FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 29066

FusionGeneSummary for PSAT1_DAB2IP

check button Fusion gene summary
Fusion gene informationFusion gene name: PSAT1_DAB2IP
Fusion gene ID: 29066
HgeneTgene
Gene symbol

PSAT1

DAB2IP

Gene ID

29968

153090

Gene namephosphoserine aminotransferase 1DAB2 interacting protein
SynonymsEPIP|NLS2|PSA|PSAT|PSATDAF9Q34|AIP-1|AIP1|DIP1/2
Cytomap

9q21.2

9q33.2

Type of geneprotein-codingprotein-coding
Descriptionphosphoserine aminotransferaseendometrial progesterone-induced proteinphosphohydroxythreonine aminotransferasedisabled homolog 2-interacting proteinASK-interacting protein 1ASK1-interacting protein 1DAB2 interaction proteinDOC-2/DAB2 interactive proteinnGAP-like protein
Modification date2018052320180522
UniProtAcc

Q9Y617

Q5VWQ8

Ensembl transtripts involved in fusion geneENST00000347159, ENST00000376588, 
ENST00000259371, ENST00000408936, 
ENST00000309989, ENST00000487716, 
Fusion gene scores* DoF score3 X 3 X 3=279 X 9 X 3=243
# samples 310
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(10/243*10)=-1.28095631383106
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PSAT1 [Title/Abstract] AND DAB2IP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDAB2IP

GO:0000122

negative regulation of transcription by RNA polymerase II

15310755

TgeneDAB2IP

GO:0000185

activation of MAPKKK activity

19903888

TgeneDAB2IP

GO:0007257

activation of JUN kinase activity

12813029

TgeneDAB2IP

GO:0008285

negative regulation of cell proliferation

19903888

TgeneDAB2IP

GO:0010719

negative regulation of epithelial to mesenchymal transition

20154697

TgeneDAB2IP

GO:0014067

negative regulation of phosphatidylinositol 3-kinase signaling

19903888

TgeneDAB2IP

GO:0016525

negative regulation of angiogenesis

19033661

TgeneDAB2IP

GO:0034144

negative regulation of toll-like receptor 4 signaling pathway

19948740

TgeneDAB2IP

GO:0035924

cellular response to vascular endothelial growth factor stimulus

19033661

TgeneDAB2IP

GO:0043065

positive regulation of apoptotic process

17389591|19903888

TgeneDAB2IP

GO:0043124

negative regulation of I-kappaB kinase/NF-kappaB signaling

15310755|17389591

TgeneDAB2IP

GO:0043254

regulation of protein complex assembly

19948740

TgeneDAB2IP

GO:0043407

negative regulation of MAP kinase activity

12813029

TgeneDAB2IP

GO:0043410

positive regulation of MAPK cascade

19903888

TgeneDAB2IP

GO:0043497

regulation of protein heterodimerization activity

18281285

TgeneDAB2IP

GO:0043507

positive regulation of JUN kinase activity

15310755

TgeneDAB2IP

GO:0043553

negative regulation of phosphatidylinositol 3-kinase activity

19903888

TgeneDAB2IP

GO:0044257

cellular protein catabolic process

17389591

TgeneDAB2IP

GO:0045944

positive regulation of transcription by RNA polymerase II

15310755|17389591

TgeneDAB2IP

GO:0046330

positive regulation of JNK cascade

17389591|19903888

TgeneDAB2IP

GO:0070317

negative regulation of G0 to G1 transition

19903888

TgeneDAB2IP

GO:0070373

negative regulation of ERK1 and ERK2 cascade

19903888

TgeneDAB2IP

GO:0071158

positive regulation of cell cycle arrest

19903888

TgeneDAB2IP

GO:0071222

cellular response to lipopolysaccharide

19948740

TgeneDAB2IP

GO:0071347

cellular response to interleukin-1

19948740

TgeneDAB2IP

GO:0071356

cellular response to tumor necrosis factor

12813029|15310755|17389591

TgeneDAB2IP

GO:0071901

negative regulation of protein serine/threonine kinase activity

19903888

TgeneDAB2IP

GO:0071902

positive regulation of protein serine/threonine kinase activity

19903888

TgeneDAB2IP

GO:1903363

negative regulation of cellular protein catabolic process

19903888

TgeneDAB2IP

GO:2001235

positive regulation of apoptotic signaling pathway

19903888


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A1KZ-01APSAT1chr9

80919856

+DAB2IPchr9

124440957

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000347159ENST00000259371PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
In-frameENST00000347159ENST00000408936PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
5CDS-intronENST00000347159ENST00000309989PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
5CDS-intronENST00000347159ENST00000487716PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
In-frameENST00000376588ENST00000259371PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
In-frameENST00000376588ENST00000408936PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
5CDS-intronENST00000376588ENST00000309989PSAT1chr9

80919856

+DAB2IPchr9

124440957

+
5CDS-intronENST00000376588ENST00000487716PSAT1chr9

80919856

+DAB2IPchr9

124440957

+

Top

FusionProtFeatures for PSAT1_DAB2IP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PSAT1

Q9Y617

DAB2IP

Q5VWQ8

Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.{ECO:0000250|UniProtKB:P10658}. Functions as a scaffold protein implicated in theregulation of a large spectrum of both general and specializedsignaling pathways. Involved in several processes such as innateimmune response, inflammation and cell growth inhibition,apoptosis, cell survival, angiogenesis, cell migration andmaturation. Plays also a role in cell cycle checkpoint control;reduces G1 phase cyclin levels resulting in G0/G1 cell cyclearrest. Mediates signal transduction by receptor-mediatedinflammatory signals, such as the tumor necrosis factor (TNF),interferon (IFN) or lipopolysaccharide (LPS). Modulates thebalance between phosphatidylinositol 3-kinase (PI3K)-AKT-mediatedcell survival and apoptosis stimulated kinase (MAP3K5)-JNKsignaling pathways; sequesters both AKT1 and MAP3K5 andcounterbalances the activity of each kinase by modulating theirphosphorylation status in response to proinflammatory stimuli.Acts as a regulator of the endoplasmic reticulum (ER) unfoldedprotein response (UPR) pathway; specifically involved intransduction of the ER stress-response to the JNK cascade throughERN1. Mediates TNF-alpha-induced apoptosis activation byfacilitating dissociation of inhibitor 14-3-3 from MAP3K5;recruits the PP2A phosphatase complex which dephosphorylatesMAP3K5 on 'Ser-966', leading to the dissociation of 13-3-3proteins and activation of the MAP3K5-JNK signaling pathway inendothelial cells. Mediates also TNF/TRAF2-induced MAP3K5-JNKactivation, while it inhibits CHUK-NF-kappa-B signaling. Acts anegative regulator in the IFN-gamma-mediated JAK-STAT signalingcascade by inhibiting smooth muscle cell (VSMCs) proliferation andintimal expansion, and thus, prevents graft arteriosclerosis (GA).Acts as a GTPase-activating protein (GAP) for the ADP ribosylationfactor 6 (ARF6) and Ras. Promotes hydrolysis of the ARF6-bound GTPand thus, negatively regulates phosphatidylinositol 4,5-bisphosphate (PIP2)-dependent TLR4-TIRAP-MyD88 and NF-kappa-Bsignaling pathways in endothelial cells in response tolipopolysaccharides (LPS). Binds specifically tophosphatidylinositol 4-phosphate (PtdIns4P) andphosphatidylinositol 3-phosphate (PtdIns3P). In response tovascular endothelial growth factor (VEGFA), acts as a negativeregulator of the VEGFR2-PI3K-mediated angiogenic signaling pathwayby inhibiting endothelial cell migration and tube formation. Inthe developing brain, promotes both the transition from themultipolar to the bipolar stage and the radial migration ofcortical neurons from the ventricular zone toward the superficiallayer of the neocortex in a glial-dependent locomotion process.Probable downstream effector of the Reelin signaling pathway;promotes Purkinje cell (PC) dendrites development and formation ofcerebellar synapses. Functions also as a tumor suppressor proteinin prostate cancer progression; prevents cell proliferation andepithelial-to-mesenchymal transition (EMT) through activation ofthe glycogen synthase kinase-3 beta (GSK3B)-induced beta-cateninand inhibition of PI3K-AKT and Ras-MAPK survival downstreamsignaling cascades, respectively. {ECO:0000269|PubMed:12813029,ECO:0000269|PubMed:17389591, ECO:0000269|PubMed:18292600,ECO:0000269|PubMed:19033661, ECO:0000269|PubMed:19903888,ECO:0000269|PubMed:19948740, ECO:0000269|PubMed:20080667,ECO:0000269|PubMed:20154697, ECO:0000269|PubMed:21700930,ECO:0000269|PubMed:22696229}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePSAT1chr9:80919856chr9:124440957ENST00000347159+4879_80132325RegionPyridoxal phosphate binding
HgenePSAT1chr9:80919856chr9:124440957ENST00000376588+4979_80132371RegionPyridoxal phosphate binding
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+0171026_1159131133Coiled coilOntology_term=ECO:0000255
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+0141026_1159-491066Coiled coilOntology_term=ECO:0000255
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+0161026_1159411190Coiled coilOntology_term=ECO:0000255
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017112_117131133Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017867_870131133Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017903_948131133Compositional biasNote=Pro-rich
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014112_117-491066Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014867_870-491066Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+0148_52-491066Compositional biasNote=Arg-rich
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014903_948-491066Compositional biasNote=Pro-rich
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016112_117411190Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016867_870411190Compositional biasNote=Poly-Ala
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016903_948411190Compositional biasNote=Pro-rich
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017101_202131133DomainPH
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017200_295131133DomainNote=C2
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+017371_563131133DomainRas-GAP
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014101_202-491066DomainPH
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014200_295-491066DomainNote=C2
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000309989+014371_563-491066DomainRas-GAP
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016101_202411190DomainPH
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016200_295411190DomainNote=C2
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+016371_563411190DomainRas-GAP

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePSAT1chr9:80919856chr9:124440957ENST00000347159+48241_242132325RegionPyridoxal phosphate binding
HgenePSAT1chr9:80919856chr9:124440957ENST00000376588+49241_242132371RegionPyridoxal phosphate binding
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000259371+0178_52131133Compositional biasNote=Arg-rich
TgeneDAB2IPchr9:80919856chr9:124440957ENST00000408936+0168_52411190Compositional biasNote=Arg-rich


Top

FusionGeneSequence for PSAT1_DAB2IP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_1252aa
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNTKVIFLQGGGCGQFSAVPLNL
IGLKAGRCADTVVTGAWSAKAAEEAKKFGTINIVHPKLGSTTKSPQERPGSRRSLPGSLSEKSPSMEPSAATPFRVTGFLSRRLKGSIKR
TKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGS
KCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLTARTTGKLKTDNVFWGEHFEFHNLPPLR
TVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGL
CAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALTESD
ENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLL
QEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVS
QLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGV
QPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTT
PGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEK
GGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPELKPRAVHKQ
GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEETETLFKCQEETTQKLVLEYQA

>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_1281aa
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNTKVIFLQGGGCGQFSAVPLNL
IGLKAGRCADTVVTGAWSAKAAEEAKKFGTINIVHPKLGSTTKSPQERPGSRRSLPGSLSEKSPSMEPSAATPFRVTGFLSRRLKGSIKR
TKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGS
KCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLTARTTGKLKTDNVFWGEHFEFHNLPPLR
TVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGL
CAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALTESD
ENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLL
QEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVS
QLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGV
QPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTT
PGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEK
GGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPELKPRAVHKQ
GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEETETLFKCQEETTQKLVLEYQA
RLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGISP

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_1252aa
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNTKVIFLQGGGCGQFSAVPLNL
IGLKAGRCADTVVTGAWSAKAAEEAKKFGTINIVHPKLGSTTKSPQERPGSRRSLPGSLSEKSPSMEPSAATPFRVTGFLSRRLKGSIKR
TKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGS
KCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLTARTTGKLKTDNVFWGEHFEFHNLPPLR
TVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGL
CAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALTESD
ENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLL
QEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVS
QLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGV
QPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTT
PGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEK
GGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPELKPRAVHKQ
GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEETETLFKCQEETTQKLVLEYQA

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_1281aa
MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNTKVIFLQGGGCGQFSAVPLNL
IGLKAGRCADTVVTGAWSAKAAEEAKKFGTINIVHPKLGSTTKSPQERPGSRRSLPGSLSEKSPSMEPSAATPFRVTGFLSRRLKGSIKR
TKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGS
KCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLTARTTGKLKTDNVFWGEHFEFHNLPPLR
TVTVHLYRETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGL
CAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALTESD
ENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLL
QEYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPETLSNTAGFEGYIDLGRELSSLHSLLWEAVS
QLEQSIVSKLGPLPRILRDVHTALSTPGSGQLPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGV
QPSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQLVAGWPARATPVNLAGLATVRRAGQTPTT
PGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEK
GGQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDWVGPSTRLRQQSSSSKGDSPELKPRAVHKQ
GPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEETETLFKCQEETTQKLVLEYQA
RLEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQLKERYSMQARNGISP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_3756nt
ATGGACGCCCCCAGGCAGGTGGTCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTA
GACTACAAAGGAGTTGGCATTAGTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTG
CGGGAATTGCTAGCTGTTCCAGACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTC
ATTGGCTTGAAAGCAGGAAGGTGTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACT
ATAAATATCGTTCACCCTAAACTTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCC
GAGAAGAGCCCCAGCATGGAGCCCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGC
ACCAAGAGCCAGCCCAAGCTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAAT
GAGAGGTCCCATCTGATGCCGAGGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTC
AGCATGGAGGAAGAGGTGGTCATCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGC
AAGTGCTTTTCCTGCCGGTCTGCAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGG
CGTGTGGAGCACATCCTGAAGCTGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGAT
GTGCTCTATGCCCGCACCACGGGCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGC
ACGGTCACTGTCCACCTGTACCGGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCC
TCGGTGGCCGGGCGGCAGTTCGTGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGC
ATCAAGGCGCGCTACCAAACCATCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTG
TGTGCAGCCCTCGAGCCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTG
AAGGACTTCCTGACAGACCTGATGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACC
AAGGCCATTGAGGAGTACCTCAAGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGAT
GAGAACTGCGAAGTGGATCCCAGCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTC
TGCAAGATCATCAACTCCTACTGTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGC
CCGGACATCAGTGAGCGGCTCATCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTG
CAGGAGTACCCTGATGACCGCACTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGC
AAGGAGGAATACATGTCCTTCATGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAG
ACCCTCTCCAATACAGCCGGCTTCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGC
CAGCTGGAGCAGAGCATAGTATCCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGG
CAGCTCCCAGGGACCAATGACCTGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAAC
GATCTTTCCGGTCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTC
CAGCCCTCACCTGCCCGCAGCTCGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTG
GACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCT
CAGCTGGTGGCCGGGTGGCCGGCCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACA
CCAGGCACCTCCGAGGGCGCGCCAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTG
CCGCTGTCACCCCGTGGCCTTGGCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCT
GCCAAGCTGGGAAGTTTCAGCACTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAA
GGCGGGCAGCCCACGGTGCCACGGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCT
GCCCCCCGCGGCCGGACGCCCCCCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGAT
TGGGTGGGCCCCAGTACCCGCCTGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAG
GGCCCTTCACCTGTGAGCCCCAATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTG
GGCCCAGACCCCCCCCACAGGGATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTG
CGAATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCA
CGGCTGGAGGAGGGCGAGGAGCGGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTG
GAGGAAGAACTGAAGAAGGACCACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCC

>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_3843nt
ATGGACGCCCCCAGGCAGGTGGTCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTA
GACTACAAAGGAGTTGGCATTAGTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTG
CGGGAATTGCTAGCTGTTCCAGACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTC
ATTGGCTTGAAAGCAGGAAGGTGTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACT
ATAAATATCGTTCACCCTAAACTTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCC
GAGAAGAGCCCCAGCATGGAGCCCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGC
ACCAAGAGCCAGCCCAAGCTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAAT
GAGAGGTCCCATCTGATGCCGAGGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTC
AGCATGGAGGAAGAGGTGGTCATCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGC
AAGTGCTTTTCCTGCCGGTCTGCAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGG
CGTGTGGAGCACATCCTGAAGCTGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGAT
GTGCTCTATGCCCGCACCACGGGCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGC
ACGGTCACTGTCCACCTGTACCGGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCC
TCGGTGGCCGGGCGGCAGTTCGTGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGC
ATCAAGGCGCGCTACCAAACCATCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTG
TGTGCAGCCCTCGAGCCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTG
AAGGACTTCCTGACAGACCTGATGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACC
AAGGCCATTGAGGAGTACCTCAAGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGAT
GAGAACTGCGAAGTGGATCCCAGCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTC
TGCAAGATCATCAACTCCTACTGTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGC
CCGGACATCAGTGAGCGGCTCATCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTG
CAGGAGTACCCTGATGACCGCACTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGC
AAGGAGGAATACATGTCCTTCATGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAG
ACCCTCTCCAATACAGCCGGCTTCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGC
CAGCTGGAGCAGAGCATAGTATCCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGG
CAGCTCCCAGGGACCAATGACCTGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAAC
GATCTTTCCGGTCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTC
CAGCCCTCACCTGCCCGCAGCTCGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTG
GACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCT
CAGCTGGTGGCCGGGTGGCCGGCCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACA
CCAGGCACCTCCGAGGGCGCGCCAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTG
CCGCTGTCACCCCGTGGCCTTGGCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCT
GCCAAGCTGGGAAGTTTCAGCACTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAA
GGCGGGCAGCCCACGGTGCCACGGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCT
GCCCCCCGCGGCCGGACGCCCCCCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGAT
TGGGTGGGCCCCAGTACCCGCCTGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAG
GGCCCTTCACCTGTGAGCCCCAATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTG
GGCCCAGACCCCCCCCACAGGGATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTG
CGAATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCA
CGGCTGGAGGAGGGCGAGGAGCGGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTG
GAGGAAGAACTGAAGAAGGACCACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCC
TCGTTGGATGCCGCCAATGCCCGCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCATCTCCCCC

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_3756nt
ATGGACGCCCCCAGGCAGGTGGTCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTA
GACTACAAAGGAGTTGGCATTAGTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTG
CGGGAATTGCTAGCTGTTCCAGACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTC
ATTGGCTTGAAAGCAGGAAGGTGTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACT
ATAAATATCGTTCACCCTAAACTTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCC
GAGAAGAGCCCCAGCATGGAGCCCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGC
ACCAAGAGCCAGCCCAAGCTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAAT
GAGAGGTCCCATCTGATGCCGAGGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTC
AGCATGGAGGAAGAGGTGGTCATCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGC
AAGTGCTTTTCCTGCCGGTCTGCAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGG
CGTGTGGAGCACATCCTGAAGCTGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGAT
GTGCTCTATGCCCGCACCACGGGCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGC
ACGGTCACTGTCCACCTGTACCGGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCC
TCGGTGGCCGGGCGGCAGTTCGTGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGC
ATCAAGGCGCGCTACCAAACCATCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTG
TGTGCAGCCCTCGAGCCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTG
AAGGACTTCCTGACAGACCTGATGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACC
AAGGCCATTGAGGAGTACCTCAAGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGAT
GAGAACTGCGAAGTGGATCCCAGCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTC
TGCAAGATCATCAACTCCTACTGTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGC
CCGGACATCAGTGAGCGGCTCATCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTG
CAGGAGTACCCTGATGACCGCACTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGC
AAGGAGGAATACATGTCCTTCATGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAG
ACCCTCTCCAATACAGCCGGCTTCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGC
CAGCTGGAGCAGAGCATAGTATCCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGG
CAGCTCCCAGGGACCAATGACCTGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAAC
GATCTTTCCGGTCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTC
CAGCCCTCACCTGCCCGCAGCTCGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTG
GACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCT
CAGCTGGTGGCCGGGTGGCCGGCCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACA
CCAGGCACCTCCGAGGGCGCGCCAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTG
CCGCTGTCACCCCGTGGCCTTGGCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCT
GCCAAGCTGGGAAGTTTCAGCACTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAA
GGCGGGCAGCCCACGGTGCCACGGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCT
GCCCCCCGCGGCCGGACGCCCCCCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGAT
TGGGTGGGCCCCAGTACCCGCCTGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAG
GGCCCTTCACCTGTGAGCCCCAATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTG
GGCCCAGACCCCCCCCACAGGGATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTG
CGAATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCA
CGGCTGGAGGAGGGCGAGGAGCGGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTG
GAGGAAGAACTGAAGAAGGACCACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCC

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_3843nt
ATGGACGCCCCCAGGCAGGTGGTCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTA
GACTACAAAGGAGTTGGCATTAGTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTG
CGGGAATTGCTAGCTGTTCCAGACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTC
ATTGGCTTGAAAGCAGGAAGGTGTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACT
ATAAATATCGTTCACCCTAAACTTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCC
GAGAAGAGCCCCAGCATGGAGCCCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGC
ACCAAGAGCCAGCCCAAGCTGGACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAAT
GAGAGGTCCCATCTGATGCCGAGGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTC
AGCATGGAGGAAGAGGTGGTCATCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGC
AAGTGCTTTTCCTGCCGGTCTGCAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGG
CGTGTGGAGCACATCCTGAAGCTGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGAT
GTGCTCTATGCCCGCACCACGGGCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGC
ACGGTCACTGTCCACCTGTACCGGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCC
TCGGTGGCCGGGCGGCAGTTCGTGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGC
ATCAAGGCGCGCTACCAAACCATCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTG
TGTGCAGCCCTCGAGCCCATCCTCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTG
AAGGACTTCCTGACAGACCTGATGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACC
AAGGCCATTGAGGAGTACCTCAAGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGAT
GAGAACTGCGAAGTGGATCCCAGCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTC
TGCAAGATCATCAACTCCTACTGTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGC
CCGGACATCAGTGAGCGGCTCATCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTG
CAGGAGTACCCTGATGACCGCACTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGC
AAGGAGGAATACATGTCCTTCATGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAG
ACCCTCTCCAATACAGCCGGCTTCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGC
CAGCTGGAGCAGAGCATAGTATCCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGG
CAGCTCCCAGGGACCAATGACCTGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAAC
GATCTTTCCGGTCTGATAGATTTCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTC
CAGCCCTCACCTGCCCGCAGCTCGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTG
GACCTCCAGGACGCCCGCACGCTGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCT
CAGCTGGTGGCCGGGTGGCCGGCCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACA
CCAGGCACCTCCGAGGGCGCGCCAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTG
CCGCTGTCACCCCGTGGCCTTGGCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCT
GCCAAGCTGGGAAGTTTCAGCACTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAA
GGCGGGCAGCCCACGGTGCCACGGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCT
GCCCCCCGCGGCCGGACGCCCCCCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGAT
TGGGTGGGCCCCAGTACCCGCCTGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAG
GGCCCTTCACCTGTGAGCCCCAATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTG
GGCCCAGACCCCCCCCACAGGGATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTG
CGAATCTCCACCAAGAAGCTGGAGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCA
CGGCTGGAGGAGGGCGAGGAGCGGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTG
GAGGAAGAACTGAAGAAGGACCACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCC
TCGTTGGATGCCGCCAATGCCCGCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCATCTCCCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_5807nt
GGCCAGGAACGCCAGCCGTTCACGCGTTCGGTCCTCCTTGGCTGACTCACCGCCCTGGCCGCCGCACCATGGACGCCCCCAGGCAGGTGG
TCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTAGACTACAAAGGAGTTGGCATTA
GTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTGCGGGAATTGCTAGCTGTTCCAG
ACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTCATTGGCTTGAAAGCAGGAAGGT
GTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACTATAAATATCGTTCACCCTAAAC
TTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCCGAGAAGAGCCCCAGCATGGAGC
CCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAGCTGG
ACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAATGAGAGGTCCCATCTGATGCCGA
GGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTCAGCATGGAGGAAGAGGTGGTCA
TCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGCAAGTGCTTTTCCTGCCGGTCTG
CAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGGCGTGTGGAGCACATCCTGAAGC
TGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGATGTGCTCTATGCCCGCACCACGG
GCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGCACGGTCACTGTCCACCTGTACC
GGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCCTCGGTGGCCGGGCGGCAGTTCG
TGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGCATCAAGGCGCGCTACCAAACCA
TCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTGTGTGCAGCCCTCGAGCCCATCC
TCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTGAAGGACTTCCTGACAGACCTGA
TGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATTGAGGAGTACCTCA
AGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGATGAGAACTGCGAAGTGGATCCCA
GCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTCTGCAAGATCATCAACTCCTACT
GTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGCCCGGACATCAGTGAGCGGCTCA
TCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTGCAGGAGTACCCTGATGACCGCA
CTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGCAAGGAGGAATACATGTCCTTCA
TGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAGACCCTCTCCAATACAGCCGGCT
TCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGCCAGCTGGAGCAGAGCATAGTAT
CCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGGCAGCTCCCAGGGACCAATGACC
TGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAACGATCTTTCCGGTCTGATAGATT
TCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCCTCACCTGCCCGCAGCT
CGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTGGACCTCCAGGACGCCCGCACGC
TGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCTCAGCTGGTGGCCGGGTGGCCGG
CCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACACCAGGCACCTCCGAGGGCGCGC
CAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTGCCGCTGTCACCCCGTGGCCTTG
GCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCTGCCAAGCTGGGAAGTTTCAGCA
CTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAAGGCGGGCAGCCCACGGTGCCAC
GGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCTGCCCCCCGCGGCCGGACGCCCC
CCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGATTGGGTGGGCCCCAGTACCCGCC
TGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAGGGCCCTTCACCTGTGAGCCCCA
ATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTGGGCCCAGACCCCCCCCACAGGG
ATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTGCGAATCTCCACCAAGAAGCTGG
AGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCACGGCTGGAGGAGGGCGAGGAGC
GGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTGGAGGAAGAACTGAAGAAGGACC
ACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCCTCGTTGGATGCCGCCAATGCCC
GCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTA
AGTTGAGCGTGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCTGCCC
CGTGTGTGTGGCCGGCCTCCTCCTCACCCTTCCCGGCCCCCGGCCAAGGACCCAGGCGCTGCATACAGGGGAGGGGCGCACCCCACAGCT
GGGGCCGGTTTTCCTCAGCTCTAGGCTGTTCTGTAGCTTATCTGCCCCTCCCCCACTTTCAAGACAGATGAGCAGGAGCTTGGGTCTCTC
TCGGCCCCTGTCTGTTCCCAGCCCCTGCAGATTCTGAGCAAAGGCCCTGGGTAAGAAGGGTGGGAGTGGGGCCTTTGCCAGCAGAGCCAG
GGCAGGGCGAGCTGCAGGAATCACCCCTCTGCCCCTGCAGCTGGAATGTGCCACAGAGGCCCCACCTGAAGGGTGGATGTGCTGGAGGGG
TGGCCCAGAGCCATACTGCGTCCACCCTGAGCTCGGGGACAGGTGACAGTGGCTGCTCTGGGAAGGGGCTTTTAGATGTAACCTACAATT
CAGTTAGGCTAGAGACAGATGCTGGTGGAGGAAGGGCTGGGCCACCAGGGATCACAGACCACAGGAAGATGGGAGGTGGAAGCAGAGGCC
CTGCCCCCACCCCTTCCTGTCTCACTCTTCTGTCTTGTCCCCACCCATGCGCCTTCGTGCCTGAGACCAGGGTGGCCACACAGGCAGGGC
CTGGCTCCAGTCTCATCCTCCCATTGCCCAGTGAGCCCTGCTCTTCTCTCCCCAGCCCCCTCCCACCGCTGCCTCGTAGAGTGACCTCGG
ACAGAGCCCCCCTAGCAATACAGGGAGGCTCCCGGGGCCTGGACAGGCGGGCTCGGAGGCTACCCGCTGTGGCCGGTGCCAGCTGCCCTT
GCAGGGTGGGTGAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTTCACAGATTTTTATCTTA
ATTGCAAGTCTGCCGATTTTGTAAATGTTCTTGGTGTTTGACTGTAATGTAACTATCTCACCTAATGGTTGTACATATCCTTTGGTCCTG
GTGCTGCCGAGGGCTGGCCGGGACTGCTGCTCTCCCAAGGGTTTTATTTTATTTCTGAATCTAGAGAACAGTATTGGGCAGGAGGAAAAG
GCTTGGTGTCTGCGGGGGGTGTCTTCCCTGCCTGTGGCATTTGTGTGTTGGCTTTGCAGCTGCTGTCTGAGTAGTGGCCACTGGGGTGCC
TTCACTGGGCCAGTCAACGGGGGGCTCCTGCCCAGGCCACAGAGAACCTGAGTTCCCGGGAGCTGGGCCCTGCCTGCAGCCAGGGCTGGG
GTTGCCAGAGGCCCTGGAGGGAAGGACAGTCCCTGCTGGGGAAGAACAGCCCCGGGGCCCCCTGGTCACCGAGACTCAGCCTCTGCTGGA
GAAAGCCACGCCCTCCCTGCTAGCACAGAGGCCTGACTGACTTTTTTGCTTAACTTCCATGTTCTGGGTGATGGAAACTGCCAAACCTCC
TGTCAGTGAGGACTCTTTCCGACTGCCCAGAAAGTGGGGGTGGAGGACCGAGGCTACAGCTCCACACGCCCCGGTCCCCCAGAGCATCTG
CCCCAGGTACACCTCCCCCTGCGCCCCGCACGACTGCGGGAGCCAGACTGTCCAGGGAAACAGCCTCTCTCTTTTCTACACACTCAGCCA
CAAAGCCCCCCAGCTCCCACACCGCGTCCCAGCTCCCCTCTTTTGTAAGTATGTGAAAAGGAAAAAATGCAAACGTTGGAGTTTGGGCTG
GAGCTCCTCCCTCCAGCTGCGACTTTTAACTATGTAATAATGTACAGAGGAAGCTGTTGGTGTTCTAAGACTCTGTGTGGCTGTGCAATT

>In-frame_PSAT1_ENST00000347159_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_6943nt
GGCCAGGAACGCCAGCCGTTCACGCGTTCGGTCCTCCTTGGCTGACTCACCGCCCTGGCCGCCGCACCATGGACGCCCCCAGGCAGGTGG
TCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTAGACTACAAAGGAGTTGGCATTA
GTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTGCGGGAATTGCTAGCTGTTCCAG
ACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTCATTGGCTTGAAAGCAGGAAGGT
GTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACTATAAATATCGTTCACCCTAAAC
TTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCCGAGAAGAGCCCCAGCATGGAGC
CCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAGCTGG
ACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAATGAGAGGTCCCATCTGATGCCGA
GGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTCAGCATGGAGGAAGAGGTGGTCA
TCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGCAAGTGCTTTTCCTGCCGGTCTG
CAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGGCGTGTGGAGCACATCCTGAAGC
TGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGATGTGCTCTATGCCCGCACCACGG
GCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGCACGGTCACTGTCCACCTGTACC
GGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCCTCGGTGGCCGGGCGGCAGTTCG
TGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGCATCAAGGCGCGCTACCAAACCA
TCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTGTGTGCAGCCCTCGAGCCCATCC
TCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTGAAGGACTTCCTGACAGACCTGA
TGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATTGAGGAGTACCTCA
AGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGATGAGAACTGCGAAGTGGATCCCA
GCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTCTGCAAGATCATCAACTCCTACT
GTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGCCCGGACATCAGTGAGCGGCTCA
TCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTGCAGGAGTACCCTGATGACCGCA
CTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGCAAGGAGGAATACATGTCCTTCA
TGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAGACCCTCTCCAATACAGCCGGCT
TCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGCCAGCTGGAGCAGAGCATAGTAT
CCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGGCAGCTCCCAGGGACCAATGACC
TGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAACGATCTTTCCGGTCTGATAGATT
TCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCCTCACCTGCCCGCAGCT
CGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTGGACCTCCAGGACGCCCGCACGC
TGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCTCAGCTGGTGGCCGGGTGGCCGG
CCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACACCAGGCACCTCCGAGGGCGCGC
CAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTGCCGCTGTCACCCCGTGGCCTTG
GCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCTGCCAAGCTGGGAAGTTTCAGCA
CTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAAGGCGGGCAGCCCACGGTGCCAC
GGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCTGCCCCCCGCGGCCGGACGCCCC
CCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGATTGGGTGGGCCCCAGTACCCGCC
TGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAGGGCCCTTCACCTGTGAGCCCCA
ATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTGGGCCCAGACCCCCCCCACAGGG
ATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTGCGAATCTCCACCAAGAAGCTGG
AGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCACGGCTGGAGGAGGGCGAGGAGC
GGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTGGAGGAAGAACTGAAGAAGGACC
ACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCCTCGTTGGATGCCGCCAATGCCC
GCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCATCTCCCCCACCAACCCCACCAAATTGCAGA
TTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGGGAGGAAGCTACCCAAGGAGAGGGGGACTATGGTGG
CCAAGGGCAGGGTCTCGGCCTGGGGAGGCACCCACGGTTGCAGCCCCAGCGCGGGTGTCAGGAGGCCGAGCCTCCCCTCCCTGCCGCTGT
CCAGGAGGCGGCCGCAGAGGGAGCCACCAGAGACTGAAGCAGCGTGAGGCGAGGTCACCAGCCGCTCCCTGTGGGGTGCGGGCAGAAGAG
ACTGCACGCTGGGGAGTGGGGACAGCCTGATGGGGCAGGGGGCCTGCCAAAAATATGTCTGTTGGTTCCTGAATGTGGTGTGTCCTTGTC
CTCCTGGATCTGGCCGAGTGCATGTGTCCCCCCACACCTGTGCCAGGGAGGGGGCTTCCTGGAGGGGGGATTCAAGGGCTAGGGGCCTAC
ACCTGTGGCTTCCCCTCGCCTCCTTGGGGGGCCCGGGACTCCCTGGCAGCCAGGCCCTGTCATGTGGGACCTGGCACTTGGCAGATCAGT
TGGCAGGCAGGAAGATAGGAGGACACAGAGCAGGAGGTCAGTGTCCCCTGCCTGTCTCCATCCGAAGCACCTGCCACTGCATGCAGCCTG
TTGGGACCTTCCTGGCTGTGAGGAACTGAGGATTCCTACCCACCCACCCCCTCTGAACCTGTCCCCAGAGCACCACCTGCTACCTTCTTC
CCTGCCTTAGTTGTATTGCCAGATAGACCCAGTGAGGGCCATGGCTTTTTCTTGTGAGCTCTTGTCCCTGTGGGGAGGACCCACAGCTTC
CCACACCTCCCACACAGGCCCAGGCTGATGCTCTAGGGCTCCCAGAAGCCAGAGATCTGGGCGGATCTGGCCAGATGGCTCTGAGCACTG
TATCTGCCTTCTCCTGGGGCCCAGCACACCCAGGGCACAGTGGTCCTGTAGGGAGTGCCACCTGGTGCTCACCCTGAAAGAAAAGGTGAT
CCTTCCTCTGAGTGATGGTTTAAAAAAAGATTCTAACGCCTGCAGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTA
TGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAGTTGAGCGTGCGCACTGCATGGGAAATAGCGGCCC
TGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCTGCCCCGTGTGTGTGGCCGGCCTCCTCCTCACCCTTCCCGG
CCCCCGGCCAAGGACCCAGGCGCTGCATACAGGGGAGGGGCGCACCCCACAGCTGGGGCCGGTTTTCCTCAGCTCTAGGCTGTTCTGTAG
CTTATCTGCCCCTCCCCCACTTTCAAGACAGATGAGCAGGAGCTTGGGTCTCTCTCGGCCCCTGTCTGTTCCCAGCCCCTGCAGATTCTG
AGCAAAGGCCCTGGGTAAGAAGGGTGGGAGTGGGGCCTTTGCCAGCAGAGCCAGGGCAGGGCGAGCTGCAGGAATCACCCCTCTGCCCCT
GCAGCTGGAATGTGCCACAGAGGCCCCACCTGAAGGGTGGATGTGCTGGAGGGGTGGCCCAGAGCCATACTGCGTCCACCCTGAGCTCGG
GGACAGGTGACAGTGGCTGCTCTGGGAAGGGGCTTTTAGATGTAACCTACAATTCAGTTAGGCTAGAGACAGATGCTGGTGGAGGAAGGG
CTGGGCCACCAGGGATCACAGACCACAGGAAGATGGGAGGTGGAAGCAGAGGCCCTGCCCCCACCCCTTCCTGTCTCACTCTTCTGTCTT
GTCCCCACCCATGCGCCTTCGTGCCTGAGACCAGGGTGGCCACACAGGCAGGGCCTGGCTCCAGTCTCATCCTCCCATTGCCCAGTGAGC
CCTGCTCTTCTCTCCCCAGCCCCCTCCCACCGCTGCCTCGTAGAGTGACCTCGGACAGAGCCCCCCTAGCAATACAGGGAGGCTCCCGGG
GCCTGGACAGGCGGGCTCGGAGGCTACCCGCTGTGGCCGGTGCCAGCTGCCCTTGCAGGGTGGGTGAGCTCTCAGGCCGAGAGCCTTATT
TACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTTCACAGATTTTTATCTTAATTGCAAGTCTGCCGATTTTGTAAATGTTCTTGGTG
TTTGACTGTAATGTAACTATCTCACCTAATGGTTGTACATATCCTTTGGTCCTGGTGCTGCCGAGGGCTGGCCGGGACTGCTGCTCTCCC
AAGGGTTTTATTTTATTTCTGAATCTAGAGAACAGTATTGGGCAGGAGGAAAAGGCTTGGTGTCTGCGGGGGGTGTCTTCCCTGCCTGTG
GCATTTGTGTGTTGGCTTTGCAGCTGCTGTCTGAGTAGTGGCCACTGGGGTGCCTTCACTGGGCCAGTCAACGGGGGGCTCCTGCCCAGG
CCACAGAGAACCTGAGTTCCCGGGAGCTGGGCCCTGCCTGCAGCCAGGGCTGGGGTTGCCAGAGGCCCTGGAGGGAAGGACAGTCCCTGC
TGGGGAAGAACAGCCCCGGGGCCCCCTGGTCACCGAGACTCAGCCTCTGCTGGAGAAAGCCACGCCCTCCCTGCTAGCACAGAGGCCTGA
CTGACTTTTTTGCTTAACTTCCATGTTCTGGGTGATGGAAACTGCCAAACCTCCTGTCAGTGAGGACTCTTTCCGACTGCCCAGAAAGTG
GGGGTGGAGGACCGAGGCTACAGCTCCACACGCCCCGGTCCCCCAGAGCATCTGCCCCAGGTACACCTCCCCCTGCGCCCCGCACGACTG
CGGGAGCCAGACTGTCCAGGGAAACAGCCTCTCTCTTTTCTACACACTCAGCCACAAAGCCCCCCAGCTCCCACACCGCGTCCCAGCTCC
CCTCTTTTGTAAGTATGTGAAAAGGAAAAAATGCAAACGTTGGAGTTTGGGCTGGAGCTCCTCCCTCCAGCTGCGACTTTTAACTATGTA
ATAATGTACAGAGGAAGCTGTTGGTGTTCTAAGACTCTGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTAT

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000259371_chr9_124440957_+_5807nt
GGCCAGGAACGCCAGCCGTTCACGCGTTCGGTCCTCCTTGGCTGACTCACCGCCCTGGCCGCCGCACCATGGACGCCCCCAGGCAGGTGG
TCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTAGACTACAAAGGAGTTGGCATTA
GTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTGCGGGAATTGCTAGCTGTTCCAG
ACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTCATTGGCTTGAAAGCAGGAAGGT
GTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACTATAAATATCGTTCACCCTAAAC
TTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCCGAGAAGAGCCCCAGCATGGAGC
CCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAGCTGG
ACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAATGAGAGGTCCCATCTGATGCCGA
GGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTCAGCATGGAGGAAGAGGTGGTCA
TCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGCAAGTGCTTTTCCTGCCGGTCTG
CAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGGCGTGTGGAGCACATCCTGAAGC
TGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGATGTGCTCTATGCCCGCACCACGG
GCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGCACGGTCACTGTCCACCTGTACC
GGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCCTCGGTGGCCGGGCGGCAGTTCG
TGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGCATCAAGGCGCGCTACCAAACCA
TCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTGTGTGCAGCCCTCGAGCCCATCC
TCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTGAAGGACTTCCTGACAGACCTGA
TGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATTGAGGAGTACCTCA
AGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGATGAGAACTGCGAAGTGGATCCCA
GCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTCTGCAAGATCATCAACTCCTACT
GTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGCCCGGACATCAGTGAGCGGCTCA
TCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTGCAGGAGTACCCTGATGACCGCA
CTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGCAAGGAGGAATACATGTCCTTCA
TGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAGACCCTCTCCAATACAGCCGGCT
TCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGCCAGCTGGAGCAGAGCATAGTAT
CCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGGCAGCTCCCAGGGACCAATGACC
TGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAACGATCTTTCCGGTCTGATAGATT
TCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCCTCACCTGCCCGCAGCT
CGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTGGACCTCCAGGACGCCCGCACGC
TGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCTCAGCTGGTGGCCGGGTGGCCGG
CCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACACCAGGCACCTCCGAGGGCGCGC
CAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTGCCGCTGTCACCCCGTGGCCTTG
GCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCTGCCAAGCTGGGAAGTTTCAGCA
CTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAAGGCGGGCAGCCCACGGTGCCAC
GGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCTGCCCCCCGCGGCCGGACGCCCC
CCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGATTGGGTGGGCCCCAGTACCCGCC
TGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAGGGCCCTTCACCTGTGAGCCCCA
ATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTGGGCCCAGACCCCCCCCACAGGG
ATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTGCGAATCTCCACCAAGAAGCTGG
AGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCACGGCTGGAGGAGGGCGAGGAGC
GGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTGGAGGAAGAACTGAAGAAGGACC
ACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCCTCGTTGGATGCCGCCAATGCCC
GCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGTATGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTA
AGTTGAGCGTGCGCACTGCATGGGAAATAGCGGCCCTGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCTGCCC
CGTGTGTGTGGCCGGCCTCCTCCTCACCCTTCCCGGCCCCCGGCCAAGGACCCAGGCGCTGCATACAGGGGAGGGGCGCACCCCACAGCT
GGGGCCGGTTTTCCTCAGCTCTAGGCTGTTCTGTAGCTTATCTGCCCCTCCCCCACTTTCAAGACAGATGAGCAGGAGCTTGGGTCTCTC
TCGGCCCCTGTCTGTTCCCAGCCCCTGCAGATTCTGAGCAAAGGCCCTGGGTAAGAAGGGTGGGAGTGGGGCCTTTGCCAGCAGAGCCAG
GGCAGGGCGAGCTGCAGGAATCACCCCTCTGCCCCTGCAGCTGGAATGTGCCACAGAGGCCCCACCTGAAGGGTGGATGTGCTGGAGGGG
TGGCCCAGAGCCATACTGCGTCCACCCTGAGCTCGGGGACAGGTGACAGTGGCTGCTCTGGGAAGGGGCTTTTAGATGTAACCTACAATT
CAGTTAGGCTAGAGACAGATGCTGGTGGAGGAAGGGCTGGGCCACCAGGGATCACAGACCACAGGAAGATGGGAGGTGGAAGCAGAGGCC
CTGCCCCCACCCCTTCCTGTCTCACTCTTCTGTCTTGTCCCCACCCATGCGCCTTCGTGCCTGAGACCAGGGTGGCCACACAGGCAGGGC
CTGGCTCCAGTCTCATCCTCCCATTGCCCAGTGAGCCCTGCTCTTCTCTCCCCAGCCCCCTCCCACCGCTGCCTCGTAGAGTGACCTCGG
ACAGAGCCCCCCTAGCAATACAGGGAGGCTCCCGGGGCCTGGACAGGCGGGCTCGGAGGCTACCCGCTGTGGCCGGTGCCAGCTGCCCTT
GCAGGGTGGGTGAGCTCTCAGGCCGAGAGCCTTATTTACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTTCACAGATTTTTATCTTA
ATTGCAAGTCTGCCGATTTTGTAAATGTTCTTGGTGTTTGACTGTAATGTAACTATCTCACCTAATGGTTGTACATATCCTTTGGTCCTG
GTGCTGCCGAGGGCTGGCCGGGACTGCTGCTCTCCCAAGGGTTTTATTTTATTTCTGAATCTAGAGAACAGTATTGGGCAGGAGGAAAAG
GCTTGGTGTCTGCGGGGGGTGTCTTCCCTGCCTGTGGCATTTGTGTGTTGGCTTTGCAGCTGCTGTCTGAGTAGTGGCCACTGGGGTGCC
TTCACTGGGCCAGTCAACGGGGGGCTCCTGCCCAGGCCACAGAGAACCTGAGTTCCCGGGAGCTGGGCCCTGCCTGCAGCCAGGGCTGGG
GTTGCCAGAGGCCCTGGAGGGAAGGACAGTCCCTGCTGGGGAAGAACAGCCCCGGGGCCCCCTGGTCACCGAGACTCAGCCTCTGCTGGA
GAAAGCCACGCCCTCCCTGCTAGCACAGAGGCCTGACTGACTTTTTTGCTTAACTTCCATGTTCTGGGTGATGGAAACTGCCAAACCTCC
TGTCAGTGAGGACTCTTTCCGACTGCCCAGAAAGTGGGGGTGGAGGACCGAGGCTACAGCTCCACACGCCCCGGTCCCCCAGAGCATCTG
CCCCAGGTACACCTCCCCCTGCGCCCCGCACGACTGCGGGAGCCAGACTGTCCAGGGAAACAGCCTCTCTCTTTTCTACACACTCAGCCA
CAAAGCCCCCCAGCTCCCACACCGCGTCCCAGCTCCCCTCTTTTGTAAGTATGTGAAAAGGAAAAAATGCAAACGTTGGAGTTTGGGCTG
GAGCTCCTCCCTCCAGCTGCGACTTTTAACTATGTAATAATGTACAGAGGAAGCTGTTGGTGTTCTAAGACTCTGTGTGGCTGTGCAATT

>In-frame_PSAT1_ENST00000376588_chr9_80919856_+_DAB2IP_ENST00000408936_chr9_124440957_+_6943nt
GGCCAGGAACGCCAGCCGTTCACGCGTTCGGTCCTCCTTGGCTGACTCACCGCCCTGGCCGCCGCACCATGGACGCCCCCAGGCAGGTGG
TCAACTTTGGGCCTGGTCCCGCCAAGCTGCCGCACTCAGTGTTGTTAGAGATACAAAAGGAATTATTAGACTACAAAGGAGTTGGCATTA
GTGTTCTTGAAATGAGTCACAGGTCATCAGATTTTGCCAAGATTATTAACAATACAGAGAATCTTGTGCGGGAATTGCTAGCTGTTCCAG
ACAACTATAAGGTGATTTTTCTGCAAGGAGGTGGGTGCGGCCAGTTCAGTGCTGTCCCCTTAAACCTCATTGGCTTGAAAGCAGGAAGGT
GTGCTGACTATGTGGTGACAGGAGCTTGGTCAGCTAAGGCCGCAGAAGAAGCCAAGAAGTTTGGGACTATAAATATCGTTCACCCTAAAC
TTGGGAGTTATACAAAGTCGCCTCAAGAAAGGCCGGGCTCTCGGCGCAGCCTGCCTGGCAGCCTTTCCGAGAAGAGCCCCAGCATGGAGC
CCTCGGCCGCCACGCCGTTCCGGGTCACGGGCTTCCTCAGCCGCCGCCTCAAGGGCTCCATCAAGCGCACCAAGAGCCAGCCCAAGCTGG
ACCGCAACCACAGCTTCCGCCACATCCTGCCGGGGTTCCGGAGCGCCGCCGCCGCCGCCGCGGACAATGAGAGGTCCCATCTGATGCCGA
GGCTGAAGGAGTCTCGCTCCCACGAGTCCCTGCTCAGCCCCAGCAGTGCGGTGGAGGCGCTGGACCTCAGCATGGAGGAAGAGGTGGTCA
TCAAGCCCGTGCACAGCAGCATCCTTGGCCAGGACTACTGCTTCGAGGTGACGACGTCATCAGGAAGCAAGTGCTTTTCCTGCCGGTCTG
CAGCTGAGCGGGATAAGTGGATGGAGAACCTCCGGCGAGCGGTGCATCCCAACAAGGACAACAGCCGGCGTGTGGAGCACATCCTGAAGC
TGTGGGTGATCGAGGCCAAGGACCTGCCAGCCAAGAAGAAGTACCTGTGCGAGCTGTGCCTGGACGATGTGCTCTATGCCCGCACCACGG
GCAAGCTCAAGACGGACAATGTTTTCTGGGGCGAGCACTTCGAGTTCCACAACTTGCCGCCTCTGCGCACGGTCACTGTCCACCTGTACC
GGGAGACCGACAAGAAGAAGAAGAAGGAGCGCAACAGTTACCTGGGCCTGGTGAGCCTACCTGCTGCCTCGGTGGCCGGGCGGCAGTTCG
TGGAGAAGTGGTACCCGGTGGTGACGCCCAACCCCAAGGGCGGCAAGGGCCCTGGACCCATGATCCGCATCAAGGCGCGCTACCAAACCA
TCACCATCCTGCCCATGGAGATGTACAAAGAGTTCGCTGAGCACATCACCAACCACTACCTGGGGCTGTGTGCAGCCCTCGAGCCCATCC
TCAGTGCCAAGACCAAGGAGGAGATGGCATCTGCCCTGGTGCACATCCTGCAGAGCACGGGCAAGGTGAAGGACTTCCTGACAGACCTGA
TGATGTCAGAGGTGGACCGCTGCGGGGACAACGAGCACCTCATCTTCCGGGAGAACACACTGGCCACCAAGGCCATTGAGGAGTACCTCA
AGCTAGTGGGCCAGAAGTACCTGCAGGACGCCCTAGGTGAGTTCATCAAAGCGCTGTATGAGTCAGATGAGAACTGCGAAGTGGATCCCA
GCAAGTGCTCGGCCGCTGACCTCCCAGAGCACCAGGGCAACCTCAAGATGTGCTGCGAGCTGGCCTTCTGCAAGATCATCAACTCCTACT
GTGTCTTCCCACGGGAGTTGAAAGAGGTGTTTGCCTCGTGGAGGCAGGAGTGCAGCAGTCGCGGCCGCCCGGACATCAGTGAGCGGCTCA
TCAGCGCCTCCCTCTTCCTGCGCTTCCTCTGCCCAGCCATCATGTCGCCCTCACTCTTCAACCTGCTGCAGGAGTACCCTGATGACCGCA
CTGCCCGCACCCTCACCCTCATCGCCAAGGTCACCCAGAACCTGGCCAACTTTGCCAAATTTGGCAGCAAGGAGGAATACATGTCCTTCA
TGAACCAGTTCCTAGAGCATGAGTGGACCAACATGCAGCGCTTCCTGCTGGAGATCTCCAACCCCGAGACCCTCTCCAATACAGCCGGCT
TCGAGGGCTACATCGACCTGGGCCGCGAGCTCTCCAGCCTGCACTCACTGCTCTGGGAGGCCGTCAGCCAGCTGGAGCAGAGCATAGTAT
CCAAACTGGGACCCCTGCCTCGGATCCTGAGGGACGTCCACACAGCACTGAGCACCCCAGGTAGCGGGCAGCTCCCAGGGACCAATGACC
TGGCCTCCACACCGGGCTCTGGCAGCAGCAGCATCTCAGCTGGGCTGCAGAAGATGGTGATTGAGAACGATCTTTCCGGTCTGATAGATT
TCACCCGGTTACCGTCTCCAACCCCCGAAAACAAGGACTTGTTTTTTGTCACAAGGTCCTCCGGGGTCCAGCCCTCACCTGCCCGCAGCT
CGAGTTACTCGGAAGCCAACGAGCCTGATCTTCAGATGGCCAACGGTGGCAAGAGCCTCTCCATGGTGGACCTCCAGGACGCCCGCACGC
TGGATGGGGAGGCAGGCTCCCCGGCGGGCCCCGACGTCCTCCCCACAGATGGGCAGGCCGCTGCAGCTCAGCTGGTGGCCGGGTGGCCGG
CCCGGGCAACCCCAGTGAACCTGGCAGGGCTGGCCACGGTGCGGCGGGCAGGCCAGACACCAACCACACCAGGCACCTCCGAGGGCGCGC
CAGGCCGGCCCCAGCTGTTGGCACCGCTCTCCTTCCAGAACCCTGTGTACCAGATGGCGGCTGGCCTGCCGCTGTCACCCCGTGGCCTTG
GCGACTCAGGCTCTGAGGGCCACAGCTCCCTGAGCTCACACAGCAACAGCGAGGAGTTGGCGGCTGCTGCCAAGCTGGGAAGTTTCAGCA
CTGCCGCGGAGGAGCTGGCTCGGCGGCCCGGTGAGCTGGCACGGCGACAGATGTCACTGACTGAAAAAGGCGGGCAGCCCACGGTGCCAC
GGCAGAACAGTGCTGGCCCCCAGAGGAGGATCGACCAGCCTCCGCCCCCACCCCCGCCGCCACCTCCTGCCCCCCGCGGCCGGACGCCCC
CCAACCTGCTGAGCACCCTGCAGTACCCAAGACCCTCAAGCGGAACCCTGGCGTCGGCCTCACCTGATTGGGTGGGCCCCAGTACCCGCC
TGAGGCAGCAGTCCTCTTCCTCCAAGGGGGACAGCCCAGAACTGAAGCCACGGGCAGTGCACAAGCAGGGCCCTTCACCTGTGAGCCCCA
ATGCCCTGGACCGCACAGCCGCTTGGCTCTTGACCATGAACGCGCAGTTGTTAGAAGACGAGGGCCTGGGCCCAGACCCCCCCCACAGGG
ATAGGCTAAGGAGTAAGGACGAGCTCAGCCAAGCAGAAAAGGACCTGGCGGTGCTGCAGGACAAGCTGCGAATCTCCACCAAGAAGCTGG
AGGAGTATGAGACCCTGTTCAAGTGCCAGGAGGAGACGACGCAGAAGCTGGTGCTGGAGTACCAGGCACGGCTGGAGGAGGGCGAGGAGC
GGCTGCGGCGGCAGCAGGAGGACAAGGACATCCAGATGAAGGGCATCATCAGCAGGTTGATGTCCGTGGAGGAAGAACTGAAGAAGGACC
ACGCAGAGATGCAAGCGGCTGTGGACTCCAAACAGAAGATCATTGATGCCCAGGAGAAGCGCATTGCCTCGTTGGATGCCGCCAATGCCC
GCCTCATGAGTGCCCTGACCCAGCTGAAAGAGAGGTACAGCATGCAAGCCCGTAACGGCATCTCCCCCACCAACCCCACCAAATTGCAGA
TTACTGAGAACGGCGAGTTCAGAAACAGCAGCAATTGTTAACCTGCCTGAGGAGGGAGGAAGCTACCCAAGGAGAGGGGGACTATGGTGG
CCAAGGGCAGGGTCTCGGCCTGGGGAGGCACCCACGGTTGCAGCCCCAGCGCGGGTGTCAGGAGGCCGAGCCTCCCCTCCCTGCCGCTGT
CCAGGAGGCGGCCGCAGAGGGAGCCACCAGAGACTGAAGCAGCGTGAGGCGAGGTCACCAGCCGCTCCCTGTGGGGTGCGGGCAGAAGAG
ACTGCACGCTGGGGAGTGGGGACAGCCTGATGGGGCAGGGGGCCTGCCAAAAATATGTCTGTTGGTTCCTGAATGTGGTGTGTCCTTGTC
CTCCTGGATCTGGCCGAGTGCATGTGTCCCCCCACACCTGTGCCAGGGAGGGGGCTTCCTGGAGGGGGGATTCAAGGGCTAGGGGCCTAC
ACCTGTGGCTTCCCCTCGCCTCCTTGGGGGGCCCGGGACTCCCTGGCAGCCAGGCCCTGTCATGTGGGACCTGGCACTTGGCAGATCAGT
TGGCAGGCAGGAAGATAGGAGGACACAGAGCAGGAGGTCAGTGTCCCCTGCCTGTCTCCATCCGAAGCACCTGCCACTGCATGCAGCCTG
TTGGGACCTTCCTGGCTGTGAGGAACTGAGGATTCCTACCCACCCACCCCCTCTGAACCTGTCCCCAGAGCACCACCTGCTACCTTCTTC
CCTGCCTTAGTTGTATTGCCAGATAGACCCAGTGAGGGCCATGGCTTTTTCTTGTGAGCTCTTGTCCCTGTGGGGAGGACCCACAGCTTC
CCACACCTCCCACACAGGCCCAGGCTGATGCTCTAGGGCTCCCAGAAGCCAGAGATCTGGGCGGATCTGGCCAGATGGCTCTGAGCACTG
TATCTGCCTTCTCCTGGGGCCCAGCACACCCAGGGCACAGTGGTCCTGTAGGGAGTGCCACCTGGTGCTCACCCTGAAAGAAAAGGTGAT
CCTTCCTCTGAGTGATGGTTTAAAAAAAGATTCTAACGCCTGCAGGCCCTGAGAAGGTGGATAACTGTGATTTTTTTTCCTTTCACAGTA
TGCATTAGAAACAAAAGCCCGCTTGCTCGCTTGCTGGAACACAGGGGCCTTTTAAGTTGAGCGTGCGCACTGCATGGGAAATAGCGGCCC
TGGAGGATGTTAGACTTGCTCCCTCTCCAAGACAGCAGCAGCCTGCACCTGCCCCGTGTGTGTGGCCGGCCTCCTCCTCACCCTTCCCGG
CCCCCGGCCAAGGACCCAGGCGCTGCATACAGGGGAGGGGCGCACCCCACAGCTGGGGCCGGTTTTCCTCAGCTCTAGGCTGTTCTGTAG
CTTATCTGCCCCTCCCCCACTTTCAAGACAGATGAGCAGGAGCTTGGGTCTCTCTCGGCCCCTGTCTGTTCCCAGCCCCTGCAGATTCTG
AGCAAAGGCCCTGGGTAAGAAGGGTGGGAGTGGGGCCTTTGCCAGCAGAGCCAGGGCAGGGCGAGCTGCAGGAATCACCCCTCTGCCCCT
GCAGCTGGAATGTGCCACAGAGGCCCCACCTGAAGGGTGGATGTGCTGGAGGGGTGGCCCAGAGCCATACTGCGTCCACCCTGAGCTCGG
GGACAGGTGACAGTGGCTGCTCTGGGAAGGGGCTTTTAGATGTAACCTACAATTCAGTTAGGCTAGAGACAGATGCTGGTGGAGGAAGGG
CTGGGCCACCAGGGATCACAGACCACAGGAAGATGGGAGGTGGAAGCAGAGGCCCTGCCCCCACCCCTTCCTGTCTCACTCTTCTGTCTT
GTCCCCACCCATGCGCCTTCGTGCCTGAGACCAGGGTGGCCACACAGGCAGGGCCTGGCTCCAGTCTCATCCTCCCATTGCCCAGTGAGC
CCTGCTCTTCTCTCCCCAGCCCCCTCCCACCGCTGCCTCGTAGAGTGACCTCGGACAGAGCCCCCCTAGCAATACAGGGAGGCTCCCGGG
GCCTGGACAGGCGGGCTCGGAGGCTACCCGCTGTGGCCGGTGCCAGCTGCCCTTGCAGGGTGGGTGAGCTCTCAGGCCGAGAGCCTTATT
TACCTAGTGCAAAAACTGTAAAAGTGTACAGACTCTTCACAGATTTTTATCTTAATTGCAAGTCTGCCGATTTTGTAAATGTTCTTGGTG
TTTGACTGTAATGTAACTATCTCACCTAATGGTTGTACATATCCTTTGGTCCTGGTGCTGCCGAGGGCTGGCCGGGACTGCTGCTCTCCC
AAGGGTTTTATTTTATTTCTGAATCTAGAGAACAGTATTGGGCAGGAGGAAAAGGCTTGGTGTCTGCGGGGGGTGTCTTCCCTGCCTGTG
GCATTTGTGTGTTGGCTTTGCAGCTGCTGTCTGAGTAGTGGCCACTGGGGTGCCTTCACTGGGCCAGTCAACGGGGGGCTCCTGCCCAGG
CCACAGAGAACCTGAGTTCCCGGGAGCTGGGCCCTGCCTGCAGCCAGGGCTGGGGTTGCCAGAGGCCCTGGAGGGAAGGACAGTCCCTGC
TGGGGAAGAACAGCCCCGGGGCCCCCTGGTCACCGAGACTCAGCCTCTGCTGGAGAAAGCCACGCCCTCCCTGCTAGCACAGAGGCCTGA
CTGACTTTTTTGCTTAACTTCCATGTTCTGGGTGATGGAAACTGCCAAACCTCCTGTCAGTGAGGACTCTTTCCGACTGCCCAGAAAGTG
GGGGTGGAGGACCGAGGCTACAGCTCCACACGCCCCGGTCCCCCAGAGCATCTGCCCCAGGTACACCTCCCCCTGCGCCCCGCACGACTG
CGGGAGCCAGACTGTCCAGGGAAACAGCCTCTCTCTTTTCTACACACTCAGCCACAAAGCCCCCCAGCTCCCACACCGCGTCCCAGCTCC
CCTCTTTTGTAAGTATGTGAAAAGGAAAAAATGCAAACGTTGGAGTTTGGGCTGGAGCTCCTCCCTCCAGCTGCGACTTTTAACTATGTA
ATAATGTACAGAGGAAGCTGTTGGTGTTCTAAGACTCTGTGTGGCTGTGCAATTTCTGTACATTTGCAATTAGAAATATTAAAGATTTAT


Top

FusionGenePPI for PSAT1_DAB2IP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PSAT1UBC, MAPK6, CDK2, APP, ACAT2, FH, AHCYL1, RAC1, KIAA1598, THADA, TTC1, TALDO1, STAT6, TUBB6, HSP90AA1, HSP90AB1, BAG3, PSMD10, CEBPE, HPRT1, PNP, PPID, MPRIP, CAB39, HSPG2, PCBP1, ARF4, ARF5, DAZAP1, HSPB1, KYNU, MOCOS, PHGDH, TAGLN2, UFM1, SGPL1, NTRK1, PTPRADAB2IPDAB2, TP53, TP63, TP73, YWHAQ, TRAF2, RIPK1, MAP3K5, TNFRSF1A, TRADD, PIK3R1, AKT1, HRAS, CUL1, CUL4A, SKP1, RBX1, FBXW7, RFPL3, NTRK1, XPO1, EXOSC9, RAB4B, IWS1, UGGT1, RNASEH2B, CDH1, CTDSPL, ANKS1A, CLIP1, MCC, CD83, CGN, TMEM206, SNX17, CBY1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PSAT1_DAB2IP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePSAT1Q9Y617DB00114Pyridoxal PhosphatePhosphoserine aminotransferasesmall moleculeapproved|investigational|nutraceutical
HgenePSAT1Q9Y617DB00142Glutamic AcidPhosphoserine aminotransferasesmall moleculeapproved|nutraceutical

Top

RelatedDiseases for PSAT1_DAB2IP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePSAT1C0007131Non-Small Cell Lung Carcinoma1CTD_human
HgenePSAT1C0036341Schizophrenia1PSYGENET
HgenePSAT1C1970253Phosphoserine Aminotransferase Deficiency1CTD_human;ORPHANET;UNIPROT
HgenePSAT1C4015019NEU-LAXOVA SYNDROME 21UNIPROT
TgeneDAB2IPC0024121Lung Neoplasms1CTD_human
TgeneDAB2IPC0027051Myocardial Infarction1CTD_human
TgeneDAB2IPC0033578Prostatic Neoplasms1CTD_human
TgeneDAB2IPC0034065Pulmonary Embolism1CTD_human
TgeneDAB2IPC0085096Peripheral Vascular Diseases1CTD_human
TgeneDAB2IPC0162871Aortic Aneurysm, Abdominal1CTD_human