FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29366

FusionGeneSummary for PTK7_DLK2

check button Fusion gene summary
Fusion gene informationFusion gene name: PTK7_DLK2
Fusion gene ID: 29366
HgeneTgene
Gene symbol

PTK7

DLK2

Gene ID

5754

65989

Gene nameprotein tyrosine kinase 7 (inactive)delta like non-canonical Notch ligand 2
SynonymsCCK-4|CCK4DLK-2|EGFL9
Cytomap

6p21.1

6p21.1

Type of geneprotein-codingprotein-coding
Descriptioninactive tyrosine-protein kinase 7PTK7 protein tyrosine kinase 7colon carcinoma kinase 4pseudo tyrosine kinase receptor 7tyrosine-protein kinase-like 7protein delta homolog 2EGF-like protein 9EGF-like-domain, multiple 9delta-like 2 homologepidermal growth factor-like protein 9
Modification date2018052320180519
UniProtAcc

Q13308

Q6UY11

Ensembl transtripts involved in fusion geneENST00000230419, ENST00000349241, 
ENST00000345201, ENST00000352931, 
ENST00000481273, ENST00000476760, 
ENST00000471863, 
ENST00000372485, 
ENST00000372488, ENST00000414245, 
ENST00000357338, 
Fusion gene scores* DoF score10 X 3 X 10=3001 X 1 X 1=1
# samples 101
** MAII scorelog2(10/300*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PTK7 [Title/Abstract] AND DLK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDLK2

GO:0045746

negative regulation of Notch signaling pathway

25093684


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-05-4420-01APTK7chr6

43044305

+DLK2chr6

43422212

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000230419ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000230419ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000230419ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000230419ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000349241ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000349241ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000349241ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000349241ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000345201ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000345201ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000345201ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000345201ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000352931ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000352931ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000352931ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000352931ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
intron-3CDSENST00000481273ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
intron-3CDSENST00000481273ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
intron-3CDSENST00000481273ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
intron-3CDSENST00000481273ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000476760ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000476760ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000476760ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000476760ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000471863ENST00000372485PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000471863ENST00000372488PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000471863ENST00000414245PTK7chr6

43044305

+DLK2chr6

43422212

-
In-frameENST00000471863ENST00000357338PTK7chr6

43044305

+DLK2chr6

43422212

-

Top

FusionProtFeatures for PTK7_DLK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTK7

Q13308

DLK2

Q6UY11

Regulates adipogenesis. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-16131_17225384DomainEGF-like 4
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-16174_21025384DomainEGF-like 5%3B calcium-binding
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-16212_24825384DomainEGF-like 6%3B calcium-binding
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-1627_5825384DomainEGF-like 1
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-1662_8925384DomainEGF-like 2
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-1691_12925384DomainEGF-like 3
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-16131_17225384DomainEGF-like 4
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-16174_21025384DomainEGF-like 5%3B calcium-binding
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-16212_24825384DomainEGF-like 6%3B calcium-binding
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-1627_5825384DomainEGF-like 1
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-1662_8925384DomainEGF-like 2
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-1691_12925384DomainEGF-like 3
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-1627_30625384Topological domainExtracellular
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-16328_38325384Topological domainCytoplasmic
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-1627_30625384Topological domainExtracellular
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-16328_38325384Topological domainCytoplasmic
TgeneDLK2chr6:43044305chr6:43422212ENST00000357338-16307_32725384TransmembraneHelical
TgeneDLK2chr6:43044305chr6:43422212ENST00000372488-16307_32725384TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120128_218261071DomainNote=Ig-like C2-type 2
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120225_317261071DomainNote=Ig-like C2-type 3
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120309_407261071DomainNote=Ig-like C2-type 4
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+12031_120261071DomainNote=Ig-like C2-type 1
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120412_497261071DomainNote=Ig-like C2-type 5
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120503_586261071DomainNote=Ig-like C2-type 6
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120578_680261071DomainNote=Ig-like C2-type 7
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120796_1066261071DomainProtein kinase%3B inactive
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119128_218261031DomainNote=Ig-like C2-type 2
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119225_317261031DomainNote=Ig-like C2-type 3
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119309_407261031DomainNote=Ig-like C2-type 4
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+11931_120261031DomainNote=Ig-like C2-type 1
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119412_497261031DomainNote=Ig-like C2-type 5
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119503_586261031DomainNote=Ig-like C2-type 6
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119578_680261031DomainNote=Ig-like C2-type 7
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119796_1066261031DomainProtein kinase%3B inactive
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117128_21826941DomainNote=Ig-like C2-type 2
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117225_31726941DomainNote=Ig-like C2-type 3
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117309_40726941DomainNote=Ig-like C2-type 4
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+11731_12026941DomainNote=Ig-like C2-type 1
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117412_49726941DomainNote=Ig-like C2-type 5
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117503_58626941DomainNote=Ig-like C2-type 6
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117578_68026941DomainNote=Ig-like C2-type 7
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117796_106626941DomainProtein kinase%3B inactive
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119128_218261015DomainNote=Ig-like C2-type 2
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119225_317261015DomainNote=Ig-like C2-type 3
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119309_407261015DomainNote=Ig-like C2-type 4
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+11931_120261015DomainNote=Ig-like C2-type 1
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119412_497261015DomainNote=Ig-like C2-type 5
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119503_586261015DomainNote=Ig-like C2-type 6
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119578_680261015DomainNote=Ig-like C2-type 7
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119796_1066261015DomainProtein kinase%3B inactive
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120128_218-241079DomainNote=Ig-like C2-type 2
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120225_317-241079DomainNote=Ig-like C2-type 3
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120309_407-241079DomainNote=Ig-like C2-type 4
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+12031_120-241079DomainNote=Ig-like C2-type 1
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120412_497-241079DomainNote=Ig-like C2-type 5
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120503_586-241079DomainNote=Ig-like C2-type 6
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120578_680-241079DomainNote=Ig-like C2-type 7
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120796_1066-241079DomainProtein kinase%3B inactive
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+12031_704261071Topological domainExtracellular
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120726_1070261071Topological domainCytoplasmic
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+11931_704261031Topological domainExtracellular
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119726_1070261031Topological domainCytoplasmic
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+11731_70426941Topological domainExtracellular
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117726_107026941Topological domainCytoplasmic
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+11931_704261015Topological domainExtracellular
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119726_1070261015Topological domainCytoplasmic
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+12031_704-241079Topological domainExtracellular
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120726_1070-241079Topological domainCytoplasmic
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120705_725261071TransmembraneHelical
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119705_725261031TransmembraneHelical
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117705_72526941TransmembraneHelical
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119705_725261015TransmembraneHelical
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120705_725-241079TransmembraneHelical


Top

FusionGeneSequence for PTK7_DLK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_379aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWADEHIC
TTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCAN
GATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPAT
GPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQVSMLPA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_385aa
MGAARGSPARPRRLPLLSVLLLPLLGADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCD
KDEHICTTQSPCQNGGQCMTDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCL
MRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGTGGKTCELVLPVPDPPTTVDTPLGPTSA
VVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHTAPACQDQECQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1137nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGT
ACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGG
CGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCT
CTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAAC
GGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGAC
TGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAG
ACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACG
GGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCT
AGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGT
GTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1155nt
ATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGC
AGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGC
TGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGAC
AAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGC
TTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAG
GACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTG
ATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGC
ACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCC
AGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCT
GTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAG
GCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTG
AGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1545nt
GGCGGGGCTTGGCGGCGGCGGCGGCGGCGCGCGGGGACTCGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTC
GGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCG
CCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGC
TCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCT
GCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGC
AGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGG
GCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCAT
GCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTG
AGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTG
AGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCC
ACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACA
CCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGA
AGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTC
TGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAG
CGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAG
CACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCT
TGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGGAATTTTATCAAATAAA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1563nt
GGCGGGGCTTGGCGGCGGCGGCGGCGGCGCGCGGGGACTCGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTC
GGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCG
CCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGC
TCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCT
GCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGC
AGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCC
AGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTG
AACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCT
TTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCT
TCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCC
GCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACC
CCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTC
TGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCC
TCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTG
CCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTG
AGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGT
TCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGAT

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1543nt
GGCGGGGCTTGGCGGCGGCGGCGGCGGCGCGCGGGGACTCGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTC
GGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCG
CCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGC
TCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCT
GCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGC
AGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGG
GCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCAT
GCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTG
AGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTG
AGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCC
ACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACA
CCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGA
AGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTC
TGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAG
CGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAG
CACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCT
TGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGGAATTTTATCAAATAAA

>In-frame_PTK7_ENST00000230419_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1561nt
GGCGGGGCTTGGCGGCGGCGGCGGCGGCGCGCGGGGACTCGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTC
GGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCG
CCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGC
TCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCT
GCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGC
AGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCC
AGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTG
AACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCT
TTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCT
TCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCC
GCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACC
CCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTC
TGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCC
TCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTG
CCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTG
AGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGT
TCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGAT

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1471nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1489nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1469nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000349241_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1487nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1471nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1489nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1469nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000345201_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1487nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1471nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1489nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1469nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAG
TGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAA
CAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTT
GTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTC
TCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGC
TGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCC
CCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTG
CTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTC
ACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCC
CCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAG
CCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTC
TCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGATGG

>In-frame_PTK7_ENST00000352931_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1487nt
CGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCG
GAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCC
CGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGT
GCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACC
TGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCCCCC
TGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGC
AAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGC
CGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTT
GACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCA
TGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTC
TTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCAC
AGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTG
GTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGA
CCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCA
CGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCA
GACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAAT

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1506nt
CGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCG
CGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCG
CGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACT
GCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGC
GCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCT
GTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATG
GGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTG
CTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTA
ACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATG
ACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCA
AGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCA
CGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGC
CTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGG
GTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAG
CAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTC
ACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1524nt
CGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCG
CGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCG
CGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACT
GCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGC
GCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTG
ACAAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGT
GCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCC
AGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCC
TGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCT
GCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCC
CCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAG
CTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAG
AGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCC
TGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTC
AGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGC
TTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1504nt
CGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCG
CGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCG
CGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACT
GCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGC
GCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCT
GTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATG
GGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTG
CTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTA
ACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATG
ACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCA
AGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCA
CGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGC
CTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGG
GTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAG
CAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTC
ACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGA

>In-frame_PTK7_ENST00000476760_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1522nt
CGGAGGTACTGGGCGCGCGCGGCTCCGGCTCGGGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCG
CGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCCGCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCG
CGATGGGAGCTGCGCGGGGATCCCCGGCCAGACCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACT
GCAGCTCCCACTGTGACCTGGCCCACGGCTGCTGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGC
GCTGTGTGAGGATGCCTGGCTGCCAGCACGGTACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTG
ACAAAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGT
GCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCC
AGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCC
TGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCT
GCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCC
CCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAG
CTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAG
AGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCC
TGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTC
AGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGC
TTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372485_chr6_43422212_-_1474nt
GGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCC
GCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGA
CCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGC
TGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGT
ACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGC
CAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGT
GAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGC
TTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGC
TTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCC
CGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGAC
CCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGT
CTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCC
CTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCT
GCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCT
GAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCG
TTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000372488_chr6_43422212_-_1492nt
GGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCC
GCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGA
CCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGC
TGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGT
ACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCC
CCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAG
CGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACG
TGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGC
CTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGC
CCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTT
GTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCC
CACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCC
CTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCT
GGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTG
CCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCC
TCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTT

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000414245_chr6_43422212_-_1472nt
GGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCC
GCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGA
CCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGC
TGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGT
ACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGATGAACATATCTGTACCACGCAGTCCCCCTGCCAGAATGGAGGC
CAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAGCGCAAGGCTGGACCCTGT
GAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACGTGCCGCTGCTTGGTGGGC
TTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGCCTTGACGGCATAAACCGC
TTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGCCCATGCCAGAGAGGGGCC
CGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTTGTCTTACCTGTCCCAGAC
CCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCCCACAGCGCAGGGGCTGGT
CTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCCCTGGTGGTGTTTGGGGCC
CTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCTGGACCCTGTTGCTACCCT
GCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTGCCACGTGACTTGCCCCCT
GAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCCTCAGACTGGAGTGGTCCG
TTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTTAATACACAGAATGTAAGA

>In-frame_PTK7_ENST00000471863_chr6_43044305_+_DLK2_ENST00000357338_chr6_43422212_-_1490nt
GGACGCCTCGGGACGCCTCGGGGTCGGGCTCCGGCTGCGGCTGCTGCTGCGGCGCCCGCGCTCCGGTGCGCTCCGCCTCCTGTGCCCGCC
GCGGAGCGCAGTCTGCGCGCCCGCCGTGCGCCCTCAGCTCCTTTTCCTGAGCCCGCCGCGATGGGAGCTGCGCGGGGATCCCCGGCCAGA
CCCCGCCGGTTGCCTCTGCTCAGCGTCCTGCTGCTGCCGCTGCTGGGCGCCGATGACTGCAGCTCCCACTGTGACCTGGCCCACGGCTGC
TGTGCACCTGACGGCTCCTGCAGGTGTGACCCGGGCTGGGAGGGGCTGCACTGTGAGCGCTGTGTGAGGATGCCTGGCTGCCAGCACGGT
ACCTGCCACCAGCCATGGCAGTGCATCTGCCACAGTGGCTGGGCAGGCAAGTTCTGTGACAAAGATGAACATATCTGTACCACGCAGTCC
CCCTGCCAGAATGGAGGCCAGTGCATGTATGACGGGGGCGGTGAGTACCATTGTGTGTGCTTACCAGGCTTCCATGGGCGTGACTGCGAG
CGCAAGGCTGGACCCTGTGAACAGGCAGGCTCCCCATGCCGCAATGGCGGGCAGTGCCAGGACGACCAGGGCTTTGCTCTCAACTTCACG
TGCCGCTGCTTGGTGGGCTTTGTGGGTGCCCGCTGTGAGGTAAATGTGGATGACTGCCTGATGCGGCCTTGTGCTAACGGTGCCACCTGC
CTTGACGGCATAAACCGCTTCTCCTGCCTCTGTCCTGAGGGCTTTGCTGGACGCTTCTGCACCATCAACCTGGATGACTGTGCCAGCCGC
CCATGCCAGAGAGGGGCCCGCTGTCGGGACCGTGTCCACGACTTCGACTGCCTCTGCCCCAGTGGCTATGGTGGCAAGACCTGTGAGCTT
GTCTTACCTGTCCCAGACCCCCCAACCACAGTGGACACCCCTCTAGGGCCCACCTCAGCTGTAGTGGTACCTGCCACGGGGCCAGCCCCC
CACAGCGCAGGGGCTGGTCTGCTGCGGATCTCAGTGAAGGAGGTGGTGCGGAGGCAAGAGGCTGGGCTAGGTGAGCCTAGCTTGGTGGCC
CTGGTGGTGTTTGGGGCCCTCACTGCTGCCCTGGTTCTGGCTACTGTGTTGCTGACCCTGAGGGCCTGGCGCCGGGGTGTCTGCCCCCCT
GGACCCTGTTGCTACCCTGCCCCACACTATGCTCCAGCGTGCCAGGACCAGGAGTGTCAGGTTAGCATGCTGCCAGCAGGGCTCCCCCTG
CCACGTGACTTGCCCCCTGAGCCTGGAAAGACCACAGCACTGTGATGGAGGTGGGGGCTTTCTGGCCCCCTTCCTCACCTCTTCCACCCC
TCAGACTGGAGTGGTCCGTTCTCACCACCCTTCAGCTTGGGTACACACACAGAGGAGACCTCAGCCTCACACCAGAAATATTATTTTTTT


Top

FusionGenePPI for PTK7_DLK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTK7RYK, TSHR, CEACAM21, ATP1B4, BTNL8, NTRK1, PPM1G, CLNK, TMEM17, PPP3CA, PPP3CB, PPM1A, PPM1B, PPM1F, PPM1K, ILKAP, CTDSP2, PTPRR, PTPN6, PTPN7, PTPN11, PTPN12, DUSP10, DUSP14, DUSP15, DUSP18, DUSP19, DUSP21, DUSP26, DUPD1, STYX, CDC14A, PTEN, TPTE, TPTE2, MTMR1, MTMR6, MTMR9, MTMR10DLK2ADAMTSL4, PLSCR1, KRTAP4-12, APP, RNF213, EIF2AK3, RABGAP1L, TARBP1, SLC22A23, VEZT, ASPHD2, NOTCH3, NOTCH1, ZDHHC18, SLC7A2, LDLR, TYW1, LRRC8A, LRRC8E, RABGAP1, XPO7, LCLAT1, ALG5, GBF1, METAP2, LRBA, LRP10, LRP2, STAT3, TNPO2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePTK7chr6:43044305chr6:43422212ENST00000230419+120794_1070261071CTNNB1
HgenePTK7chr6:43044305chr6:43422212ENST00000345201+119794_1070261031CTNNB1
HgenePTK7chr6:43044305chr6:43422212ENST00000349241+117794_107026941CTNNB1
HgenePTK7chr6:43044305chr6:43422212ENST00000352931+119794_1070261015CTNNB1
HgenePTK7chr6:43044305chr6:43422212ENST00000481273+120794_1070-241079CTNNB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTK7_DLK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTK7_DLK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource