATCTCCCCATTGCCTAGAGCGCTGCACATTGACCCCAGCTCTGACTTCTCATTACTGTGCTGAAAGTCAGCCCACGTCGGA
GCGGTGAGGAGGAGCCACAGCACATGGGGTGCCACCTCGAGGTCTGCACAGGAGGACTTGGCGCTGCCATTTCCTACCCCTGCCATTTCC
CACCCCTGCTTCAGCGAAAGGGACTCTCTAACAGGGCAGTCACTGTTGACTCTATTCTGAATTTCCTCCCTTGGGGAAGAAGGGAACCAA
CATTTATACCTGACCAGATGGCTAAAGTGCTTTTAAAGTTTTGTTTAAGTAGAGCTGGAATTTGAGGTGCTGATCTGTGGTCTACAGTTA
TGTGGTAACTCATGTTGTCCAGCCAACTCAGAGTTTCGTCAGTGAACAAGAAACATGAAATCTGCTTCTTAGAGAGGCTATATTTTTCTG
CTACAAATATTTTATATTTATAGCAAAACTAGACTTTCAGAGTCCTTGATTGTCTAGGGGAAGTTAACTCCCTGAGAGGATGTAGAGATT
TGGGGTGGTTGATTAGACTTTTGAAAAACTCATCACCACATGCCTTCACTCCAGAGTGTTCTCAGCTAGATTTGATTTGGTTGAGGAGGA
ACTGTGGCCCTCCGTAAGTTATTGCCATAGTGTATGCATTAAACCAAGTCCATTTTGAATGACCTAAAATGAAGTAACACAATCAGAAAT
CCCATGTGCCCATAAGCACAGATTTTTCTTTTTCATTGAAACTTTAAAGGTTATTATTGGAAACATTACTTTGAGTGCAGTGTTTTTAAA
AGCCAATTCTTTTTTATCCCTTTTAGAAGTAGAATTTGCACACTTACTACAATTGAGGAGTGTCATCTCTATAACTTTTTCTCCGCCTTT
GTCCCATTCTGCCCCTGTACATGTTTCCTACCAAGCATGTTTCACATTTTCCTATTAGTGGAGGAGGGAGAACCATATTTATTTATAATG
AAGACATCTAAGATCCCTATGATGAATGCAGGAACTCTCTTGGTAGTTTGTAAATACACAAAGGGATGTGTCGAGGGATGGGAGCGATGC
TTATCTCTCACAGTGTGAGTGGTCTGTGTGAGGCTGTTCCTTCAGTTTCTTCTCCAGACTGTTCTTTGGTTGTCACTAAGTCAGAGGTCT
GGTCCCTCATGTTTAGGTGAAAGCCAGAGAATGACAGCTGTAGTCATATCTGAGCATAAGACCTTGATGTGTGATTCCTGATGACCGGTT
TCATTTATTCATGTTATAAAGCAAAGCCCTGGTCCTTTTTAAACTACTAGTTTTAAAAACCTGTGTTAAATGAACAGTAATTGCCTGGTA
GGTTTGGTGTGTGTGTAGCATTGTGTGTCCATCTGTTATATGTAAAGGACAAGGCACCAGAATCAGGCTTTATTTCGATATTGAAGATGT
TATTTAACATCTTTCTTTTTTCCTTACTCCCTTAGCCATCCCCTCCCCTTTTGTCCTATCATTCCCTAGAACAAGCCACCTGTCAATTGT
GAAGGGTTGTGTTCTTTATGGCAGGTTCTATGCAGATTGTGCCAGAGCATGTGCGTGTTCTGTTGGCAAGCCACAGTGCTCCCTTGACTG
AAGACATTTCCAGGTAGATTTCTCAGCCAGCTCTAAAACAGATTGCTTTTTCAGTGGCCTTACTCTTTGTGGGTTTTTTTTTTTTTCTCT
GAACTTGATATAAAGATTTTATTTGTCCCTTGAAAAAGTAACAAATGTGCATAGATCAATTTGTACTACTTTGGTCATTGGATATTTCTG
ATCCTTATTGCATTGTACCTAAAGGAGAGTAACTAATGGTAACCTTTTTAATAGAGTATGTGAAAGGTAGTGGCTGATGAATCCTTAACG
TTCATAGGGTCTTTTTGCTGTTACGGTTGTATATAGAGGTCTGAAGGATTTTTAAAATGATTTGCACTTTTTCACTGCATGCTTACAATT
CCCAAAGGCAAAATCTGTACTGAGGTAGATCATTTGAAAGGGCTAGATTATAAAATTAAGCCTTAGAGTATGGAAAGTTCTTATAACAAT
AATAGTACACACTTCAGAGTAAGACAAATGCAAAGCATCTTAAGGAGTGAAAATAGAGTGTAAATCTTGCCTTTGGCACTACAAGGTGTG
TGTGTGTGTGTGTGTGTGTGTGTGTGTCTTTAGTAGGAAATGGAAGAACACTGTTTTATTTTTTAAAGTGTTTAATGTTTCTGTCCTTTC
TGTGAATTATTGAATTTAAGAGCCCTGCTAAATAATGAAAAAACACTTTACTAAAATTTATCAAATTATACTGGGTTCGGATTGTGAAAA
CATTGGCCACCTAGTAGCAGTGGTGAGGAGTGGGAGGGCCCAGCAAGCATTTATCAGAAATAGAATCACAATAGGAGGAGAATTTGACTG
TCTGATATTATGATTTGATTACAATACTGAATGGGAAAAGTATCTAATATTTTGTAACAAAAAGACCTTCATATTATCTGTTTTGACCAA
AATATGTAGCTATTTCCCTTACACAGATTGGACCGCACTTATCTCCCTTGTCCTGTATCCTTTAATTTCAGGTCTCAGGATGTTTAGAAA
GCTAAAACCCCCTACCCCTTTCTGGCTGAAAACTTGCCTTATTTGGTATCTTACACATTAATGTTACTAGCATCAGGAGCTTACTGTTTT
ATTATGATTCATCTTCAGTAATTTTTAGAAGCAAGAAGAAAGCCATTGTGTCCTCTACAATTAACAAAACTTATCTCTGATATACAAAGG
GATATAAATATATACACTTAAATAGAGAAAAAGAGGTTGATTGAATTGTGCCTTTGAGTGAACCCAGTTTTTAAATACCGCTGTGTTTGT
TTCGCCATGGCTTCAGGGATGCTACATGGCTCTTGCACCTTTTACTCCTCTGCTTTATGAAGTTTGAGTTGTATTTGTGCATCTTAAAGT
AGGTTGAGGCTTGAGGCTGGGCTTTCGGGTTTTTTTGTTTTTTGTTTTGTTTTGTTTTGTTTTGTTTTCTTGTACTTAAACCTGCTTGCT
TCCTACCACAGATTCTTTATTTTCCCAAACACTACAAAAAAACTTTTAAAACTTTGCCATTTCATCTGTTTACACTCTTTGCCACTGATT
AGCAGTATTTAAATCTTGCAAGAATATTTTGTGCTTTCTTTAGAAACACAAGAGTATAGATTTTTCTCACTGAAAAGTGAGAGTTACGCA
TTGCAGCCATGAAGGGATGCTAGGATCAATTATGGCAGTACCTTTTTTCCCCTCCTGTTCTTGAGCCAGTTGTCTCTTTTGTTTTGGGTC
CCACTTAGGATTAATGGATGTAAGGTATTTTCCTGTGCCTTTATTTTGTGTCATTCTATTGGAAGGAGGTGTAACGGCAGAATAGCATCG
TGTTGGGGGTTTTCCTTCAAACACTGCAAGTGATATTGCCACCATGTGAACCTCAAATATGCAATCCAGTTGTGTTGGTTTCTCGGTGAC
TTGGAGTGTTCATCTCTTCATGAATTGTGAGCACTGACCATGTTCTTCAGTTCTTAATTATGGTGAGTTGACAAATACCAACTACTGCTT
TTCTTTAGGTGGCTATAAATTTCTTACTGTCAGGAGGAAATGACATTATATTCTGTTCCACTGAACGTCAGAGATCAGCAGGCACTGTAC
TGGGTAGAGAAGTGCCTATACTTCTCTACCTAAGAGGGCAGGAGGGAAACCCTACAGCTCCTTGTGAGCCTATATATTAGTATATCGGCC
TGGAGAGGACAAGGGAATAAGACCACTCATAGTGAGGCTGGCCAAGCTGCACTGGTCGGACCAGGCAGTGGCTGACCTAAGGAAGACAAC
TTGCTTTGCTTAAAAGTAGATTTTTTAAGCAATGCTTAACACAGGCAGCATTCACCTTTGTTCAGGCCATCGACATGTATTGTTAAAATT
ACTGCATATCCCCCTCAGATATCAAGTATACACTGTTCATGTTGGGGTTGTGTGTGTGTATGTGTGTATGTACGCACGCATGTGTCCCAA
ATCTTGTTTTAATTTTTTTTTTCTGAATGTGATCATGTTTTGGATGATACCTGAGCAGGGTTGCCTTTTTTTTATTTATTACCATTATAT
ATTATATTATATTATATTATATATTTTTTGCTTTCTTATAACTTTGGAGGAAAGTCAAATCTTGGTATTATTAAAATTGTTTTAAAAAGG
AGTAAATTTTCCAGTTGATAAATGAAAATCACTGGCCTATGTTTAATAAGTTTTTCTTTAATTACTGTGGAATAACGTGCCAGCTATCAT
CAACACAATGATTTTGTACATAGGGTAGGGAAGCAGTGATGCTCTCAATGGGAAGATGTGCAACACAAATTAAGGGGAACTCCATGTATT
TTACCTACTTCAGCAATGGAACTGCAACTTGGGGCTTTGTGAATAAAATTTAGCTGCCTTGTATAGTCGTTTGAAAGAATATGTGATCTG
TGAGAGAATTATAGTTTTTTTTTAGAAGAAAAATCTGCAAAAGATCTTTCCAAAGACAATGTGCCACAGATCTTTTGTTCTCTGTAATGA
GGATTAATTGCTGTTTAAACAAAAATGTAATTGTTCATCTTTAAATTCTTTCCTTTTCATAAGAGGATCAAGCTGTAAAAAAACAAAAAA


Top

FusionGenePPI for PTPN13_AFF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTPN13PKN2, NFKBIA, EFNB1, ARHGAP29, FASLG, CTNNB1, GHR, FBXL2, LATS1, LATS2, YWHAB, RAPGEF2, RASSF10, WHSC1, FBXW11, DNM2, NINL, TMEM17, PLEKHA1, STXBP4, PTEN, RGS2, DFFB, KCTD3, KIF13B, CGN, ZBTB21, KSR1, GIGYF1, LPIN3, LRFN1, RTKN, DENND4C, MAST3, SH3RF3, DENND1A, SH3PXD2A, SRGAP2, PPM1H, TANC2, RALGPS2, EIF4E2, SIPA1L1, NF1, CDC25C, CBY1, GIGYF2, INPP5E, MTNR1A, HEY1AFF1MLLT1, CCNT1, NT5E, MLLT3, CDK9, AFF4, KMT2A, AFF1, BRD4, RELA, NPM1, PCSK1, MLLT10, DOT1L, POLR2A, DDX6, HEXIM1, HIST3H3, NSD1, CARM1, SIAH1, SIAH2, SMAD9, MED26, EAF1, ELL2, LARP7, ELL3, HDAC1, MYH7, SLC16A6, ZNF526, VDR, PIP4K2A, CAMKV, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTPN13_AFF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTPN13_AFF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource