FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29275

FusionGeneSummary for PTCH1_FANCC

check button Fusion gene summary
Fusion gene informationFusion gene name: PTCH1_FANCC
Fusion gene ID: 29275
HgeneTgene
Gene symbol

PTCH1

FANCC

Gene ID

5727

2176

Gene namepatched 1FA complementation group C
SynonymsBCNS|NBCCS|PTC|PTC1|PTCHFA3|FAC|FACC
Cytomap

9q22.32

9q22.32

Type of geneprotein-codingprotein-coding
Descriptionprotein patched homolog 1Fanconi anemia group C proteinFanconi anemia complementation group C
Modification date2018052320180523
UniProtAcc

Q13635

Q00597

Ensembl transtripts involved in fusion geneENST00000331920, ENST00000418258, 
ENST00000421141, ENST00000437951, 
ENST00000430669, ENST00000429896, 
ENST00000375274, ENST00000548379, 
ENST00000468211, 
ENST00000289081, 
ENST00000375305, ENST00000464653, 
Fusion gene scores* DoF score5 X 5 X 3=751 X 1 X 1=1
# samples 51
** MAII scorelog2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PTCH1 [Title/Abstract] AND FANCC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePTCH1

GO:0010875

positive regulation of cholesterol efflux

21931618

HgenePTCH1

GO:0072659

protein localization to plasma membrane

11278759


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-D7-6822-01APTCH1chr9

98238316

-FANCCchr9

97879672

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000331920ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000331920ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000331920ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000418258ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000418258ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000418258ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000421141ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000421141ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000421141ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000437951ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000437951ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000437951ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000430669ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000430669ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000430669ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000429896ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
Frame-shitENST00000429896ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000429896ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000375274ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
In-frameENST00000375274ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
5CDS-5UTRENST00000375274ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-3CDSENST00000548379ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-3CDSENST00000548379ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-5UTRENST00000548379ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-3CDSENST00000468211ENST00000289081PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-3CDSENST00000468211ENST00000375305PTCH1chr9

98238316

-FANCCchr9

97879672

-
intron-5UTRENST00000468211ENST00000464653PTCH1chr9

98238316

-FANCCchr9

97879672

-

Top

FusionProtFeatures for PTCH1_FANCC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PTCH1

Q13635

FANCC

Q00597

DNA repair protein that may operate in a postreplicationrepair or a cell cycle checkpoint function. May be implicated ininterstrand DNA cross-link repair and in the maintenance of normalchromosome stability. Upon IFNG induction, may facilitate STAT1activation by recruiting STAT1 to IFNGR1.{ECO:0000269|PubMed:11520787}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-122414_315762534Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-122414_315751526Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-122414_314252461Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-122414_314252513Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-122414_314252093Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-122314_315101382Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-122414_315102468Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224122_4365762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241_1005762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224458_4725762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224494_5015762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224523_5475762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224569_5775762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224122_4365751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241_1005751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224458_4725751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224494_5015751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224523_5475751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224569_5775751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241_1004252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241_1004252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241_1004252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223122_4365101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231_1005101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223458_4725101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223494_5015101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224122_4365102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241_1005102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224458_4725102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224494_5015102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224101_1215762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224437_4575762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224473_4935762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224502_5225762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224548_5685762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224101_1215751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224437_4575751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224473_4935751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224502_5225751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224548_5685751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224101_1214252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224101_1214252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224101_1214252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223101_1215101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223437_4575101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223473_4935101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224101_1215102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224437_4575102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224473_4935102468TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-1514_31-196184Compositional biasNote=Gly-rich
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224438_5985762534DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224438_5985751526DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224438_5984252461DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224438_5984252513DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224438_5984252093DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223438_5985101382DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224438_5985102468DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15438_598-196184DomainSSD
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241049_10555762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241077_10835762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241105_11215762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241142_11545762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241176_14475762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224599_7485762534Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224770_10275762534Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241049_10555751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241077_10835751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241105_11215751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241142_11545751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241176_14475751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224599_7485751526Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224770_10275751526Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241049_10554252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241077_10834252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241105_11214252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241142_11544252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241176_14474252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224122_4364252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224458_4724252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224494_5014252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224523_5474252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224569_5774252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224599_7484252461Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224770_10274252461Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241049_10554252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241077_10834252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241105_11214252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241142_11544252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241176_14474252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224122_4364252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224458_4724252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224494_5014252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224523_5474252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224569_5774252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224599_7484252513Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224770_10274252513Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241049_10554252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241077_10834252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241105_11214252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241142_11544252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241176_14474252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224122_4364252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224458_4724252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224494_5014252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224523_5474252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224569_5774252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224599_7484252093Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224770_10274252093Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231049_10555101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231077_10835101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231105_11215101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231142_11545101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231176_14475101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223523_5475101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223569_5775101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223599_7485101382Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223770_10275101382Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241049_10555102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241077_10835102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241105_11215102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241142_11545102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241176_14475102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224523_5475102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224569_5775102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224599_7485102468Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224770_10275102468Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151049_1055-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151077_1083-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151105_1121-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151142_1154-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151176_1447-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15122_436-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151_100-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15458_472-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15494_501-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15523_547-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15569_577-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15599_748-196184Topological domainCytoplasmic
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15770_1027-196184Topological domainExtracellular
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241028_10485762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241056_10765762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241084_11045762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241122_11415762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-12241155_11755762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224578_5985762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000331920-1224749_7695762534TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241028_10485751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241056_10765751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241084_11045751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241122_11415751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-12241155_11755751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224578_5985751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000375274-1224749_7695751526TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241028_10484252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241056_10764252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241084_11044252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241122_11414252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-12241155_11754252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224437_4574252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224473_4934252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224502_5224252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224548_5684252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224578_5984252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000418258-1224749_7694252461TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241028_10484252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241056_10764252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241084_11044252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241122_11414252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-12241155_11754252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224437_4574252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224473_4934252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224502_5224252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224548_5684252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224578_5984252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000421141-1224749_7694252513TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241028_10484252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241056_10764252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241084_11044252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241122_11414252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-12241155_11754252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224437_4574252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224473_4934252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224502_5224252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224548_5684252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224578_5984252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000429896-1224749_7694252093TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231028_10485101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231056_10765101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231084_11045101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231122_11415101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-12231155_11755101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223502_5225101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223548_5685101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223578_5985101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000430669-1223749_7695101382TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241028_10485102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241056_10765102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241084_11045102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241122_11415102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-12241155_11755102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224502_5225102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224548_5685102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224578_5985102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000437951-1224749_7695102468TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15101_121-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151028_1048-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151056_1076-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151084_1104-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151122_1141-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-151155_1175-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15437_457-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15473_493-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15502_522-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15548_568-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15578_598-196184TransmembraneHelical
HgenePTCH1chr9:98238316chr9:97879672ENST00000468211-15749_769-196184TransmembraneHelical


Top

FusionGeneSequence for PTCH1_FANCC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_803aa
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDTLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKL
GCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKK
INTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLML
ATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGS
CGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTD

>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_803aa
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDTLHRPSYCDAAFALEQISKGKATGRKAPLWLRAKFQRLLFKL
GCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKK
INTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLML
ATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGS
CGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTD

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_737aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQ
LMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLRWTNFDPLEFLEELKKINTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMH
WQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVF
LLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRG
HWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGH
LLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPR

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_737aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQ
LMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLRWTNFDPLEFLEELKKINTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMH
WQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVF
LLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRG
HWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGH
LLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPR

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_737aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQ
LMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLRWTNFDPLEFLEELKKINTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMH
WQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVF
LLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRG
HWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGH
LLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPR

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_737aa
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQ
LMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTA
YLLGKPPLRWTNFDPLEFLEELKKINTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMH
WQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTT
LDDILKSFSDVSVIRVASGYLLMLATACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVF
LLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRG
HWLQTLKHISELLREAVEDQTHGSCGGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGH
LLAMSRSSSLSAQDLQTVAGQGTDTDLRAPAQQLIRHLLLNFLLWAPGGHTIAWDVITLMAHTAEITHEIIGFLDQTLYRWNRLGIESPR

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_802aa
MELLNRNRLVIVSPRCTPPKASGGPARRGFYTFRSFCKDGGGGEEEEENGGEEKDDRGDKETRSDKGKATGRKAPLWLRAKFQRLLFKLG
CYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDS
ALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMHWQEELIVGGTVKNSTGKLVSAHALQ
TMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLA
TACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECL
KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSC
GGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDT

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_802aa
MELLNRNRLVIVSPRCTPPKASGGPARRGFYTFRSFCKDGGGGEEEEENGGEEKDDRGDKETRSDKGKATGRKAPLWLRAKFQRLLFKLG
CYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNTTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDS
ALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIETLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NTQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKTMHWQEELIVGGTVKNSTGKLVSAHALQ
TMFQLMTPKQMYEHFKGYETVSHINWNEDKAAAILEAWQRTTVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLA
TACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECL
KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQLRFALKTYFPYTSPSLAMVLLQDPQDIPRGHWLQTLKHISELLREAVEDQTHGSC
GGPFESWFLFIHFGGWAEMVAEQLLMSAAEPPTALLWLLAFYYGPRDGRQQRAQTMVQVKAVLGHLLAMSRSSSLSAQDLQTVAGQGTDT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_2409nt
ATGGCCTCGGCTGGTAACGCCGCCGAGCCCCAGGACCGCGGCGGCGGCGGCAGCGGCTGTATCGGTGCCCCGGGACGGCCGGCTGGAGGC
GGGAGGCGCAGACGGACGGGGGGGCTGCGCCGTGCTGCCGCGCCGGACCGGGACTATCTGCACCGGCCCAGCTACTGCGACGCCGCCTTC
GCTCTGGAGCAGATTTCCAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTG
GGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAAC
CTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAG
GCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGAC
TCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATC
ACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAA
TTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAA
ATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCC
GATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTA
TCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTG
CAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGAC
AAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTT
TCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTC
GCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCA
GTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTT
GGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGC
CTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTG
CGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCT
CAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCC
TGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCC
GAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTG
AAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGAC
ACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGG
GATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTT

>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_2409nt
ATGGCCTCGGCTGGTAACGCCGCCGAGCCCCAGGACCGCGGCGGCGGCGGCAGCGGCTGTATCGGTGCCCCGGGACGGCCGGCTGGAGGC
GGGAGGCGCAGACGGACGGGGGGGCTGCGCCGTGCTGCCGCGCCGGACCGGGACTATCTGCACCGGCCCAGCTACTGCGACGCCGCCTTC
GCTCTGGAGCAGATTTCCAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTG
GGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAAC
CTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAG
GCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGAC
TCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATC
ACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAA
TTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAA
ATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCC
GATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTA
TCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTG
CAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGAC
AAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTT
TCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTC
GCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCA
GTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTT
GGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGC
CTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTG
CGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCT
CAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCC
TGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCC
GAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTG
AAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGAC
ACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGG
GATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTT

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_2211nt
ATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAA
AACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAG
GAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAA
CTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGC
CGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATG
GATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCA
TACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGAC
AGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCC
ACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCAC
TGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTA
ATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTG
GAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACC
CTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACC
ATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGC
CTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTT
CTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCC
AGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAG
CTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGA
CACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAG
AGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTG
CTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCAC
CTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCT
GCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATG
GCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGA

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_2211nt
ATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAA
AACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAG
GAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAA
CTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGC
CGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATG
GATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCA
TACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGAC
AGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCC
ACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCAC
TGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTA
ATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTG
GAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACC
CTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACC
ATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGC
CTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTT
CTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCC
AGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAG
CTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGA
CACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAG
AGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTG
CTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCAC
CTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCT
GCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATG
GCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGA

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_2211nt
ATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAA
AACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAG
GAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAA
CTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGC
CGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATG
GATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCA
TACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGAC
AGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCC
ACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCAC
TGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTA
ATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTG
GAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACC
CTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACC
ATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGC
CTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTT
CTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCC
AGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAG
CTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGA
CACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAG
AGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTG
CTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCAC
CTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCT
GCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATG
GCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGA

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_2211nt
ATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAA
AACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAG
GAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAA
CTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGC
CGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATG
GATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCA
TACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGAC
AGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCC
ACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCAC
TGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTA
ATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTG
GAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACC
CTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACC
ATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGC
CTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTT
CTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCC
AGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAG
CTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGA
CACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAG
AGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTG
CTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCAC
CTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCT
GCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATG
GCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGA

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_2406nt
ATGGAACTGCTTAATAGAAACAGGCTTGTAATTGTGAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTT
TACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGGAGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAA
GAGACCCGCAGCGACAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGT
TGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTC
GAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCT
ATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCG
GCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACA
GAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTA
CAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATA
AACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGAT
CCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCC
AGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAG
ACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAA
GCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCC
TTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCC
TATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTG
GCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGT
GTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTG
AAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGG
GCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAA
GATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGC
GGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAA
CCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAG
GCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACA
GACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGAT
GTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGC

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_2406nt
ATGGAACTGCTTAATAGAAACAGGCTTGTAATTGTGAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTT
TACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGGAGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAA
GAGACCCGCAGCGACAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGT
TGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTC
GAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCT
ATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCG
GCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACA
GAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTA
CAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATA
AACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGAT
CCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCC
AGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAG
ACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAA
GCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCC
TTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCC
TATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTG
GCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGT
GTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTG
AAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGG
GCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAA
GATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGC
GGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAA
CCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAG
GCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACA
GACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGAT
GTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_5362nt
GAACTGGATGTGGGCAGCGGCGGCCGCAGAGACCTCGGGACCCCCGCGCAATGTGGCAATGGAAGGCGCAGGGTCTGACTCCCCGGCAGC
GGCCGCGGCCGCAGCGGCAGCAGCGCCCGCCGTGTGAGCAGCAGCAGCGGCTGGTCTGTCAACCGGAGCCCGAGCCCGAGCAGCCTGCGG
CCAGCAGCGTCCTCGCAAGCCGAGCGCCCAGGCGCGCCAGGAGCCCGCAGCAGCGGCAGCAGCGCGCCGGGCCGCCCGGGAAGCCTCCGT
CCCCGCGGCGGCGGCGGCGGCGGCGGCAACATGGCCTCGGCTGGTAACGCCGCCGAGCCCCAGGACCGCGGCGGCGGCGGCAGCGGCTGT
ATCGGTGCCCCGGGACGGCCGGCTGGAGGCGGGAGGCGCAGACGGACGGGGGGGCTGCGCCGTGCTGCCGCGCCGGACCGGGACTATCTG
CACCGGCCCAGCTACTGCGACGCCGCCTTCGCTCTGGAGCAGATTTCCAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGA
GCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGG
GCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTA
AATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTG
ACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAA
CATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACA
CCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGAC
CCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGT
TACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCC
CTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGC
ACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAG
TATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGT
GTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATC
CGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGG
CTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACT
CAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGA
ATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTC
ATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCA
TCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGA
GAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATG
GTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGG
CAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGAC
CTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTC
TGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTT
GACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACT
CAAGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCAC
GCATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCA
GAGCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGAC
CGTCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAA
AAATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTC
AGGGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCT
GGACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGC
TAACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAA
TTCAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCT
GTGATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCT
CTACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAAC
CCGGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATT
GTTAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTAC
ATTCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCG
TTTTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCAC
TGAAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTG
GTGGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATG
ATCCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCT
CCTGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGA
GAGGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCC
TCTTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCT
AGCCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCC
TTGCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCA
TGTGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGA
CAGGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAG
GAATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAG
GGAGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTAC
TCTAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAA
TACAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCT

>In-frame_PTCH1_ENST00000331920_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_5361nt
GAACTGGATGTGGGCAGCGGCGGCCGCAGAGACCTCGGGACCCCCGCGCAATGTGGCAATGGAAGGCGCAGGGTCTGACTCCCCGGCAGC
GGCCGCGGCCGCAGCGGCAGCAGCGCCCGCCGTGTGAGCAGCAGCAGCGGCTGGTCTGTCAACCGGAGCCCGAGCCCGAGCAGCCTGCGG
CCAGCAGCGTCCTCGCAAGCCGAGCGCCCAGGCGCGCCAGGAGCCCGCAGCAGCGGCAGCAGCGCGCCGGGCCGCCCGGGAAGCCTCCGT
CCCCGCGGCGGCGGCGGCGGCGGCGGCAACATGGCCTCGGCTGGTAACGCCGCCGAGCCCCAGGACCGCGGCGGCGGCGGCAGCGGCTGT
ATCGGTGCCCCGGGACGGCCGGCTGGAGGCGGGAGGCGCAGACGGACGGGGGGGCTGCGCCGTGCTGCCGCGCCGGACCGGGACTATCTG
CACCGGCCCAGCTACTGCGACGCCGCCTTCGCTCTGGAGCAGATTTCCAAGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGA
GCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGG
GCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTA
AATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTG
ACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAA
CATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACA
CCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGAC
CCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGT
TACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCC
CTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGC
ACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAG
TATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGT
GTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATC
CGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGG
CTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACT
CAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGA
ATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTC
ATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCA
TCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGA
GAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATG
GTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGG
CAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGAC
CTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTC
TGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTT
GACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACT
CAAGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCAC
GCATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCA
GAGCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGAC
CGTCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAA
AAATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTC
AGGGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCT
GGACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGC
TAACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAA
TTCAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCT
GTGATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCT
CTACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAAC
CCGGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATT
GTTAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTAC
ATTCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCG
TTTTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCAC
TGAAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTG
GTGGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATG
ATCCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCT
CCTGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGA
GAGGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCC
TCTTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCT
AGCCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCC
TTGCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCA
TGTGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGA
CAGGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAG
GAATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAG
GGAGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTAC
TCTAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAA
TACAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCT

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_5358nt
ACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCGTC
ACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATTGT
GAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGG
AGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGCAAGGGGGAGACGAGG
GAAGACTGGGAGAAGACGGAGGAGCGGAGGACGAGGAAAGGGGGGCCAGGGAAAAAAAAGGAATTGATGTGAAATCCAAGCCCAGCGTCC
GCGCCATCGGCACCCGCGCTCCGAGCAGGGGTTGACGGCCGGCTATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGA
AGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCT
TCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATT
ATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCA
CAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATT
TGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTT
TGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTT
TGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACA
TGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTG
TTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTG
GAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATG
TCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCG
CACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCG
TGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGG
CTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGG
TTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCC
CTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGG
CCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTC
TTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAG
CAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGG
CAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGC
AGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGC
AGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGG
CTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACC
AGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACTCAAG
TCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCACGCAT
TTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCAGAGC
CAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGACCGTC
AGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAAAAAT
TCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTCAGGG
ATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCTGGAC
CTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGCTAAC
TGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAATTCA
GTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCTGTGA
TCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCTCTAC
TAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAACCCGG
GAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATTGTTA
GTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTACATTC
TTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCGTTTT
GAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCACTGAA
GATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTGGTGG
CAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATGATCC
TTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCTCCTG
TTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGAGAGG
GGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCCTCTT
CCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCTAGCC
TGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCCTTGC
CGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCATGTG
GCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGACAGG
TGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAGGAAT
GGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAGGGAG
GCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTACTCTA
GCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAATACA
GAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCTGTAA

>In-frame_PTCH1_ENST00000437951_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_5357nt
ACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCGTC
ACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATTGT
GAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGG
AGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGCAAGGGGGAGACGAGG
GAAGACTGGGAGAAGACGGAGGAGCGGAGGACGAGGAAAGGGGGGCCAGGGAAAAAAAAGGAATTGATGTGAAATCCAAGCCCAGCGTCC
GCGCCATCGGCACCCGCGCTCCGAGCAGGGGTTGACGGCCGGCTATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGCGA
AGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGCCT
TCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAATT
ATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGACCA
CAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACATT
TGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACCTT
TGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCCTT
TGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTACA
TGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCTTG
TTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCACTG
GAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTATG
TCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGTCG
CACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCGCG
TGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCTGG
CTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCAGG
TTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAATCC
CTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCATGG
CCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATCTC
TTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGAAG
CAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGTGG
CAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCAGC
AGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCTGC
AGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTGGG
CTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGACC
AGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACTCAAG
TCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCACGCAT
TTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCAGAGC
CAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGACCGTC
AGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAAAAAT
TCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTCAGGG
ATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCTGGAC
CTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGCTAAC
TGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAATTCA
GTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCTGTGA
TCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCTCTAC
TAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAACCCGG
GAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATTGTTA
GTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTACATTC
TTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCGTTTT
GAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCACTGAA
GATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTGGTGG
CAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATGATCC
TTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCTCCTG
TTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGAGAGG
GGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCCTCTT
CCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCTAGCC
TGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCCTTGC
CGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCATGTG
GCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGACAGG
TGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAGGAAT
GGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAGGGAG
GCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTACTCTA
GCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAATACA
GAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCTGTAA

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_5450nt
CGGCCGCGGGGGGCGGGGAGAGGGTGGCTAGGCTCGCGGGAGCTCGCCGGGCAGGGCGCCTCCCAGGAAGGCGGGGAGGGGAGCGCCTGT
TTACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCG
TCACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATT
GTGAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGA
GGAGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGCAAGGGGGAGACGA
GGGAAGACTGGGAGAAGACGGAGGAGCGGAGGACGAGGAAAGGGGGGCCAGGGAAAAAAAAGGAATTGATGTGAAATCCAAGCCCAGCGT
CCGCGCCATCGGCACCCGCGCTCCGAGCAGGGGTTGACGGCCGGCTATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGC
GAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGC
CTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAA
TTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGAC
CACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACA
TTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACC
TTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCC
TTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTA
CATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCT
TGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCAC
TGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTA
TGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGT
CGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCG
CGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCT
GGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCA
GGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAAT
CCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCAT
GGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATC
TCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGA
AGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGT
GGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCA
GCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCT
GCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTG
GGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGA
CCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACTCA
AGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCACGC
ATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCAGA
GCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGACCG
TCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAAAA
ATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTCAG
GGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCTGG
ACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGCTA
ACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAATT
CAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCTGT
GATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCTCT
ACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAACCC
GGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATTGT
TAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTACAT
TCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCGTT
TTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCACTG
AAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTGGT
GGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATGAT
CCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCTCC
TGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGAGA
GGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCCTC
TTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCTAG
CCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCCTT
GCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCATG
TGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGACA
GGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAGGA
ATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAGGG
AGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTACTC
TAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAATA
CAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCTGT

>In-frame_PTCH1_ENST00000430669_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_5449nt
CGGCCGCGGGGGGCGGGGAGAGGGTGGCTAGGCTCGCGGGAGCTCGCCGGGCAGGGCGCCTCCCAGGAAGGCGGGGAGGGGAGCGCCTGT
TTACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCG
TCACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATT
GTGAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGA
GGAGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGCAAGGGGGAGACGA
GGGAAGACTGGGAGAAGACGGAGGAGCGGAGGACGAGGAAAGGGGGGCCAGGGAAAAAAAAGGAATTGATGTGAAATCCAAGCCCAGCGT
CCGCGCCATCGGCACCCGCGCTCCGAGCAGGGGTTGACGGCCGGCTATGGGGAAGGCTACTGGCCGGAAAGCGCCGCTGTGGCTGAGAGC
GAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGTTGTGGGCCTCCTCATATTTGGGGC
CTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGGAGGACGAGTAAGTCGTGAATTAAA
TTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAAAGAAGAAGGTGCTAATGTCCTGAC
CACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTACAACAGGCAGTGGAAATTGGAACA
TTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCTTTACCCTTGTTTGATTATTACACC
TTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCCTTTGCGGTGGACAAACTTCGACCC
TTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAATAAGGCTGAGGTTGGTCATGGTTA
CATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTCAACCAAACCTCTTGATATGGCCCT
TGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGTGGGTGGCACAGTCAAGAACAGCAC
TGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTACGAGCACTTCAAGGGGTACGAGTA
TGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATATGTGGAGGTGGTTCATCAGAGTGT
CGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATCCTTCTCTGACGTCAGTGTCATCCG
CGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTCCAAGTCCCAGGGTGCCGTGGGGCT
GGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAATTTCCTTTAACGCTGCAACAACTCA
GGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAGTGAAACAGGACAGAATAAAAGAAT
CCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCATCAGCAATGTCACAGCCTTCTTCAT
GGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGACCTACTTTCCTTACACTTCTCCATC
TCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAAGCATATTTCTGAACTGCTCAGAGA
AGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCACTTCGGAGGATGGGCTGAGATGGT
GGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTACTACGGCCCCCGTGATGGGAGGCA
GCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAGCAGCAGCCTCTCAGCCCAGGACCT
GCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCACCTTCTCCTCAACTTCCTGCTCTG
GGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAACTCACGAGATCATTGGCTTTCTTGA
CCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGAGCTCCTTAAAGAGCTGCGAACTCA
AGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGGACAGGTGATGACCTGTGGCCACGC
ATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCTAGTATCTATTTTACAAAATGCAGA
GCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACTCCTGGTGCCCGCCCGGCCAGACCG
TCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTCAAGCTGCACATCTATTATTTAAAA
ATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCTTTTTAGACTCTTTTTAGGAGTCAG
GGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCTCAGGCTTCCCTTGTGTCTCCCTGG
ACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCACTCTGTATTTGCTAAATGATGCTA
ACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAGAAACATTAGAAGGCAGGATTAATT
CAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGGCTGGGTGCAGTGGCTCACACCTGT
GATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGGCTAACATGGCAATACCCTATCTCT
ACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCTGAGGCATGAGGATCTCTTGAACCC
GGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGACCATCTCTTAAAAAAAGGCATTGT
TAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACATTCTGGAATTGTATTGGTTGTACAT
TCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGTATTAGTCTGAGTCTTGGCTCCGTT
TTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTATGTGGCAATGCTAATAGATCCACTG
AAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAGGGTGTGCTGGTAAAGTATTTTGGT
GGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATATAACATGCTTCGTGCCATCATGAT
CCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTTCACTGGAGTTGAGGGCCTCTCTCC
TGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGTGGCAGCAGGGAACCCCTAGAGAGA
GGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGTGGTCCTGTGTACAGGGTTGGCCTC
TTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTAGGCATCTGGAAGACTTCTTCCTAG
CCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCTCACGGGTGCGGTGGAGGCGGCCTT
GCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGCACTGAAGTGCCTGCTGGCTTCATG
TGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCGGCCATTCCCTCCACCTCCAAGACA
GGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGCCTGGGCAGGTGCCACCGGGAAGGA
ATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGCCTGGGCACAGGGGCAGCCGCAGGG
AGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGACAGGGTCTGGAATCTGACCTTACTC
TAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCACTACCCTCAGAGAGAGCCAAAAATA
CAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGAATTTTTTAGCTCTTTAAAATCTGT

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000289081_chr9_97879672_-_5204nt
ACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCGTC
ACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATTGT
GAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGG
AGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGGGAAGGCTACTGGCCG
GAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGT
TGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGG
AGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAA
AGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTA
CAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCT
TTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCC
TTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAA
TAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTC
AACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGT
GGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTA
CGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATA
TGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATC
CTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTC
CAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAAT
TTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAG
TGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCAT
CAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGAC
CTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAA
GCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCA
CTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTA
CTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAG
CAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCA
CCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAAC
TCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGA
GCTCCTTAAAGAGCTGCGAACTCAAGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGG
ACAGGTGATGACCTGTGGCCACGCATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCT
AGTATCTATTTTACAAAATGCAGAGCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACT
CCTGGTGCCCGCCCGGCCAGACCGTCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTC
AAGCTGCACATCTATTATTTAAAAATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCT
TTTTAGACTCTTTTTAGGAGTCAGGGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCT
CAGGCTTCCCTTGTGTCTCCCTGGACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCA
CTCTGTATTTGCTAAATGATGCTAACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAG
AAACATTAGAAGGCAGGATTAATTCAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGG
CTGGGTGCAGTGGCTCACACCTGTGATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGG
CTAACATGGCAATACCCTATCTCTACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCT
GAGGCATGAGGATCTCTTGAACCCGGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGA
CCATCTCTTAAAAAAAGGCATTGTTAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACAT
TCTGGAATTGTATTGGTTGTACATTCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGT
ATTAGTCTGAGTCTTGGCTCCGTTTTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTAT
GTGGCAATGCTAATAGATCCACTGAAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAG
GGTGTGCTGGTAAAGTATTTTGGTGGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATA
TAACATGCTTCGTGCCATCATGATCCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTT
CACTGGAGTTGAGGGCCTCTCTCCTGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGT
GGCAGCAGGGAACCCCTAGAGAGAGGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGT
GGTCCTGTGTACAGGGTTGGCCTCTTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTA
GGCATCTGGAAGACTTCTTCCTAGCCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCT
CACGGGTGCGGTGGAGGCGGCCTTGCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGC
ACTGAAGTGCCTGCTGGCTTCATGTGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCG
GCCATTCCCTCCACCTCCAAGACAGGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGC
CTGGGCAGGTGCCACCGGGAAGGAATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGC
CTGGGCACAGGGGCAGCCGCAGGGAGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGAC
AGGGTCTGGAATCTGACCTTACTCTAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCAC
TACCCTCAGAGAGAGCCAAAAATACAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGA

>In-frame_PTCH1_ENST00000375274_chr9_98238316_-_FANCC_ENST00000375305_chr9_97879672_-_5203nt
ACCCAGGAGGGCTGTGCTGATAGCACGTTCCTCGAGTTTACTTTGCTTTCCTTGAGTTTATTGTAAAGGGGTAAAGTTTTCGGATCCGTC
ACGTGACCCTGACAGGTCCTGCCTATGGCGCGGCAGACCACCCACGCCGAGGGCCATGGAACTGCTTAATAGAAACAGGCTTGTAATTGT
GAGTCCGCGCTGCACTCCGCCGAAAGCCTCCGGCGGCCCAGCGCGCCGGGGTTTTTACACTTTCCGTTCCTTTTGTAAAGACGGAGGAGG
AGGAGAAGAAGAAGAAGAAAACGGAGGAGAAGAAAAAGACGACAGGGGAGACAAAGAGACCCGCAGCGACAAGGGGAAGGCTACTGGCCG
GAAAGCGCCGCTGTGGCTGAGAGCGAAGTTTCAGAGACTCTTATTTAAACTGGGTTGTTACATTCAAAAAAACTGCGGCAAGTTCTTGGT
TGTGGGCCTCCTCATATTTGGGGCCTTCGCGGTGGGATTAAAAGCAGCGAACCTCGAGACCAACGTGGAGGAGCTGTGGGTGGAAGTTGG
AGGACGAGTAAGTCGTGAATTAAATTATACTCGCCAGAAGATTGGAGAAGAGGCTATGTTTAATCCTCAACTCATGATACAGACCCCTAA
AGAAGAAGGTGCTAATGTCCTGACCACAGAAGCGCTCCTACAACACCTGGACTCGGCACTCCAGGCCAGCCGTGTCCATGTATACATGTA
CAACAGGCAGTGGAAATTGGAACATTTGTGTTACAAATCAGGAGAGCTTATCACAGAAACAGGTTACATGGATCAGATAATAGAATATCT
TTACCCTTGTTTGATTATTACACCTTTGGACTGCTTCTGGGAAGGGGCGAAATTACAGTCTGGGACAGCATACCTCCTAGGTAAACCTCC
TTTGCGGTGGACAAACTTCGACCCTTTGGAATTCCTGGAAGAGTTAAAGAAAATAAACTATCAAGTGGACAGCTGGGAGGAAATGCTGAA
TAAGGCTGAGGTTGGTCATGGTTACATGGACCGCCCCTGCCTCAATCCGGCCGATCCAGACTGCCCCGCCACAGCCCCCAACAAAAATTC
AACCAAACCTCTTGATATGGCCCTTGTTTTGAATGGTGGATGTCATGGCTTATCCAGAAAGTATATGCACTGGCAGGAGGAGTTGATTGT
GGGTGGCACAGTCAAGAACAGCACTGGAAAACTCGTCAGCGCCCATGCCCTGCAGACCATGTTCCAGTTAATGACTCCCAAGCAAATGTA
CGAGCACTTCAAGGGGTACGAGTATGTCTCACACATCAACTGGAACGAGGACAAAGCGGCAGCCATCCTGGAGGCCTGGCAGAGGACATA
TGTGGAGGTGGTTCATCAGAGTGTCGCACAGAACTCCACTCAAAAGGTGCTTTCCTTCACCACCACGACCCTGGACGACATCCTGAAATC
CTTCTCTGACGTCAGTGTCATCCGCGTGGCCAGCGGCTACTTACTCATGCTCGCCTATGCCTGTCTAACCATGCTGCGCTGGGACTGCTC
CAAGTCCCAGGGTGCCGTGGGGCTGGCTGGCGTCCTGCTGGTTGCACTGTCAGTGGCTGCAGGACTGGGCCTGTGCTCATTGATCGGAAT
TTCCTTTAACGCTGCAACAACTCAGGTTTTGCCATTTCTCGCTCTTGGTGTTGGTGTGGATGATGTTTTTCTTCTGGCCCACGCCTTCAG
TGAAACAGGACAGAATAAAAGAATCCCTTTTGAGGACAGGACCGGGGAGTGCCTGAAGCGCACAGGAGCCAGCGTGGCCCTCACGTCCAT
CAGCAATGTCACAGCCTTCTTCATGGCCGCGTTAATCCCAATTCCCGCTCTGCGGGCGTTCTCCCTCCAGCTGCGGTTTGCACTCAAGAC
CTACTTTCCTTACACTTCTCCATCTCTTGCCATGGTGCTGCTGCAAGACCCTCAAGATATCCCTCGGGGACACTGGCTCCAGACACTGAA
GCATATTTCTGAACTGCTCAGAGAAGCAGTTGAAGACCAGACTCATGGGTCCTGCGGAGGTCCCTTTGAGAGCTGGTTCCTGTTCATTCA
CTTCGGAGGATGGGCTGAGATGGTGGCAGAGCAATTACTGATGTCGGCAGCCGAACCCCCCACGGCCCTGCTGTGGCTCTTGGCCTTCTA
CTACGGCCCCCGTGATGGGAGGCAGCAGAGAGCACAGACTATGGTCCAGGTGAAGGCCGTGCTGGGCCACCTCCTGGCAATGTCCAGAAG
CAGCAGCCTCTCAGCCCAGGACCTGCAGACGGTAGCAGGACAGGGCACAGACACAGACCTCAGAGCTCCTGCACAACAGCTGATCAGGCA
CCTTCTCCTCAACTTCCTGCTCTGGGCTCCTGGAGGCCACACGATCGCCTGGGATGTCATCACCCTGATGGCTCACACTGCTGAGATAAC
TCACGAGATCATTGGCTTTCTTGACCAGACCTTGTACAGATGGAATCGTCTTGGCATTGAAAGCCCTAGATCAGAAAAACTGGCCCGAGA
GCTCCTTAAAGAGCTGCGAACTCAAGTCTAGAAGGCACGCAGGCCGTGTGGGTGCCCGGCGTGAGGGATCAGGCTCGCCAGGGCCACAGG
ACAGGTGATGACCTGTGGCCACGCATTTGTGGAGTAAGTGCCCTCGCTGGGCTGTGAGAATGAGCTGTACACATCTTGGGACAATCTGCT
AGTATCTATTTTACAAAATGCAGAGCCAGGTCCCTCAGCCCAGACTCAGTCAGACATGTTCACTAATGACTCAAGTGAGCCTTCGGTACT
CCTGGTGCCCGCCCGGCCAGACCGTCAGCTTGATAATTACTAAAGCAAAGGCCTGGGTGGGAGAACAGGTTTCTAGTTTTTACCCAAGTC
AAGCTGCACATCTATTATTTAAAAATTCAAAGTCTTAGAACCAAGAATTTGGTCATGAACCATTAAAGAATTTAGAGAGAACTTAGCTCT
TTTTAGACTCTTTTTAGGAGTCAGGGATCTGGGATAAAGCCACACTGTCTTGCTGTATGGAGAAATTCTTCAAGGGGAGTCAGGGTCCCT
CAGGCTTCCCTTGTGTCTCCCTGGACCTGCCTGACAGGCCACAGGAGCAGACAGCACACCCAAGCCCGGGCCTCCGGCACACTCTTTCCA
CTCTGTATTTGCTAAATGATGCTAACTGCTACCAAAAGGCCCTTGGGACATCAGAGGAGCCGGCAGGCGAAGGTAGAGGATGTGTTCCAG
AAACATTAGAAGGCAGGATTAATTCAGTTAGTTAGTTCTCTTGTTAAATGGAAATGGGAATTGGAAATTCCTGATAAAGAATTGGCCTGG
CTGGGTGCAGTGGCTCACACCTGTGATCCCAGCACTTTGGGAGGCCAAGGCAGGGGGATTACTTCAGCCCAGGAGTTCCAGACTGCCTGG
CTAACATGGCAATACCCTATCTCTACTAAAAATACAAAAATTATCGGGGTGCAATGGCATGCATCTGTAATCCCAGCTATTCAAGAGGCT
GAGGCATGAGGATCTCTTGAACCCGGGAGGTGGGAGTTGTAGTGAGCCGAGATCATGACACTGCACTCCAGCCTGGGCAACAGAGCGAGA
CCATCTCTTAAAAAAAGGCATTGTTAGTGTAATCTCAAGGTTAACATTTATTTCATGTCAGTACAGGGTGCTTTTTCCTTTCAGGGACAT
TCTGGAATTGTATTGGTTGTACATTCTTTTGTGTCTATTCTGTTTGTCAAGTGAGTCAAGACTTGCTTTTGTCCATTTTGATTTGTGTGT
ATTAGTCTGAGTCTTGGCTCCGTTTTGAGGTATGAGCAAAGTTTTGCTGGATTAGAAGTTAACCTTTAGGGAAATTCCTTATTTTGGTAT
GTGGCAATGCTAATAGATCCACTGAAGATCTGGAAAATTCCAGGAACTTTTCACCTGAGCCTTTCTTCTGAGAAATGCTGCAGTCAGAAG
GGTGTGCTGGTAAAGTATTTTGGTGGCAGCTGCCATCATGGTCATTGCCTTCATATAACATGCTTCGTGCTCATGGTCATTGCCTTCATA
TAACATGCTTCGTGCCATCATGATCCTTGCCTTCATATAACAAACATGCTTCGTCAGAGGTGTTGGGGTTGAAAAAGGAGCTGCATGCTT
CACTGGAGTTGAGGGCCTCTCTCCTGTTCTGACTTTAAGCCAGAACTTGTGGCTGGGCCATGGAAGCTGTGACTCCTCTGTGGACATGGT
GGCAGCAGGGAACCCCTAGAGAGAGGGGCCACTGGGACCAGGCCTCCTGTTGTGGAGGGACTCCTGGGACAGTCCTCCACCCTGTCCTGT
GGTCCTGTGTACAGGGTTGGCCTCTTCCTCCTCCCCTGCCAGGCCTCTGCCCATGCCCCTTCCTTCCTTCTCCTGGGACTGGTGAAGCTA
GGCATCTGGAAGACTTCTTCCTAGCCTGGAAGCCCTGACCTCGGCCCATCTGCAGAATCTCCCAGTTCCTTCACAGCTGCCGAGTCCTCT
CACGGGTGCGGTGGAGGCGGCCTTGCCGGTGGTGCTTTCTGGGCAGCCAGGGGTTCCTGGGTGGGAGGACTGTCCCTCTGGGGACGTGGC
ACTGAAGTGCCTGCTGGCTTCATGTGGCCCTTTGCCCTTTCCCAGCCTGAGAGATGCTCAAAGGTGGGGAGCTGGGGGAGCCACCCCTCG
GCCATTCCCTCCACCTCCAAGACAGGTGGCGGCCGGGCAGGCACTCTTAAGCCCACCTCCCCCTCTTGTTGCCTTCGATTTCGGCAAAGC
CTGGGCAGGTGCCACCGGGAAGGAATGGCATCCGAGATGCTGGGCGGGGACGCGGCGTGGCCGAGGGGGCCTTGACGGCGTTGGCGGGGC
CTGGGCACAGGGGCAGCCGCAGGGAGGCAGGGATGGCAAGGCGTGAAGCCACCCTGGAAGGAACTGGACCAAGGTCTTCAGAGGTGCGAC
AGGGTCTGGAATCTGACCTTACTCTAGCAGGAGTTTTTGTAGACTCTCCCTGATAGTTTAGTTTTTGATAAAGCATGCTGGTAAAACCAC
TACCCTCAGAGAGAGCCAAAAATACAGAAGAGGCGGAGAGCGCCCCTCCAACCAGGCTGTTATTCCCCTGGACTCCGTGACATCTGTGGA


Top

FusionGenePPI for PTCH1_FANCC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PTCH1SMO, CAV1, ITCH, WWP2, NEDD4, NEDD4L, SMURF1, SMURF2, WWP1, CASP9, FHL2, CNTNAP3, B4GALT7, CACNA2D2, IMPAD1, SEMA6A, PLXNA1, TMEM132A, PAM, HLA-C, HLA-A, HSPA5, TMEM160, PLXNB2, NDST2, TPST2, CNNM4, CNNM1, POMGNT2, CHST14, SPPL2B, EXT1, ADAM17, ENPP1, DDX19B, TTC17, MUCL1, COCH, ASPH, TMEM131, EGFR, MOXD1, UGT8, ITGA7, HS6ST2, SLIT2, POMT2, B4GALT1, SULF2, ATF6B, CHST12, MAN2A1, ARSK, ITGA6, NETO2, CCPG1, ST3GAL6, CHSY1, CACNA2D1, UGT3A2, MGAT5, B4GALT3, PXYLP1, GCNT1, COL18A1, DHFRL1, TXNDC15, SEMA4F, B3GALTL, FUT11, TOR1AIP1, ABCA2, ST8SIA4, RNF130, ITGA8, ST3GAL4, ST6GALNAC3, ITGA4, CHPF, ENDOG, TMEM2, LRFN3, GALNT7, TGFBR3, MGAT1, PDF, KIAA1161, YAP1, GALNT18, CHST3, BTN2A1, NPTX1, ITGAV, ABHD14A, CCNB1FANCCEBLN2, HSPA1A, EIF2AK2, FANCE, FANCF, STAT1, GSTP1, FANCA, SPTAN1, AZIN1, TCERG1, CDK1, FANCG, ZBTB32, RPS3A, HSP90B1, HSP90AA1, HSPA8, ATP6, KRT1, IK, RPL18, USP14, FANCM, NPM1, CAPN1, FANCL, HES1, FANCD2, HSPA4, DNAJB1, POR, CTNNB1, C1orf86, CAPN10, APITD1, STRA13, C17orf70, NOTCH1, STMN2, STMN1, CTBP1, RECQL5, UNC5A, FANCC, PRDX3, PRPF31, CCNA2, SPTA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PTCH1_FANCC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PTCH1_FANCC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePTCH1C0004779Basal Cell Nevus Syndrome13CTD_human;ORPHANET;UNIPROT
HgenePTCH1C0007117Basal cell carcinoma3CTD_human;HPO
HgenePTCH1C0025149Medulloblastoma3CTD_human;HPO
HgenePTCH1C1835820HOLOPROSENCEPHALY 73CTD_human;UNIPROT
HgenePTCH1C0376634Craniofacial Abnormalities2CTD_human
HgenePTCH1C0006118Brain Neoplasms1CTD_human
HgenePTCH1C0008924Cleft Lip1CTD_human;HPO
HgenePTCH1C0008925Cleft Palate1CTD_human;HPO
HgenePTCH1C0019693HIV Infections1CTD_human
HgenePTCH1C0030297Pancreatic Neoplasm1CTD_human
HgenePTCH1C0035412Rhabdomyosarcoma1CTD_human
HgenePTCH1C0037286Skin Neoplasms1CTD_human
HgenePTCH1C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneFANCCC3468041FANCONI ANEMIA, COMPLEMENTATION GROUP C2CTD_human;UNIPROT