FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29215

FusionGeneSummary for PSME1_AP1G2

check button Fusion gene summary
Fusion gene informationFusion gene name: PSME1_AP1G2
Fusion gene ID: 29215
HgeneTgene
Gene symbol

PSME1

AP1G2

Gene ID

5720

8906

Gene nameproteasome activator subunit 1adaptor related protein complex 1 subunit gamma 2
SynonymsHEL-S-129m|IFI5111|PA28A|PA28alpha|REGalphaG2AD
Cytomap

14q12

14q11.2

Type of geneprotein-codingprotein-coding
Descriptionproteasome activator complex subunit 111S regulator complex subunit alpha29-kD MCP activator subunitIGUP I-5111activator of multicatalytic protease subunit 1epididymis secretory sperm binding protein Li 129minterferon gamma up-regulated I-5111 proteAP-1 complex subunit gamma-like 2adaptor related protein complex 1 gamma 2 subunitclathrin-associated/assembly/adaptor protein, large, gamma-2gamma2-adaptin
Modification date2018052320180519
UniProtAcc

Q06323

O75843

Ensembl transtripts involved in fusion geneENST00000206451, ENST00000559123, 
ENST00000382708, ENST00000561435, 
ENST00000470718, 
ENST00000308724, 
ENST00000397120, ENST00000556277, 
Fusion gene scores* DoF score2 X 2 X 2=814 X 4 X 8=448
# samples 214
** MAII scorelog2(2/8*10)=1.32192809488736log2(14/448*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PSME1 [Title/Abstract] AND AP1G2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-A4-7287-01APSME1chr14

24608175

+AP1G2chr14

24037279

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000206451ENST00000308724PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000206451ENST00000397120PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000206451ENST00000556277PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-3CDSENST00000559123ENST00000308724PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-intronENST00000559123ENST00000397120PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-intronENST00000559123ENST00000556277PSME1chr14

24608175

+AP1G2chr14

24037279

-
Frame-shitENST00000382708ENST00000308724PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000382708ENST00000397120PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000382708ENST00000556277PSME1chr14

24608175

+AP1G2chr14

24037279

-
In-frameENST00000561435ENST00000308724PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000561435ENST00000397120PSME1chr14

24608175

+AP1G2chr14

24037279

-
5CDS-intronENST00000561435ENST00000556277PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-3CDSENST00000470718ENST00000308724PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-intronENST00000470718ENST00000397120PSME1chr14

24608175

+AP1G2chr14

24037279

-
intron-intronENST00000470718ENST00000556277PSME1chr14

24608175

+AP1G2chr14

24037279

-

Top

FusionProtFeatures for PSME1_AP1G2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PSME1

Q06323

AP1G2

O75843

Implicated in immunoproteasome assembly and required forefficient antigen processing. The PA28 activator complex enhancesthe generation of class I binding peptides by altering thecleavage pattern of the proteasome. May function in protein sorting in late endosomes ormultivesucular bodies (MVBs). {ECO:0000269|PubMed:9733768}. (Microbial infection) Involved in MVB-assistedmaturation of hepatitis B virus (HBV).{ECO:0000269|PubMed:16867982, ECO:0000269|PubMed:17553870}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PSME1_AP1G2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PSME1_ENST00000561435_chr14_24608175_+_AP1G2_ENST00000308724_chr14_24037279_-_303aa
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSTFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKK
KGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKTFSE
RGDAVTKAAKQPHVGDTRQLVHELDEAEYRDIRLMVMEIRNATVRRLCTMTSS_RTSRSSRSPGEKQRE_SIESPLSHSVMSTAETFLLF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PSME1_ENST00000561435_chr14_24608175_+_AP1G2_ENST00000308724_chr14_24037279_-_909nt
ATGGCCATGCTCAGGGTCCAGCCCGAGGCCCAAGCCAAGGTGGATGTGTTTCGTGAAGACCTCTGTACCAAGACAGAGAACCTGCTCGGG
AGCTATTTCCCCAAGAAGATTTCTGAGCTGGATGCATTTTTAAAGGAGCCAGCTCTCAATGAAGCCAACTTGAGCAATCTGAAGGCCCCA
TTGGACATCCCAGTGCCTGATCCAGTCAAGGAGAAAGAGAAAGAGGAGCGGAAGAAACAGCAGGAGAAGGAAGACAAGGATGAAAAGAAG
AAGGGGGAGGATGAAGACAAAGGTCCTCCCTGTGGCCCAGTGAACTGCAATGAAAAGATCGTGGTCCTTCTGCAGCGCTTGAAGCCTGAG
ATCAAGGATGTCATTGAGCAGCTCAACCTGGTCACCACCTGGTTGCAGCTGCAGATACCTCGGATTGAGGATGGTAACAATTTTGGAGTG
GCTGTCCAGGAGAAGGTGTTTGAGCTGATGACCAGCCTCCACACCAAGCTAGAAGGCTTCCACACTCAAATCTCTAAGTATTTCTCTGAG
CGTGGTGATGCAGTGACTAAAGCAGCCAAGCAGCCCCATGTGGGTGATTATCGGCAGCTGGTGCACGAGCTGGATGAGGCAGAGTACCGG
GACATCCGGCTGATGGTCATGGAGATCCGCAATGCTTATGTGAGGAGGCTGTGTTATATGACATCATCCTGAAGAACTTCGAGAAGCTCA
AGAAGCCCAGGGGAGAAACAAAGGGAATGATCTATTGAGAGCCCTCTCTCCCATTCTGTGATGAGTACAGCAGAGACCTTCCTGCTTTTT
ACTGGGGACTCCAGATTTTCCCCAAACTTGCTTCTGTTGAGATTTTTCCCTCACCTTGCCTCTCAGGCACAATAAATATAGTTATACCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PSME1_ENST00000561435_chr14_24608175_+_AP1G2_ENST00000308724_chr14_24037279_-_4243nt
CACTCCTTGTGCGGCGCTAGGCCCCCCGTCCCGGTCATGGCCATGCTCAGGGTCCAGCCCGAGGCCCAAGCCAAGGTGGATGTGTTTCGT
GAAGACCTCTGTACCAAGACAGAGAACCTGCTCGGGAGCTATTTCCCCAAGAAGATTTCTGAGCTGGATGCATTTTTAAAGGAGCCAGCT
CTCAATGAAGCCAACTTGAGCAATCTGAAGGCCCCATTGGACATCCCAGTGCCTGATCCAGTCAAGGAGAAAGAGAAAGAGGAGCGGAAG
AAACAGCAGGAGAAGGAAGACAAGGATGAAAAGAAGAAGGGGGAGGATGAAGACAAAGGTCCTCCCTGTGGCCCAGTGAACTGCAATGAA
AAGATCGTGGTCCTTCTGCAGCGCTTGAAGCCTGAGATCAAGGATGTCATTGAGCAGCTCAACCTGGTCACCACCTGGTTGCAGCTGCAG
ATACCTCGGATTGAGGATGGTAACAATTTTGGAGTGGCTGTCCAGGAGAAGGTGTTTGAGCTGATGACCAGCCTCCACACCAAGCTAGAA
GGCTTCCACACTCAAATCTCTAAGTATTTCTCTGAGCGTGGTGATGCAGTGACTAAAGCAGCCAAGCAGCCCCATGTGGGTGATTATCGG
CAGCTGGTGCACGAGCTGGATGAGGCAGAGTACCGGGACATCCGGCTGATGGTCATGGAGATCCGCAATGCTTATGTGAGGAGGCTGTGT
TATATGACATCATCCTGAAGAACTTCGAGAAGCTCAAGAAGCCCAGGGGAGAAACAAAGGGAATGATCTATTGAGAGCCCTCTCTCCCAT
TCTGTGATGAGTACAGCAGAGACCTTCCTGCTTTTTACTGGGGACTCCAGATTTTCCCCAAACTTGCTTCTGTTGAGATTTTTCCCTCAC
CTTGCCTCTCAGGCACAATAAATATAGTTATACCACTGCCCATCAAAAAAAAATATATTAATAAAAAAGTTCAAAAAAGGGGGGGGATTG
TCATCTCCTTTGGGGTGCGATGGCTTCAAATCCAAACTGAGGCTCTCCGGGTGGTAAGGATGTGCGAGGAGGCCTCTTGAAGAACTCCAG
GCCTATCATGCTGTCTCTCCGCTAAAGCCTGAGGCCCGAGGTCAGAGGATTCAGGAAGGCTCTGCAGTCGGCCCAGGAGGGCGGGGTCCC
GTGGTGGAGGCGGGGAGAGGGAAGGACCGCACGGAGCACCAACCCCTGCTCGGCCCCGTACCAGGAAGCGCTGGGGGGCAGAGGAGCGGA
GTTGAGGCAGAAGCCAGGTGAGGCTGGAGTCCTGGGGTAGGCAGGCTGTCGCTGCCGCTGCCGCTGCCTGAGATGGAAATCGGGGGAGGA
AGCTCGCGGAAGAAACAGCGGAGGGTCGTGGAAAAAAAAGCAATGGCTGAGCTAGGGATGGGGTACCAGGTAGGGGGAGGAAACGGTAGA
GAGAAATAGGTGGGGCTCCCGCGCATGCTCAATAGGAAGGGGCGCCGGTGGGGTGCGGACGCATGCGTAGTGGGCTTCTCGGGCGGTGGG
GTGGGCGCGGAATTTGGAGACCCACTTCGGGAAAGGTAAAATGCGGGCGCAATTTTAGGGTACCTGTGGGACCCGGGCTCTTAGGGTCTT
GACACAGGACGGGCCTGGGCCGAAAGCCCAGGCACGCCCGACCAGAGAGTGTTTCTCCACTCCCGGACTCTGCCAGTCAGGATGGTGGTG
CCTTCGCTGAAGCTTCAGGACCTCATCGAAGAGATTCGCGGGGCCAAGACTCAGGCCCAGGAGCGGGAGGTGATCCAAAAGGAGTGTGCC
CACATCCGGGCCTCCTTCCGCGACGGGGACCCAGTGCACAGGCACCGGCAGCTGGCCAAACTGCTCTACGTCCACATGTTGGGCTACCCC
GCCCACTTTGGACAGATGGAGTGCCTGAAACTGATCGCCTCCTCCAGATTCACAGACAAGAGGGTGGGCTACCTGGGGGCCATGCTTCTA
TTGGATGAGAGGCACGATGCCCACCTGCTCATTACCAACAGCATCAAGAATGACCTGAGCCAGGGGATTCAGCCAGTACAAGGCCTGGCC
TTGTGCACTTTGAGCACCATGGGCTCTGCTGAGATGTGCCGAGACCTGGCCCCAGAGGTGGAGAAACTGCTCCTGCAGCCCAGTCCCTAC
GTGCGCAAGAAGGCTATTCTGACTGCAGTGCACATGATCCGGAAGGTCCCTGAACTCTCCAGTGTCTTCCTCCCACCCTGTGCCCAACTG
CTTCATGAGCGTCACCATGGCATCCTGCTGGGCACCATCACGCTGATCACGGAGCTCTGCGAACGAAGCCCTGCAGCCCTCAGGCACTTC
CGAAAGGTGGTACCCCAGCTGGTACACATCCTCCGGACTCTGGTGACAATGGGATACTCCACAGAACACAGCATATCTGGAGTCAGCGAC
CCCTTCCTGCAGGTCCAGATACTTCGTCTGCTTCGGATCCTGGGCCGGAACCACGAGGAGAGCAGTGAGACCATGAATGACTTGCTGGCC
CAGGTGGCCACTAACACGGACACCAGCCGAAATGCCGGAAATGCGGTCCTGTTTGAGACAGTACTCACCATCATGGATATCCGCTCTGCA
GCTGGCCTACGGGTTCTAGCTGTCAACATTCTTGGTCGCTTCCTACTCAACAGTGACAGGAACATTAGGTATGTAGCCCTGACATCACTG
CTTCGACTGGTGCAGTCTGATCACAGTGCTGTGCAGCGGCATCGGCCCACTGTGGTGGAATGTCTACGGGAAACTGATGCCTCCCTCAGC
CGGAGAGCCCTGGAACTAAGCCTGGCTCTGGTAAATAGCTCCAATGTGCGAGCCATGATGCAAGAGCTGCAGGCCTTTCTGGAGTCCTGC
CCTCCTGACCTACGGGCTGACTGTGCCTCAGGCATCCTGCTGGCTGCAGAGAGGTTTGCTCCAACCAAACGCTGGCACATAGACACCATC
CTGCATGTGCTGACAACGGCGGGCACCCATGTGCGGGATGATGCAGTGGCCAACCTGACCCAGCTGATTGGGGGGGCCCAGGAGCTACAT
GCCTACTCTGTGCGCCGCCTCTACAATGCCCTGGCAGAAGACATTTCCCAGCAACCACTGGTGCAGGTGGCAGCCTGGTGCATTGGGGAG
TATGGGGACCTCCTGCTGGCAGGGAACTGCGAGGAGATTGAGCCCCTTCAGGTGGACGAAGAGGAAGTGCTGGCATTGCTGGAAAAGGTG
CTGCAGTCCCACATGTCCCTGCCAGCCACTCGAGGATATGCCCTCACAGCCCTCATGAAGCTCAGCACTCGCCTCTGTGGGGACAACAAC
CGCATCCGCCAGGTGGTGTCCATCTACGGGAGCTGCTTGGACGTGGAGCTGCAGCAGCGGGCTGTGGAGTATGACACACTCTTCCGGAAA
TACGACCACATGAGGGCTGCCATCCTGGAAAAAATGCCTCTTGTGGAGCGAGATGGCCCTCAGGCTGATGAGGAAGCAAAGGAAAGCAAA
GAAGCAGCCCAGCTTTCAGAAGCAGCCCCAGTGCCCACAGAGCCCCAGGCCTCACAGCTCCTGGATCTGCTAGATCTCCTGGATGGGGCT
TCTGGGGATGTCCAGCATCCTCCCCATCTGGACCCCTCCCCAGGAGGTGCCCTGGTACACCTGCTTGACCTTCCCTGTGTACCTCCACCC
CCAGCTCCCATCCCAGATCTCAAAGTGTTTGAGCGTGAGGGAGTACAGCTGAATCTGTCTTTCATTCGACCCCCTGAAAACCCTGCTTTG
CTGTTAATCACCATCACTGCCACCAACTTCTCAGAGGGTGATGTCACCCATTTCATCTGCCAGGCTGCTGTGCCCAAGAGTCTCCAGCTG
CAGCTGCAGGCCCCCAGTGGGAACACAGTTCCAGCTCGGGGTGGCCTTCCTATCACCCAGCTCTTCAGAATCCTCAATCCTAACAAGGCC
CCCCTGCGGCTAAAGCTGCGCCTCACCTACGACCACTTTCACCAGTCGGTGCAGGAGATCTTTGAGGTGAACAACTTGCCTGTGGAATCG
TGGCAGTAACTGTCTCCACTCACAGCCTGAAATTCTCCTGTGTCCCAAACCCCAGGGGGCCCCAGCAGCTTCGAACCTACACCTGAGGGC
TACCAGCAGGTGGCGCTCTGGCTTTGCACTGCAAAAACTGGGGACCAGCCCCCTTCTCCCACAAATAAAGCCCAATAAAGCCTGAGAAGT


Top

FusionGenePPI for PSME1_AP1G2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PSME1PSME2, EMD, USP22, PFDN1, PSME1, VCL, VIM, CHD3, EIF6, TUBB4B, ATP1B1, RPP14, AIMP2, TK1, CDC37, SMN1, SETDB1, PIK3R3, PSMA1, PSMC5, PSMA6, PSMC1, PSMA2, TUBG1, GRB2, PSMB6, PSMB9, PSMA4, PSMD6, PSMB7, PSMB8, PSMB10, APP, PSMB1, PSMB2, PSMC4, PSMA3, PSMD1, PSMC2, PSMB3, PSMA7, PSMD12, RBBP6, UBL7, OXCT1, PSRC1, USP5, PHPT1, PRDX3, CSE1L, PARVB, NUBP2, PARK2, BAG3, KIF5B, PSMD14, ADRM1, SHFM1, NAA10, HUWE1, CTRL, PSMB4, DDX19B, RNF26, CYP1A1, GARS, PAK2, SCLT1, MCM2, U2AF2, FBXO7, PPP1CC, CDK15, GPX7, GJB4, PSMG2AP1G2AP1S1, AP1S2, XRN1, SYNRG, NEDD4, ATXN1L, EGFR, KDM1A, PRMT6, CENPK, SYNE4, AAGAB, AP1M2, AP2M1, IST1, RABEP1, XPO1, RBM14-RBM4, THBS2, IL27RA, TMX3, ZYG11B, ATG2B, ZNF318, RBM3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PSME1_AP1G2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PSME1_AP1G2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePSME1C0019693HIV Infections1CTD_human
HgenePSME1C0024667Animal Mammary Neoplasms1CTD_human
HgenePSME1C0024668Mammary Neoplasms, Experimental1CTD_human
HgenePSME1C0279626Squamous cell carcinoma of esophagus1CTD_human