FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29328

FusionGeneSummary for PTGFRN_NOTCH2

check button Fusion gene summary
Fusion gene informationFusion gene name: PTGFRN_NOTCH2
Fusion gene ID: 29328
HgeneTgene
Gene symbol

PTGFRN

NOTCH2

Gene ID

5738

4853

Gene nameprostaglandin F2 receptor inhibitornotch 2
SynonymsCD315|CD9P-1|EWI-F|FPRP|SMAP-6AGS2|HJCYS|hN2
Cytomap

1p13.1

1p12

Type of geneprotein-codingprotein-coding
Descriptionprostaglandin F2 receptor negative regulatorCD9 partner 1glu-Trp-Ile EWI motif-containing protein Fprostaglandin F2-alpha receptor regulatory proteinprostaglandin F2-alpha receptor-associated proteinneurogenic locus notch homolog protein 2Notch homolog 2
Modification date2018052320180519
UniProtAcc

Q9P2B2

Q04721

Ensembl transtripts involved in fusion geneENST00000393203, ENST00000496699, 
ENST00000256646, ENST00000602566, 
ENST00000493703, 
Fusion gene scores* DoF score4 X 3 X 3=369 X 7 X 3=189
# samples 49
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(9/189*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PTGFRN [Title/Abstract] AND NOTCH2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNOTCH2

GO:0007050

cell cycle arrest

11306509

TgeneNOTCH2

GO:0007219

Notch signaling pathway

11306509|25985737

TgeneNOTCH2

GO:0010629

negative regulation of gene expression

11306509

TgeneNOTCH2

GO:0045967

negative regulation of growth rate

11306509

TgeneNOTCH2

GO:0046579

positive regulation of Ras protein signal transduction

11306509

TgeneNOTCH2

GO:0070374

positive regulation of ERK1 and ERK2 cascade

11306509


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12L-01APTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393203ENST00000256646PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
5CDS-intronENST00000393203ENST00000602566PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
5CDS-intronENST00000393203ENST00000493703PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
intron-3CDSENST00000496699ENST00000256646PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
intron-intronENST00000496699ENST00000602566PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-
intron-intronENST00000496699ENST00000493703PTGFRNchr1

117492194

+NOTCH2chr1

120512367

-

Top

FusionProtFeatures for PTGFRN_NOTCH2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTGFRN

Q9P2B2

NOTCH2

Q04721

Inhibits the binding of prostaglandin F2-alpha (PGF2-alpha) to its specific FP receptor, by decreasing the receptornumber rather than the affinity constant. Functional coupling withthe prostaglandin F2-alpha receptor seems to occur (Bysimilarity). {ECO:0000250}. Functions as a receptor for membrane-bound ligandsJagged1, Jagged2 and Delta1 to regulate cell-fate determination.Upon ligand activation through the released notch intracellulardomain (NICD) it forms a transcriptional activator complex withRBPJ/RBPSUH and activates genes of the enhancer of split locus.Affects the implementation of differentiation, proliferation andapoptotic programs (By similarity). Involved in bone remodelingand homeostasis. In collaboration with RELA/p65 enhances NFATc1promoter activity and positively regulates RANKL-inducedosteoclast differentiation (PubMed:29149593). Positively regulatesself-renewal of liver cancer cells (PubMed:25985737).{ECO:0000250|UniProtKB:O35516, ECO:0000269|PubMed:21378985,ECO:0000269|PubMed:21378989, ECO:0000269|PubMed:25985737,ECO:0000269|PubMed:29149593}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49149_268404880DomainNote=Ig-like C2-type 2
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+4926_129404880DomainNote=Ig-like C2-type 1
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49276_394404880DomainNote=Ig-like C2-type 3
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341645_16482912472Compositional biasNote=Poly-Ala
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341994_19972912472Compositional biasNote=Poly-Leu
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4342426_24292912472Compositional biasNote=Poly-Ser
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341025_10612912472DomainEGF-like 27%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341063_10992912472DomainEGF-like 28
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341101_11472912472DomainEGF-like 29
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341149_11852912472DomainEGF-like 30%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341187_12232912472DomainEGF-like 31%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341225_12622912472DomainEGF-like 32%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341264_13022912472DomainEGF-like 33
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341304_13432912472DomainEGF-like 34
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341374_14122912472DomainEGF-like 35
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434298_3362912472DomainEGF-like 8%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434338_3742912472DomainEGF-like 9%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434375_4132912472DomainEGF-like 10
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434415_4542912472DomainEGF-like 11%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434456_4922912472DomainEGF-like 12%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434494_5302912472DomainEGF-like 13%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434532_5682912472DomainEGF-like 14%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434570_6052912472DomainEGF-like 15%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434607_6432912472DomainEGF-like 16%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434645_6802912472DomainEGF-like 17%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434682_7182912472DomainEGF-like 18%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434720_7552912472DomainEGF-like 19
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434757_7932912472DomainEGF-like 20%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434795_8312912472DomainEGF-like 21%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434833_8712912472DomainEGF-like 22
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434873_9092912472DomainEGF-like 23%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434911_9472912472DomainEGF-like 24%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434949_9852912472DomainEGF-like 25%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434987_10232912472DomainEGF-like 26%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341425_16772912472RegionNote=Negative regulatory region (NRR)
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341425_14652912472RepeatNote=LNR 1
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341466_15022912472RepeatNote=LNR 2
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341503_15442912472RepeatNote=LNR 3
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341827_18712912472RepeatNote=ANK 1
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341876_19052912472RepeatNote=ANK 2
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341909_19392912472RepeatNote=ANK 3
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341943_19722912472RepeatNote=ANK 4
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341976_20052912472RepeatNote=ANK 5
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4342009_20382912472RepeatNote=ANK 6
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341699_24712912472Topological domainCytoplasmic
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-4341678_16982912472TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49406_536404880DomainNote=Ig-like C2-type 4
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49544_662404880DomainNote=Ig-like C2-type 5
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49688_813404880DomainNote=Ig-like C2-type 6
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49424_427404880MotifNote=Endoplasmic reticulum retention signal
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49703_705404880MotifCell attachment site
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+4926_832404880Topological domainExtracellular
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49854_879404880Topological domainCytoplasmic
HgenePTGFRNchr1:117492194chr1:120512367ENST00000393203+49833_853404880TransmembraneHelical
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434105_1432912472DomainEGF-like 3
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434144_1802912472DomainEGF-like 4
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434182_2192912472DomainEGF-like 5%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434221_2582912472DomainEGF-like 6
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-434260_2962912472DomainEGF-like 7%3B calcium-binding
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-43426_632912472DomainEGF-like 1
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-43464_1022912472DomainEGF-like 2
TgeneNOTCH2chr1:117492194chr1:120512367ENST00000256646-43426_16772912472Topological domainExtracellular


Top

FusionGeneSequence for PTGFRN_NOTCH2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTGFRN_ENST00000393203_chr1_117492194_+_NOTCH2_ENST00000256646_chr1_120512367_-_2585aa
MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDTDGPSEQNFDWSFSSLGSSFVELASTWEVGFPAQLYQERLQRG
EILLRRTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNTEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTH
LALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSADQGSYRCIVSEWIAEQGNWQEIQEKAVEVA
TVVIQPSVLRAAVPKNVSVAEGKELDLTCNITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLV
RDVSKENSGYTYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLGQFCTEDVDECLLQPNACQNGGTCANRNGGTGCVCVNGWSGDDCSE
NIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQTICTCPQGYKGADCTEDVDECAMANSNPC
EHAGKCVNTDGAFHCECLKGTAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQ
CLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGTECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQ
IDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATC
INGVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGTKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGF
KGTNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESTTCLCAPGWQGQRCTIDIDEC
ISKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKNGGTCSDY
VNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTG
KNCQTLVNLCSRSPCKNKGTCVQKKAESQCLCPSGWAGATCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGTTGSYCE
EQLDECASNPCQHGATCSDFIGGYRCECVPGTQGVNCETEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLN
GGQCMDRIGGYSCRCLPGFAGERCEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNMPD
GFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCASSPCQHGGSCHPQRQPPTYSCQCAPPFSGSRCELYTAP
PSTPPATCLSQTCADKARDGVCDEACNSHACQWDGGDCSLTMENPWANCSSPLPCWDTINNQCDELCNTVECLFDNFECQGNSKTCKTDK
YCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKRDSQGELMVYPTTGEKS
AAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLTLLAVAVV
IILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNLSVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALL
SEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIITDLVYQGA
SLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVE
GMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSTEAAKILLDHFANRDITDHMDRLPR
DVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMGKKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSE
KVQLSESSVTLSPVDSLESPHTTVSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPSVSQLLSH
HHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHPGIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQ
PAGAPQPQSTCPPAVAGPLPTMYQIPEMARLPSVAFPTAMMPQQDGQVAQTILPATHPFPASVGKYPTPPSQHSTASSNAAERTPSHSGH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTGFRN_ENST00000393203_chr1_117492194_+_NOTCH2_ENST00000256646_chr1_120512367_-_7755nt
ATGGGGCGCCTGGCCTCGAGGCCGCTGCTGCTGGCGCTCCTGTCGTTGGCTCTTTGCCGAGGGCGTGTGGTGAGAGTCCCCACAGCGACC
CTGGTTCGAGTGGTGGGCACTGAGCTGGTCATCCCCTGCAACGTCAGTGACTATGATGGCCCCAGCGAGCAAAACTTTGACTGGAGCTTC
TCATCTTTGGGGAGCAGCTTTGTGGAGCTTGCAAGCACCTGGGAGGTGGGGTTCCCAGCCCAGCTGTACCAGGAGCGGCTGCAGAGGGGC
GAGATCCTGTTAAGGCGGACTGCCAACGACGCCGTGGAGCTCCACATAAAGAACGTCCAGCCTTCAGACCAAGGCCACTACAAATGTTCA
ACCCCCAGCACAGATGCCACTGTCCAGGGAAACTATGAGGACACAGTGCAGGTTAAAGTGCTGGCCGACTCCCTGCACGTGGGCCCCAGC
GCGCGGCCCCCGCCGAGCCTGAGCCTGCGGGAGGGGGAGCCCTTCGAGCTGCGCTGCACCGCCGCCTCCGCCTCGCCGCTGCACACGCAC
CTGGCGCTGCTGTGGGAGGTGCACCGCGGCCCGGCCAGGCGGAGCGTCCTCGCCCTGACCCACGAGGGCAGGTTCCACCCGGGCCTGGGG
TACGAGCAGCGCTACCACAGTGGGGACGTGCGCCTCGACACCGTGGGCAGCGACGCCTACCGCCTCTCAGTGTCCCGGGCTCTGTCTGCC
GACCAGGGCTCCTACAGGTGTATCGTCAGCGAGTGGATCGCCGAGCAGGGCAACTGGCAGGAAATCCAAGAAAAGGCCGTGGAAGTTGCC
ACCGTGGTGATCCAGCCATCAGTTCTGCGAGCAGCTGTGCCCAAGAATGTGTCTGTGGCTGAAGGAAAGGAACTGGACCTGACCTGTAAC
ATCACAACAGACCGAGCCGATGACGTCCGGCCCGAGGTGACGTGGTCCTTCAGCAGGATGCCTGACAGCACCCTACCTGGCTCCCGCGTG
TTGGCGCGGCTTGACCGTGATTCCCTGGTGCACAGCTCGCCTCATGTTGCTTTGAGTCATGTGGATGCACGCTCCTACCATTTACTGGTT
CGGGATGTTAGCAAAGAAAACTCTGGCTACTATTACTGCCACGTGTCCCTGTGGGCACCCGGACACAACAGGAGCTGGCACAAAGTGGCA
GAGGCCGTGTCTTCCCCAGCTGGTGTGGGTGTGACCTGGCTAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAAT
GCCTGTCAAAATGGGGGCACCTGTGCCAACCGCAATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAG
AACATTGATGATTGTGCCTTCGCCTCCTGTACTCCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGG
AAGGCAGGTCTCCTGTGTCATCTGGATGATGCATGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGG
CAATATATTTGCACCTGCCCACAAGGCTACAAAGGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGT
GAGCATGCAGGAAAATGTGTGAACACGGATGGCGCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATC
AATGAGTGCCATTCAGACCCCTGCCAGAATGATGCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAA
GGTGTGCATTGTGAATTAGAAATAAATGAATGTCAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAG
TGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTTTGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGT
ATCGATCACCCGAATGGCTATGAATGCCAGTGTGCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGAT
CCTTGCCACCATGGTCAGTGTCAGGATGGTATTGATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAG
ATTGATGAATGTTACAGCAGCCCTTGCCTGAACGATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACG
TCAGGGGTTAATTGTGAAATTAATTTTGATGACTGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGT
TGTGTCTGCTCACCAGGATTCACAGGGCAGAGATGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGT
ATCAACGGTGTGAATGGTTTCCGCTGTATATGCCCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAAT
CCCTGCATCCATGGAAACTGTACTGGAGGTCTCAGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGAC
AAAAATGAATGCCTTTCGAATCCATGCCAGAATGGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTT
AAAGGCTATAACTGCCAGGTGAATATTGATGAATGTGCCTCAAATCCATGCCTGAACCAAGGAACCTGCTTTGATGACATAAGTGGCTAC
ACTTGCCACTGTGTGCTGCCATACACAGGCAAGAATTGTCAGACAGTATTGGCTCCCTGTTCCCCAAACCCTTGTGAGAATGCTGCTGTT
TGCAAAGAGTCACCAAATTTTGAGAGTTATACTTGCTTGTGTGCTCCTGGCTGGCAAGGTCAGCGGTGTACCATTGACATTGACGAGTGT
ATCTCCAAGCCCTGCATGAACCATGGTCTCTGCCATAACACCCAGGGCAGCTACATGTGTGAATGTCCACCAGGCTTCAGTGGTATGGAC
TGTGAGGAGGACATTGATGACTGCCTTGCCAATCCTTGCCAGAATGGAGGTTCCTGTATGGATGGAGTGAATACTTTCTCCTGCCTCTGC
CTTCCGGGTTTCACTGGGGATAAGTGCCAGACAGACATGAATGAGTGTCTGAGTGAACCCTGTAAGAATGGAGGGACCTGCTCTGACTAC
GTCAACAGTTACACTTGCAAGTGCCAGGCAGGATTTGATGGAGTCCATTGTGAGAACAACATCAATGAGTGCACTGAGAGCTCCTGTTTC
AATGGTGGCACATGTGTTGATGGGATTAACTCCTTCTCTTGCTTGTGCCCTGTGGGTTTCACTGGATCCTTCTGCCTCCATGAGATCAAT
GAATGCAGCTCTCATCCATGCCTGAATGAGGGAACGTGTGTTGATGGCCTGGGTACCTACCGCTGCAGCTGCCCCCTGGGCTACACTGGG
AAAAACTGTCAGACCCTGGTGAATCTCTGCAGTCGGTCTCCATGTAAAAACAAAGGTACTTGCGTTCAGAAAAAAGCAGAGTCCCAGTGC
CTATGTCCATCTGGATGGGCTGGTGCCTATTGTGACGTGCCCAATGTCTCTTGTGACATAGCAGCCTCCAGGAGAGGTGTGCTTGTTGAA
CACTTGTGCCAGCACTCAGGTGTCTGCATCAATGCTGGCAACACGCATTACTGTCAGTGCCCCCTGGGCTATACTGGGAGCTACTGTGAG
GAGCAACTCGATGAGTGTGCGTCCAACCCCTGCCAGCACGGGGCAACATGCAGTGACTTCATTGGTGGATACAGATGCGAGTGTGTCCCA
GGCTATCAGGGTGTCAACTGTGAGTATGAAGTGGATGAGTGCCAGAATCAGCCCTGCCAGAATGGAGGCACCTGTATTGACCTTGTGAAC
CATTTCAAGTGCTCTTGCCCACCAGGCACTCGGGGCCTACTCTGTGAAGAGAACATTGATGACTGTGCCCGGGGTCCCCATTGCCTTAAT
GGTGGTCAGTGCATGGATAGGATTGGAGGCTACAGTTGTCGCTGCTTGCCTGGCTTTGCTGGGGAGCGTTGTGAGGGAGACATCAACGAG
TGCCTCTCCAACCCCTGCAGCTCTGAGGGCAGCCTGGACTGTATACAGCTCACCAATGACTACCTGTGTGTTTGCCGTAGTGCCTTTACT
GGCCGGCACTGTGAAACCTTCGTCGATGTGTGTCCCCAGATGCCCTGCCTGAATGGAGGGACTTGTGCTGTGGCCAGTAACATGCCTGAT
GGTTTCATTTGCCGTTGTCCCCCGGGATTTTCCGGGGCAAGGTGCCAGAGCAGCTGTGGACAAGTGAAATGTAGGAAGGGGGAGCAGTGT
GTGCACACCGCCTCTGGACCCCGCTGCTTCTGCCCCAGTCCCCGGGACTGCGAGTCAGGCTGTGCCAGTAGCCCCTGCCAGCACGGGGGC
AGCTGCCACCCTCAGCGCCAGCCTCCTTATTACTCCTGCCAGTGTGCCCCACCATTCTCGGGTAGCCGCTGTGAACTCTACACGGCACCC
CCCAGCACCCCTCCTGCCACCTGTCTGAGCCAGTATTGTGCCGACAAAGCTCGGGATGGCGTCTGTGATGAGGCCTGCAACAGCCATGCC
TGCCAGTGGGATGGGGGTGACTGTTCTCTCACCATGGAGAACCCCTGGGCCAACTGCTCCTCCCCACTTCCCTGCTGGGATTATATCAAC
AACCAGTGTGATGAGCTGTGCAACACGGTCGAGTGCCTGTTTGACAACTTTGAATGCCAGGGGAACAGCAAGACATGCAAGTATGACAAA
TACTGTGCAGACCACTTCAAAGACAACCACTGTGACCAGGGGTGCAACAGTGAGGAGTGTGGTTGGGATGGGCTGGACTGTGCTGCTGAC
CAACCTGAGAACCTGGCAGAAGGTACCCTGGTTATTGTGGTATTGATGCCACCTGAACAACTGCTCCAGGATGCTCGCAGCTTCTTGCGG
GCACTGGGTACCCTGCTCCACACCAACCTGCGCATTAAGCGGGACTCCCAGGGGGAACTCATGGTGTACCCCTATTATGGTGAGAAGTCA
GCTGCTATGAAGAAACAGAGGATGACACGCAGATCCCTTCCTGGTGAACAAGAACAGGAGGTGGCTGGCTCTAAAGTCTTTCTGGAAATT
GACAACCGCCAGTGTGTTCAAGACTCAGACCACTGCTTCAAGAACACGGATGCAGCAGCAGCTCTCCTGGCCTCTCACGCCATACAGGGG
ACCCTGTCATACCCTCTTGTGTCTGTCGTCAGTGAATCCCTGACTCCAGAACGCACTCAGCTCCTCTATCTCCTTGCTGTTGCTGTTGTC
ATCATTCTGTTTATTATTCTGCTGGGGGTAATCATGGCAAAACGAAAGCGTAAGCATGGCTCTCTCTGGCTGCCTGAAGGTTTCACTCTT
CGCCGAGATGCAAGCAATCACAAGCGTCGTGAGCCAGTGGGACAGGATGCTGTGGGGCTGAAAAATCTCTCAGTGCAAGTCTCAGAAGCT
AACCTAATTGGTACTGGAACAAGTGAACACTGGGTCGATGATGAAGGGCCCCAGCCAAAGAAAGTAAAGGCTGAAGATGAGGCCTTACTC
TCAGAAGAAGATGACCCCATTGATCGACGGCCATGGACACAGCAGCACCTTGAAGCTGCAGACATCCGTAGGACACCATCGCTGGCTCTC
ACCCCTCCTCAGGCAGAGCAGGAGGTGGATGTGTTAGATGTGAATGTCCGTGGCCCAGATGGCTGCACCCCATTGATGTTGGCTTCTCTC
CGAGGAGGCAGCTCAGATTTGAGTGATGAAGATGAAGATGCAGAGGACTCTTCTGCTAACATCATCACAGACTTGGTCTACCAGGGTGCC
AGCCTCCAGGCCCAGACAGACCGGACTGGTGAGATGGCCCTGCACCTTGCAGCCCGCTACTCACGGGCTGATGCTGCCAAGCGTCTCCTG
GATGCAGGTGCAGATGCCAATGCCCAGGACAACATGGGCCGCTGTCCACTCCATGCTGCAGTGGCAGCTGATGCCCAAGGTGTCTTCCAG
ATTCTGATTCGCAACCGAGTAACTGATCTAGATGCCAGGATGAATGATGGTACTACACCCCTGATCCTGGCTGCCCGCCTGGCTGTGGAG
GGAATGGTGGCAGAACTGATCAACTGCCAAGCGGATGTGAATGCAGTGGATGACCATGGAAAATCTGCTCTTCACTGGGCAGCTGCTGTC
AATAATGTGGAGGCAACTCTTTTGTTGTTGAAAAATGGGGCCAACCGAGACATGCAGGACAACAAGGAAGAGACACCTCTGTTTCTTGCT
GCCCGGGAGGGGAGCTATGAAGCAGCCAAGATCCTGTTAGACCATTTTGCCAATCGAGACATCACAGACCATATGGATCGTCTTCCCCGG
GATGTGGCTCGGGATCGCATGCACCATGACATTGTGCGCCTTCTGGATGAATACAATGTGACCCCAAGCCCTCCAGGCACCGTGTTGACT
TCTGCTCTCTCACCTGTCATCTGTGGGCCCAACAGATCTTTCCTCAGCCTGAAGCACACCCCAATGGGCAAGAAGTCTAGACGGCCCAGT
GCCAAGAGTACCATGCCTACTAGCCTCCCTAACCTTGCCAAGGAGGCAAAGGATGCCAAGGGTAGTAGGAGGAAGAAGTCTCTGAGTGAG
AAGGTCCAACTGTCTGAGAGTTCAGTAACTTTATCCCCTGTTGATTCCCTAGAATCTCCTCACACGTATGTTTCCGACACCACATCCTCT
CCAATGATTACATCCCCTGGGATCTTACAGGCCTCACCCAACCCTATGTTGGCCACTGCCGCCCCTCCTGCCCCAGTCCATGCCCAGCAT
GCACTATCTTTTTCTAACCTTCATGAAATGCAGCCTTTGGCACATGGGGCCAGCACTGTGCTTCCCTCAGTGAGCCAGTTGCTATCCCAC
CACCACATTGTGTCTCCAGGCAGTGGCAGTGCTGGAAGCTTGAGTAGGCTCCATCCAGTCCCAGTCCCAGCAGATTGGATGAACCGCATG
GAGGTGAATGAGACCCAGTACAATGAGATGTTTGGTATGGTCCTGGCTCCAGCTGAGGGCACCCATCCTGGCATAGCTCCCCAGAGCAGG
CCACCTGAAGGGAAGCACATAACCACCCCTCGGGAGCCCTTGCCCCCCATTGTGACTTTCCAGCTCATCCCTAAAGGCAGTATTGCCCAA
CCAGCGGGGGCTCCCCAGCCTCAGTCCACCTGCCCTCCAGCTGTTGCGGGCCCCCTGCCCACCATGTACCAGATTCCAGAAATGGCCCGT
TTGCCCAGTGTGGCTTTCCCCACTGCCATGATGCCCCAGCAGGACGGGCAGGTAGCTCAGACCATTCTCCCAGCCTATCATCCTTTCCCA
GCCTCTGTGGGCAAGTACCCCACACCCCCTTCACAGCACAGTTATGCTTCCTCAAATGCTGCTGAGCGAACACCCAGTCACAGTGGTCAC
CTCCAGGGTGAGCATCCCTACCTGACACCATCCCCAGAGTCTCCTGACCAGTGGTCAAGTTCATCACCCCACTCTGCTTCTGACTGGTCA
GATGTGACCACCAGCCCTACCCCTGGGGGTGCTGGAGGAGGTCAGCGGGGACCTGGGACACACATGTCTGAGCCACCACACAACAACATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTGFRN_ENST00000393203_chr1_117492194_+_NOTCH2_ENST00000256646_chr1_120512367_-_11655nt
GATTTATCGGCTCGCGAGGAGAGCGGAGCAGGCGCGCGGCCCAGGCGGAGGAGCGCCGACTCTGGAGCAGCCGGAGCTGGAAGAGGAGGA
GGAGGAGAGGCGGCGGGGAAGGAGGAGGAGGGGGAGAGTCGCTCCCGCCGGGCGAGCATGGGGCGCCTGGCCTCGAGGCCGCTGCTGCTG
GCGCTCCTGTCGTTGGCTCTTTGCCGAGGGCGTGTGGTGAGAGTCCCCACAGCGACCCTGGTTCGAGTGGTGGGCACTGAGCTGGTCATC
CCCTGCAACGTCAGTGACTATGATGGCCCCAGCGAGCAAAACTTTGACTGGAGCTTCTCATCTTTGGGGAGCAGCTTTGTGGAGCTTGCA
AGCACCTGGGAGGTGGGGTTCCCAGCCCAGCTGTACCAGGAGCGGCTGCAGAGGGGCGAGATCCTGTTAAGGCGGACTGCCAACGACGCC
GTGGAGCTCCACATAAAGAACGTCCAGCCTTCAGACCAAGGCCACTACAAATGTTCAACCCCCAGCACAGATGCCACTGTCCAGGGAAAC
TATGAGGACACAGTGCAGGTTAAAGTGCTGGCCGACTCCCTGCACGTGGGCCCCAGCGCGCGGCCCCCGCCGAGCCTGAGCCTGCGGGAG
GGGGAGCCCTTCGAGCTGCGCTGCACCGCCGCCTCCGCCTCGCCGCTGCACACGCACCTGGCGCTGCTGTGGGAGGTGCACCGCGGCCCG
GCCAGGCGGAGCGTCCTCGCCCTGACCCACGAGGGCAGGTTCCACCCGGGCCTGGGGTACGAGCAGCGCTACCACAGTGGGGACGTGCGC
CTCGACACCGTGGGCAGCGACGCCTACCGCCTCTCAGTGTCCCGGGCTCTGTCTGCCGACCAGGGCTCCTACAGGTGTATCGTCAGCGAG
TGGATCGCCGAGCAGGGCAACTGGCAGGAAATCCAAGAAAAGGCCGTGGAAGTTGCCACCGTGGTGATCCAGCCATCAGTTCTGCGAGCA
GCTGTGCCCAAGAATGTGTCTGTGGCTGAAGGAAAGGAACTGGACCTGACCTGTAACATCACAACAGACCGAGCCGATGACGTCCGGCCC
GAGGTGACGTGGTCCTTCAGCAGGATGCCTGACAGCACCCTACCTGGCTCCCGCGTGTTGGCGCGGCTTGACCGTGATTCCCTGGTGCAC
AGCTCGCCTCATGTTGCTTTGAGTCATGTGGATGCACGCTCCTACCATTTACTGGTTCGGGATGTTAGCAAAGAAAACTCTGGCTACTAT
TACTGCCACGTGTCCCTGTGGGCACCCGGACACAACAGGAGCTGGCACAAAGTGGCAGAGGCCGTGTCTTCCCCAGCTGGTGTGGGTGTG
ACCTGGCTAGGACAGTTCTGCACAGAGGATGTGGATGAATGCCTGCTGCAGCCCAATGCCTGTCAAAATGGGGGCACCTGTGCCAACCGC
AATGGAGGCTATGGCTGTGTATGTGTCAACGGCTGGAGTGGAGATGACTGCAGTGAGAACATTGATGATTGTGCCTTCGCCTCCTGTACT
CCAGGCTCCACCTGCATCGACCGTGTGGCCTCCTTCTCTTGCATGTGCCCAGAGGGGAAGGCAGGTCTCCTGTGTCATCTGGATGATGCA
TGCATCAGCAATCCTTGCCACAAGGGGGCACTGTGTGACACCAACCCCCTAAATGGGCAATATATTTGCACCTGCCCACAAGGCTACAAA
GGGGCTGACTGCACAGAAGATGTGGATGAATGTGCCATGGCCAATAGCAATCCTTGTGAGCATGCAGGAAAATGTGTGAACACGGATGGC
GCCTTCCACTGTGAGTGTCTGAAGGGTTATGCAGGACCTCGTTGTGAGATGGACATCAATGAGTGCCATTCAGACCCCTGCCAGAATGAT
GCTACCTGTCTGGATAAGATTGGAGGCTTCACATGTCTGTGCATGCCAGGTTTCAAAGGTGTGCATTGTGAATTAGAAATAAATGAATGT
CAGAGCAACCCTTGTGTGAACAATGGGCAGTGTGTGGATAAAGTCAATCGTTTCCAGTGCCTGTGTCCTCCTGGTTTCACTGGGCCAGTT
TGCCAGATTGATATTGATGACTGTTCCAGTACTCCGTGTCTGAATGGGGCAAAGTGTATCGATCACCCGAATGGCTATGAATGCCAGTGT
GCCACAGGTTTCACTGGTGTGTTGTGTGAGGAGAACATTGACAACTGTGACCCCGATCCTTGCCACCATGGTCAGTGTCAGGATGGTATT
GATTCCTACACCTGCATCTGCAATCCCGGGTACATGGGCGCCATCTGCAGTGACCAGATTGATGAATGTTACAGCAGCCCTTGCCTGAAC
GATGGTCGCTGCATTGACCTGGTCAATGGCTACCAGTGCAACTGCCAGCCAGGCACGTCAGGGGTTAATTGTGAAATTAATTTTGATGAC
TGTGCAAGTAACCCTTGTATCCATGGAATCTGTATGGATGGCATTAATCGCTACAGTTGTGTCTGCTCACCAGGATTCACAGGGCAGAGA
TGTAACATTGACATTGATGAGTGTGCCTCCAATCCCTGTCGCAAGGGTGCAACATGTATCAACGGTGTGAATGGTTTCCGCTGTATATGC
CCCGAGGGACCCCATCACCCCAGCTGCTACTCACAGGTGAACGAATGCCTGAGCAATCCCTGCATCCATGGAAACTGTACTGGAGGTCTC
AGTGGATATAAGTGTCTCTGTGATGCAGGCTGGGTTGGCATCAACTGTGAAGTGGACAAAAATGAATGCCTTTCGAATCCATGCCAGAAT
GGAGGAACTTGTGACAATCTGGTGAATGGATACAGGTGTACTTGCAAGAAGGGCTTTAAAGGCTATAACTGCCAGGTGAATATTGATGAA
TGTGCCTCAAATCCATGCCTGAACCAAGGAACCTGCTTTGATGACATAAGTGGCTACACTTGCCACTGTGTGCTGCCATACACAGGCAAG
AATTGTCAGACAGTATTGGCTCCCTGTTCCCCAAACCCTTGTGAGAATGCTGCTGTTTGCAAAGAGTCACCAAATTTTGAGAGTTATACT
TGCTTGTGTGCTCCTGGCTGGCAAGGTCAGCGGTGTACCATTGACATTGACGAGTGTATCTCCAAGCCCTGCATGAACCATGGTCTCTGC
CATAACACCCAGGGCAGCTACATGTGTGAATGTCCACCAGGCTTCAGTGGTATGGACTGTGAGGAGGACATTGATGACTGCCTTGCCAAT
CCTTGCCAGAATGGAGGTTCCTGTATGGATGGAGTGAATACTTTCTCCTGCCTCTGCCTTCCGGGTTTCACTGGGGATAAGTGCCAGACA
GACATGAATGAGTGTCTGAGTGAACCCTGTAAGAATGGAGGGACCTGCTCTGACTACGTCAACAGTTACACTTGCAAGTGCCAGGCAGGA
TTTGATGGAGTCCATTGTGAGAACAACATCAATGAGTGCACTGAGAGCTCCTGTTTCAATGGTGGCACATGTGTTGATGGGATTAACTCC
TTCTCTTGCTTGTGCCCTGTGGGTTTCACTGGATCCTTCTGCCTCCATGAGATCAATGAATGCAGCTCTCATCCATGCCTGAATGAGGGA
ACGTGTGTTGATGGCCTGGGTACCTACCGCTGCAGCTGCCCCCTGGGCTACACTGGGAAAAACTGTCAGACCCTGGTGAATCTCTGCAGT
CGGTCTCCATGTAAAAACAAAGGTACTTGCGTTCAGAAAAAAGCAGAGTCCCAGTGCCTATGTCCATCTGGATGGGCTGGTGCCTATTGT
GACGTGCCCAATGTCTCTTGTGACATAGCAGCCTCCAGGAGAGGTGTGCTTGTTGAACACTTGTGCCAGCACTCAGGTGTCTGCATCAAT
GCTGGCAACACGCATTACTGTCAGTGCCCCCTGGGCTATACTGGGAGCTACTGTGAGGAGCAACTCGATGAGTGTGCGTCCAACCCCTGC
CAGCACGGGGCAACATGCAGTGACTTCATTGGTGGATACAGATGCGAGTGTGTCCCAGGCTATCAGGGTGTCAACTGTGAGTATGAAGTG
GATGAGTGCCAGAATCAGCCCTGCCAGAATGGAGGCACCTGTATTGACCTTGTGAACCATTTCAAGTGCTCTTGCCCACCAGGCACTCGG
GGCCTACTCTGTGAAGAGAACATTGATGACTGTGCCCGGGGTCCCCATTGCCTTAATGGTGGTCAGTGCATGGATAGGATTGGAGGCTAC
AGTTGTCGCTGCTTGCCTGGCTTTGCTGGGGAGCGTTGTGAGGGAGACATCAACGAGTGCCTCTCCAACCCCTGCAGCTCTGAGGGCAGC
CTGGACTGTATACAGCTCACCAATGACTACCTGTGTGTTTGCCGTAGTGCCTTTACTGGCCGGCACTGTGAAACCTTCGTCGATGTGTGT
CCCCAGATGCCCTGCCTGAATGGAGGGACTTGTGCTGTGGCCAGTAACATGCCTGATGGTTTCATTTGCCGTTGTCCCCCGGGATTTTCC
GGGGCAAGGTGCCAGAGCAGCTGTGGACAAGTGAAATGTAGGAAGGGGGAGCAGTGTGTGCACACCGCCTCTGGACCCCGCTGCTTCTGC
CCCAGTCCCCGGGACTGCGAGTCAGGCTGTGCCAGTAGCCCCTGCCAGCACGGGGGCAGCTGCCACCCTCAGCGCCAGCCTCCTTATTAC
TCCTGCCAGTGTGCCCCACCATTCTCGGGTAGCCGCTGTGAACTCTACACGGCACCCCCCAGCACCCCTCCTGCCACCTGTCTGAGCCAG
TATTGTGCCGACAAAGCTCGGGATGGCGTCTGTGATGAGGCCTGCAACAGCCATGCCTGCCAGTGGGATGGGGGTGACTGTTCTCTCACC
ATGGAGAACCCCTGGGCCAACTGCTCCTCCCCACTTCCCTGCTGGGATTATATCAACAACCAGTGTGATGAGCTGTGCAACACGGTCGAG
TGCCTGTTTGACAACTTTGAATGCCAGGGGAACAGCAAGACATGCAAGTATGACAAATACTGTGCAGACCACTTCAAAGACAACCACTGT
GACCAGGGGTGCAACAGTGAGGAGTGTGGTTGGGATGGGCTGGACTGTGCTGCTGACCAACCTGAGAACCTGGCAGAAGGTACCCTGGTT
ATTGTGGTATTGATGCCACCTGAACAACTGCTCCAGGATGCTCGCAGCTTCTTGCGGGCACTGGGTACCCTGCTCCACACCAACCTGCGC
ATTAAGCGGGACTCCCAGGGGGAACTCATGGTGTACCCCTATTATGGTGAGAAGTCAGCTGCTATGAAGAAACAGAGGATGACACGCAGA
TCCCTTCCTGGTGAACAAGAACAGGAGGTGGCTGGCTCTAAAGTCTTTCTGGAAATTGACAACCGCCAGTGTGTTCAAGACTCAGACCAC
TGCTTCAAGAACACGGATGCAGCAGCAGCTCTCCTGGCCTCTCACGCCATACAGGGGACCCTGTCATACCCTCTTGTGTCTGTCGTCAGT
GAATCCCTGACTCCAGAACGCACTCAGCTCCTCTATCTCCTTGCTGTTGCTGTTGTCATCATTCTGTTTATTATTCTGCTGGGGGTAATC
ATGGCAAAACGAAAGCGTAAGCATGGCTCTCTCTGGCTGCCTGAAGGTTTCACTCTTCGCCGAGATGCAAGCAATCACAAGCGTCGTGAG
CCAGTGGGACAGGATGCTGTGGGGCTGAAAAATCTCTCAGTGCAAGTCTCAGAAGCTAACCTAATTGGTACTGGAACAAGTGAACACTGG
GTCGATGATGAAGGGCCCCAGCCAAAGAAAGTAAAGGCTGAAGATGAGGCCTTACTCTCAGAAGAAGATGACCCCATTGATCGACGGCCA
TGGACACAGCAGCACCTTGAAGCTGCAGACATCCGTAGGACACCATCGCTGGCTCTCACCCCTCCTCAGGCAGAGCAGGAGGTGGATGTG
TTAGATGTGAATGTCCGTGGCCCAGATGGCTGCACCCCATTGATGTTGGCTTCTCTCCGAGGAGGCAGCTCAGATTTGAGTGATGAAGAT
GAAGATGCAGAGGACTCTTCTGCTAACATCATCACAGACTTGGTCTACCAGGGTGCCAGCCTCCAGGCCCAGACAGACCGGACTGGTGAG
ATGGCCCTGCACCTTGCAGCCCGCTACTCACGGGCTGATGCTGCCAAGCGTCTCCTGGATGCAGGTGCAGATGCCAATGCCCAGGACAAC
ATGGGCCGCTGTCCACTCCATGCTGCAGTGGCAGCTGATGCCCAAGGTGTCTTCCAGATTCTGATTCGCAACCGAGTAACTGATCTAGAT
GCCAGGATGAATGATGGTACTACACCCCTGATCCTGGCTGCCCGCCTGGCTGTGGAGGGAATGGTGGCAGAACTGATCAACTGCCAAGCG
GATGTGAATGCAGTGGATGACCATGGAAAATCTGCTCTTCACTGGGCAGCTGCTGTCAATAATGTGGAGGCAACTCTTTTGTTGTTGAAA
AATGGGGCCAACCGAGACATGCAGGACAACAAGGAAGAGACACCTCTGTTTCTTGCTGCCCGGGAGGGGAGCTATGAAGCAGCCAAGATC
CTGTTAGACCATTTTGCCAATCGAGACATCACAGACCATATGGATCGTCTTCCCCGGGATGTGGCTCGGGATCGCATGCACCATGACATT
GTGCGCCTTCTGGATGAATACAATGTGACCCCAAGCCCTCCAGGCACCGTGTTGACTTCTGCTCTCTCACCTGTCATCTGTGGGCCCAAC
AGATCTTTCCTCAGCCTGAAGCACACCCCAATGGGCAAGAAGTCTAGACGGCCCAGTGCCAAGAGTACCATGCCTACTAGCCTCCCTAAC
CTTGCCAAGGAGGCAAAGGATGCCAAGGGTAGTAGGAGGAAGAAGTCTCTGAGTGAGAAGGTCCAACTGTCTGAGAGTTCAGTAACTTTA
TCCCCTGTTGATTCCCTAGAATCTCCTCACACGTATGTTTCCGACACCACATCCTCTCCAATGATTACATCCCCTGGGATCTTACAGGCC
TCACCCAACCCTATGTTGGCCACTGCCGCCCCTCCTGCCCCAGTCCATGCCCAGCATGCACTATCTTTTTCTAACCTTCATGAAATGCAG
CCTTTGGCACATGGGGCCAGCACTGTGCTTCCCTCAGTGAGCCAGTTGCTATCCCACCACCACATTGTGTCTCCAGGCAGTGGCAGTGCT
GGAAGCTTGAGTAGGCTCCATCCAGTCCCAGTCCCAGCAGATTGGATGAACCGCATGGAGGTGAATGAGACCCAGTACAATGAGATGTTT
GGTATGGTCCTGGCTCCAGCTGAGGGCACCCATCCTGGCATAGCTCCCCAGAGCAGGCCACCTGAAGGGAAGCACATAACCACCCCTCGG
GAGCCCTTGCCCCCCATTGTGACTTTCCAGCTCATCCCTAAAGGCAGTATTGCCCAACCAGCGGGGGCTCCCCAGCCTCAGTCCACCTGC
CCTCCAGCTGTTGCGGGCCCCCTGCCCACCATGTACCAGATTCCAGAAATGGCCCGTTTGCCCAGTGTGGCTTTCCCCACTGCCATGATG
CCCCAGCAGGACGGGCAGGTAGCTCAGACCATTCTCCCAGCCTATCATCCTTTCCCAGCCTCTGTGGGCAAGTACCCCACACCCCCTTCA
CAGCACAGTTATGCTTCCTCAAATGCTGCTGAGCGAACACCCAGTCACAGTGGTCACCTCCAGGGTGAGCATCCCTACCTGACACCATCC
CCAGAGTCTCCTGACCAGTGGTCAAGTTCATCACCCCACTCTGCTTCTGACTGGTCAGATGTGACCACCAGCCCTACCCCTGGGGGTGCT
GGAGGAGGTCAGCGGGGACCTGGGACACACATGTCTGAGCCACCACACAACAACATGCAGGTTTATGCGTGAGAGAGTCCACCTCCAGTG
TAGAGACATAACTGACTTTTGTAAATGCTGCTGAGGAACAAATGAAGGTCATCCGGGAGAGAAATGAAGAAATCTCTGGAGCCAGCTTCT
AGAGGTAGGAAAGAGAAGATGTTCTTATTCAGATAATGCAAGAGAAGCAATTCGTCAGTTTCACTGGGTATCTGCAAGGCTTATTGATTA
TTCTAATCTAATAAGACAAGTTTGTGGAAATGCAAGATGAATACAAGCCTTGGGTCCATGTTTACTCTCTTCTATTTGGAGAATAAGATG
GATGCTTATTGAAGCCCAGACATTCTTGCAGCTTGGACTGCATTTTAAGCCCTGCAGGCTTCTGCCATATCCATGAGAAGATTCTACACT
AGCGTCCTGTTGGGAATTATGCCCTGGAATTCTGCCTGAATTGACCTACGCATCTCCTCCTCCTTGGACATTCTTTTGTCTTCATTTGGT
GCTTTTGGTTTTGCACCTCTCCGTGATTGTAGCCCTACCAGCATGTTATAGGGCAAGACCTTTGTGCTTTTGATCATTCTGGCCCATGAA
AGCAACTTTGGTCTCCTTTCCCCTCCTGTCTTCCCGGTATCCCTTGGAGTCTCACAAGGTTTACTTTGGTATGGTTCTCAGCACAAACCT
TTCAAGTATGTTGTTTCTTTGGAAAATGGACATACTGTATTGTGTTCTCCTGCATATATCATTCCTGGAGAGAGAAGGGGAGAAGAATAC
TTTTCTTCAACAAATTTTGGGGGCAGGAGATCCCTTCAAGAGGCTGCACCTTAATTTTTCTTGTCTGTGTGCAGGTCTTCATATAAACTT
TACCAGGAAGAAGGGTGTGAGTTTGTTGTTTTTCTGTGTATGGGCCTGGTCAGTGTAAAGTTTTATCCTTGATAGTCTAGTTACTATGAC
CCTCCCCACTTTTTTAAAACCAGAAAAAGGTTTGGAATGTTGGAATGACCAAGAGACAAGTTAACTCGTGCAAGAGCCAGTTACCCACCC
ACAGGTCCCCCTACTTCCTGCCAAGCATTCCATTGACTGCCTGTATGGAACACATTTGTCCCAGATCTGAGCATTCTAGGCCTGTTTCAC
TCACTCACCCAGCATATGAAACTAGTCTTAACTGTTGAGCCTTTCCTTTCATATCCACAGAAGACACTGTCTCAAATGTTGTACCCTTGC
CATTTAGGACTGAACTTTCCTTAGCCCAAGGGACCCAGTGACAGTTGTCTTCCGTTTGTCAGATGATCAGTCTCTACTGATTATCTTGCT
GCTTAAAGGCCTGCTCACCAATCTTTCTTTCACACCGTGTGGTCCGTGTTACTGGTATACCCAGTATGTTCTCACTGAAGACATGGACTT
TATATGTTCAAGTGCAGGAATTGGAAAGTTGGACTTGTTTTCTATGATCCAAAACAGCCCTATAAGAAGGTTGGAAAAGGAGGAACTATA
TAGCAGCCTTTGCTATTTTCTGCTACCATTTCTTTTCCTCTGAAGCGGCCATGACATTCCCTTTGGCAACTAACGTAGAAACTCAACAGA
ACATTTTCCTTTCCTAGAGTCACCTTTTAGATGATAATGGACAACTATAGACTTGCTCATTGTTCAGACTGATTGCCCCTCACCTGAATC
CACTCTCTGTATTCATGCTCTTGGCAATTTCTTTGACTTTCTTTTAAGGGCAGAAGCATTTTAGTTAATTGTAGATAAAGAATAGTTTTC
TTCCTCTTCTCCTTGGGCCAGTTAATAATTGGTCCATGGCTACACTGCAACTTCCGTCCAGTGCTGTGATGCCCATGACACCTGCAAAAT
AAGTTCTGCCTGGGCATTTTGTAGATATTAACAGGTGAATTCCCGACTCTTTTGGTTTGAATGACAGTTCTCATTCCTTCTATGGCTGCA
AGTATGCATCAGTGCTTCCCACTTACCTGATTTGTCTGTCGGTGGCCCCATATGGAAACCCTGCGTGTCTGTTGGCATAATAGTTTACAA
ATGGTTTTTTCAGTCCTATCCAAATTTATTGAACCAACAAAAATAATTACTTCTGCCCTGAGATAAGCAGATTAAGTTTGTTCATTCTCT
GCTTTATTCTCTCCATGTGGCAACATTCTGTCAGCCTCTTTCATAGTGTGCAAACATTTTATCATTCTAAATGGTGACTCTCTGCCCTTG
GACCCATTTATTATTCACAGATGGGGAGAACCTATCTGCATGGACCTCTGTGGACCACAGCGTACCTGCCCCTTTCTGCCCTCCTGCTCC
AGCCCCACTTCTGAAAGTATCAGCTACTGATCCAGCCACTGGATATTTTATATCCTCCCTTTTCCTTAAGCACAATGTCAGACCAAATTG
CTTGTTTCTTTTTCTTGGACTACTTTAATTTGGATCCTTTGGGTTTGGAGAAAGGGAATGTGAAAGCTGTCATTACAGACAACAGGTTTC
AGTGATGAGGAGGACAACACTGCCTTTCAAACTTTTTACTGATCTCTTAGATTTTAAGAACTCTTGAATTGTGTGGTATCTAATAAAAGG
GAAGGTAAGATGGATAATCACTTTCTCATTTGGGTTCTGAATTGGAGACTCAGTTTTTATGAGACACATCTTTTATGCCATGTATAGATC
CTCCCCTGCTATTTTTGGTTTATTTTTATTGTTATAAATGCTTTCTTTCTTTGACTCCTCTTCTGCCTGCCTTTGGGGATAGGTTTTTTT
GTTTGTTTATTTGCTTCCTCTGTTTTGTTTTAAGCATCATTTTCTTATGTGAGGTGGGGAAGGGAAAGGTATGAGGGAAAGAGAGTCTGA
GAATTAAAATATTTTAGTATAAGCAATTGGCTGTGATGCTCAAATCCATTGCATCCTCTTATTGAATTTGCCAATTTGTAATTTTTGCAT
AATAAAGAACCAAAGGTGTAATGTTTTGTTGAGAGGTGGTTTAGGGATTTTGGCCCTAACCAATACATTGAATGTATGATGACTATTTGG
GAGGACACATTTATGTACCCAGAGGCCCCCACTAATAAGTGGTACTATGGTTACTTCCTTGTGTACATTTCTCTTAAAAGTGATATTATA
TCTGTTTGTATGAGAAACCCAGTAACCAATAAAATGACCGCATATTCCTGACTAAACGTAGTAAGGAAAATGCACACTTTGTTTTTACTT
TTCCGTTTCATTCTAAAGGTAGTTAAGATGAAATTTATATGAAAGCATTTTTATCACAAAATAAAAAAGGTTTGCCAAGCTCAGTGGTGT
TGTATTTTTTATTTTCCAATACTGCATCCATGGCCTGGCAGTGTTACCTCATGATGTCATAATTTGCTGAGAGAGCAAATTTTCTTTTCT
TTCTGAATCCCACAAAGCCTAGCACCAAACTTCTTTTTTTCTTCCTTTAATTAGATCATAAATAAATGATCCTGGGGAAAAAGCATCTGT
CAAATAGGAAACATCACAAAACTGAGCACTCTTCTGTGCACTAGCCATAGCTGGTGACAAACAGATGGTTGCTCAGGGACAAGGTGCCTT
CCAATGGAAATGCGAAGTAGTTGCTATAGCAAGAATTGGGAACTGGGATATAAGTCATAATATTAATTATGCTGTTATGTAAATGATTGG
TTTGTAACATTCCTTAAGTGAAATTTGTGTAGAACTTAATATACAGGATTATAAAATAATATTTTGTGTATAAATTTGTTATAAGTTCAC


Top

FusionGenePPI for PTGFRN_NOTCH2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTGFRNCD151, CD81, CD9, CD63, CD82, FBXO6, RPL6, LGALS3, LGALS8, LGALS9, A4GALT, ATP1B4, BTNL8, SIAE, TSPAN2, SCGB1D1, ST8SIA4NOTCH2CNTN1, GSK3B, JAG1, DLL1, RBPJ, MAML1, JAG2, CRKL, MYOC, SPEN, NDUFV2, NDUFV1, SEC24C, PCMT1, PSMB1, TJP1, SIN3A, PLAUR, NOTCH1, SMAD1, EGFL7, ANKRD28, LATS2, ASB14, ANKRD44, RABGGTB, ZFP41, EEF2, MLLT4, ATP2A2, CDC42, MSN, RDX, PDIA6, CST6, EPSTI1, FAM84B, IL13RA2, IL24, ITIH5, KLK5, MTA3, PSMC3IP, ST14, TMEM17, FBXL17, CDH1, VASN, LRRIQ1, AGRP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTGFRN_NOTCH2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTGFRN_NOTCH2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNOTCH2C0917715Hajdu-Cheney Syndrome2CTD_human;ORPHANET
TgeneNOTCH2C0004114Astrocytoma1CTD_human
TgeneNOTCH2C0007873Uterine Cervical Neoplasm1CTD_human
TgeneNOTCH2C0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
TgeneNOTCH2C0017636Glioblastoma1CTD_human
TgeneNOTCH2C0024121Lung Neoplasms1CTD_human
TgeneNOTCH2C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneNOTCH2C0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneNOTCH2C1458155Mammary Neoplasms1CTD_human
TgeneNOTCH2C1857761Alagille Syndrome 21ORPHANET;UNIPROT