FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28684

FusionGeneSummary for PRKAG2_KMT2C

check button Fusion gene summary
Fusion gene informationFusion gene name: PRKAG2_KMT2C
Fusion gene ID: 28684
HgeneTgene
Gene symbol

PRKAG2

KMT2C

Gene ID

51422

58508

Gene nameprotein kinase AMP-activated non-catalytic subunit gamma 2lysine methyltransferase 2C
SynonymsAAKG|AAKG2|CMH6|H91620p|WPWSHALR|KLEFS2|MLL3
Cytomap

7q36.1

7q36.1

Type of geneprotein-codingprotein-coding
Description5'-AMP-activated protein kinase subunit gamma-2AMPK subunit gamma-2protein kinase, AMP-activated, gamma 2 non-catalytic subunithistone-lysine N-methyltransferase 2CALR-like proteinhistone-lysine N-methyltransferase MLL3histone-lysine N-methyltransferase, H3 lysine-4 specifichomologous to ALR proteinlysine (K)-specific methyltransferase 2Cmyeloid/lymphoid or mixed-lineage le
Modification date2018052920180523
UniProtAcc

Q9UGJ0

Q8NEZ4

Ensembl transtripts involved in fusion geneENST00000287878, ENST00000418337, 
ENST00000433631, ENST00000492843, 
ENST00000392801, ENST00000461529, 
ENST00000262189, ENST00000355193, 
ENST00000485655, ENST00000485241, 
Fusion gene scores* DoF score10 X 7 X 7=4909 X 13 X 6=702
# samples 1115
** MAII scorelog2(11/490*10)=-2.15527822547791
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/702*10)=-2.22650852980868
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PRKAG2 [Title/Abstract] AND KMT2C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePRKAG2

GO:0006469

negative regulation of protein kinase activity

17255938


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AO-A12E-01APRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
TCGALDPRADTCGA-EJ-A46G-01APRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000287878ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000287878ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000287878ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
5CDS-intronENST00000287878ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000418337ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000418337ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000418337ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
5CDS-intronENST00000418337ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000433631ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000433631ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000433631ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
5CDS-intronENST00000433631ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000492843ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000492843ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000492843ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
5CDS-intronENST00000492843ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000392801ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000392801ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
Frame-shiftENST00000392801ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
5CDS-intronENST00000392801ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
intron-3CDSENST00000461529ENST00000262189PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
intron-3CDSENST00000461529ENST00000355193PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
intron-3CDSENST00000461529ENST00000485655PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
intron-intronENST00000461529ENST00000485241PRKAG2chr7

151329155

-KMT2Cchr7

151834009

-
In-frameENST00000287878ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
In-frameENST00000287878ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000287878ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000287878ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-3CDSENST00000418337ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-3CDSENST00000418337ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-intronENST00000418337ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-intronENST00000418337ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
In-frameENST00000433631ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
In-frameENST00000433631ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000433631ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000433631ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
In-frameENST00000492843ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
In-frameENST00000492843ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000492843ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000492843ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
Frame-shiftENST00000392801ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
Frame-shiftENST00000392801ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000392801ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
5CDS-intronENST00000392801ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-3CDSENST00000461529ENST00000262189PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-3CDSENST00000461529ENST00000355193PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-intronENST00000461529ENST00000485655PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-
intron-intronENST00000461529ENST00000485241PRKAG2chr7

151372506

-KMT2Cchr7

151860911

-

Top

FusionProtFeatures for PRKAG2_KMT2C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PRKAG2

Q9UGJ0

KMT2C

Q8NEZ4

AMP/ATP-binding subunit of AMP-activated protein kinase(AMPK), an energy sensor protein kinase that plays a key role inregulating cellular energy metabolism. In response to reduction ofintracellular ATP levels, AMPK activates energy-producing pathwaysand inhibits energy-consuming processes: inhibits protein,carbohydrate and lipid biosynthesis, as well as cell growth andproliferation. AMPK acts via direct phosphorylation of metabolicenzymes, and by longer-term effects via phosphorylation oftranscription regulators. Also acts as a regulator of cellularpolarity by remodeling the actin cytoskeleton; probably byindirectly activating myosin. Gamma non-catalytic subunit mediatesbinding to AMP, ADP and ATP, leading to activate or inhibit AMPK:AMP-binding results in allosteric activation of alpha catalyticsubunit (PRKAA1 or PRKAA2) both by inducing phosphorylation andpreventing dephosphorylation of catalytic subunits. ADP alsostimulates phosphorylation, without stimulating alreadyphosphorylated catalytic subunit. ATP promotes dephosphorylationof catalytic subunit, rendering the AMPK enzyme inactive.{ECO:0000269|PubMed:14722619}. Histone methyltransferase. Methylates 'Lys-4' of histoneH3. H3 'Lys-4' methylation represents a specific tag forepigenetic transcriptional activation. Central component of theMLL2/3 complex, a coactivator complex of nuclear receptors,involved in transcriptional coactivation. KMT2C/MLL3 may be acatalytic subunit of this complex. May be involved inleukemogenesis and developmental disorder.{ECO:0000269|PubMed:17500065}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41593391_343332504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41603391_343332504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41593277_338132504912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41603277_338132504969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594895_491148814912DomainPost-SET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594545_460532504912DomainFYR N-terminal
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594606_469132504912DomainFYR C-terminal
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594771_488732504912DomainSET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594895_491132504912DomainPost-SET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604545_460532504969DomainFYR N-terminal
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604606_469132504969DomainFYR C-terminal
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604771_488732504969DomainSET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604895_491132504969DomainPost-SET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594848_484932504912RegionS-adenosyl-L-methionine binding
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604848_484932504969RegionS-adenosyl-L-methionine binding
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594399_443932504912Zinc fingerC2HC pre-PHD-type 2
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41594460_450732504912Zinc fingerPHD-type 8
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604399_443932504969Zinc fingerC2HC pre-PHD-type 2
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41604460_450732504969Zinc fingerPHD-type 8

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516275_335251570DomainCBS 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516357_415251570DomainCBS 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516430_492251570DomainCBS 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516504_562251570DomainCBS 4
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516275_335207526DomainCBS 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516357_415207526DomainCBS 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516430_492207526DomainCBS 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516504_562207526DomainCBS 4
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112275_33510329DomainCBS 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112357_41510329DomainCBS 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112430_49210329DomainCBS 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112504_56210329DomainCBS 4
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416275_335228570DomainCBS 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416357_415228570DomainCBS 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416430_492228570DomainCBS 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416504_562228570DomainCBS 4
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416275_335184526DomainCBS 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416357_415184526DomainCBS 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416430_492184526DomainCBS 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416504_562184526DomainCBS 4
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112275_335-85329DomainCBS 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112357_415-85329DomainCBS 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112430_492-85329DomainCBS 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112504_562-85329DomainCBS 4
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516370_391251570MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516370_391207526MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112370_39110329MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416370_391228570MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416370_391184526MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112370_391-85329MotifNote=AMPK pseudosubstrate
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516319_322251570Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516383_384251570Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516458_459251570Nucleotide bindingAMP 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516474_477251570Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516530_531251570Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000287878-516546_549251570Nucleotide bindingAMP 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516319_322207526Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516383_384207526Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516458_459207526Nucleotide bindingAMP 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516474_477207526Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516530_531207526Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000392801-516546_549207526Nucleotide bindingAMP 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112319_32210329Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112383_38410329Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112458_45910329Nucleotide bindingAMP 3
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112474_47710329Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112530_53110329Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151329155chr7:151834009ENST00000418337-112546_54910329Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416319_322228570Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416383_384228570Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416458_459228570Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416474_477228570Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416530_531228570Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000287878-416546_549228570Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416319_322184526Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416383_384184526Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416458_459184526Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416474_477184526Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416530_531184526Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000392801-416546_549184526Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112319_322-85329Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112383_384-85329Nucleotide bindingAMP%2C ADP or ATP 1
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112458_459-85329Nucleotide bindingAMP 3
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112474_477-85329Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112530_531-85329Nucleotide bindingAMP%2C ADP or ATP 2
HgenePRKAG2chr7:151372506chr7:151860911ENST00000418337-112546_549-85329Nucleotide bindingAMP 3
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591338_136648814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591754_178748814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57593054_308148814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57593173_327248814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57593391_343348814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759644_67248814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-575992_11248814912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601338_136649384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601754_178749384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58603054_308149384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58603173_327249384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58603391_343349384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860644_67249384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-586092_11249384969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591338_136632504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591754_178732504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41593054_308132504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41593173_327232504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159644_67232504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-415992_11232504912Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601338_136632504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601754_178732504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41603054_308132504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41603173_327232504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160644_67232504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-416092_11232504969Coiled coilOntology_term=ECO:0000255
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591719_179648814912Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591834_228148814912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57592412_263048814912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57592690_278648814912Compositional biasNote=Asp-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57593012_350948814912Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57593277_338148814912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601719_179649384969Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601834_228149384969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58602412_263049384969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58602690_278649384969Compositional biasNote=Asp-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58603012_350949384969Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58603277_338149384969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591719_179632504912Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591834_228132504912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41592412_263032504912Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41592690_278632504912Compositional biasNote=Asp-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41593012_350932504912Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601719_179632504969Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601834_228132504969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41602412_263032504969Compositional biasNote=Pro-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41602690_278632504969Compositional biasNote=Asp-rich
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41603012_350932504969Compositional biasNote=Gln-rich
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-575934_4648814912DNA bindingNote=A.T hook
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-586034_4649384969DNA bindingNote=A.T hook
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-415934_4632504912DNA bindingNote=A.T hook
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-416034_4632504969DNA bindingNote=A.T hook
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759436_48948814912DomainDHHC
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594545_460548814912DomainFYR N-terminal
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594606_469148814912DomainFYR C-terminal
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594771_488748814912DomainSET
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860436_48949384969DomainDHHC
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604545_460549384969DomainFYR N-terminal
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604606_469149384969DomainFYR C-terminal
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604771_488749384969DomainSET
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604895_491149384969DomainPost-SET
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159436_48932504912DomainDHHC
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160436_48932504969DomainDHHC
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594848_484948814912RegionS-adenosyl-L-methionine binding
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604848_484949384969RegionS-adenosyl-L-methionine binding
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591007_105748814912Zinc fingerPHD-type 6
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57591084_113948814912Zinc fingerPHD-type 7
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759227_26248814912Zinc fingerC2HC pre-PHD-type 1%3B degenerate
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759283_33148814912Zinc fingerPHD-type 1
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759341_39148814912Zinc fingerPHD-type 2
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759344_38948814912Zinc fingerRING-type
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759388_43848814912Zinc fingerPHD-type 3
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594399_443948814912Zinc fingerC2HC pre-PHD-type 2
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-57594460_450748814912Zinc fingerPHD-type 8
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759464_52048814912Zinc fingerPHD-type 4
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000262189-5759957_101048814912Zinc fingerPHD-type 5
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601007_105749384969Zinc fingerPHD-type 6
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58601084_113949384969Zinc fingerPHD-type 7
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860227_26249384969Zinc fingerC2HC pre-PHD-type 1%3B degenerate
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860283_33149384969Zinc fingerPHD-type 1
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860341_39149384969Zinc fingerPHD-type 2
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860344_38949384969Zinc fingerRING-type
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860388_43849384969Zinc fingerPHD-type 3
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604399_443949384969Zinc fingerC2HC pre-PHD-type 2
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-58604460_450749384969Zinc fingerPHD-type 8
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860464_52049384969Zinc fingerPHD-type 4
TgeneKMT2Cchr7:151329155chr7:151834009ENST00000355193-5860957_101049384969Zinc fingerPHD-type 5
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591007_105732504912Zinc fingerPHD-type 6
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-41591084_113932504912Zinc fingerPHD-type 7
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159227_26232504912Zinc fingerC2HC pre-PHD-type 1%3B degenerate
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159283_33132504912Zinc fingerPHD-type 1
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159341_39132504912Zinc fingerPHD-type 2
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159344_38932504912Zinc fingerRING-type
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159388_43832504912Zinc fingerPHD-type 3
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159464_52032504912Zinc fingerPHD-type 4
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000262189-4159957_101032504912Zinc fingerPHD-type 5
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601007_105732504969Zinc fingerPHD-type 6
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-41601084_113932504969Zinc fingerPHD-type 7
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160227_26232504969Zinc fingerC2HC pre-PHD-type 1%3B degenerate
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160283_33132504969Zinc fingerPHD-type 1
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160341_39132504969Zinc fingerPHD-type 2
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160344_38932504969Zinc fingerRING-type
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160388_43832504969Zinc fingerPHD-type 3
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160464_52032504969Zinc fingerPHD-type 4
TgeneKMT2Cchr7:151372506chr7:151860911ENST00000355193-4160957_101032504969Zinc fingerPHD-type 5


Top

FusionGeneSequence for PRKAG2_KMT2C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_282aa
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMS
APVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEALLXLXVXLXRXPAQDSVS

>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_282aa
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMS
APVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEALLXLXVXLXRXPAQDSVS

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_158aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_158aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_158aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_158aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_1890aa
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMS
APVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIP
GATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPR
VEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQS
PQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPP
VANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSEL
PQQADQESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGS
KVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFG
CGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTPPASLPPTPPPMACQKMANGFAT
TEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLARALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVG
VEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLISVAITLHPTAAENISSVVAAFS
DLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAA
LRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLPQSPMRETPSKAFHQYSN
NISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFK
PPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKC
VFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGS
LIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVA
CVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNST
STSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNR
GVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMNX

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_1947aa
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSSRKVDSPFGPGSPSKGFFSRGPQPRPSSPMS
APVRPKTSPGSPKTVFPFSYQESPPRSPRRMSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIP
GATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPR
VEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQS
PQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPP
VANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSEL
PQQADQESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGS
KVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFG
CGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQVRQLSLLPLMEPIIGVNFAHFLPYGSGQFNSG
NRLLGTFGSATLEGVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQD
DLLARALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAG
KSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPG
LEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSR
ESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEA
AQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFC
HEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMF
FKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRL
YWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIA
ESLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKM
KTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNC

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_1766aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR
PPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSP
VRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLM
QEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNE
RRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDI
IPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPN
SDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNEL
LKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSK
KRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDD
LLARALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGK
SSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGL
EYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRE
STKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAA
QVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCH
EEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFF
KDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLY
WSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAE
SLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMK
TEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCV

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_1823aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR
PPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSP
VRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLM
QEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNE
RRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDI
IPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPN
SDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNEL
LKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSK
KRKKDEEEKQAMYSSTDTFTHLKQVRQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGNRLLGTFGSATLEGVSDYYSQLIYKQNNLSNPPT
PPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLARALAQGPKTVDVPASLPTPPHNNQEELRIQ
DHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGL
ISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVP
FPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKE
SIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLN
KKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEV
YETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQR
DEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQG
HEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCA
RSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIE
YIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFD

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_1766aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR
PPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSP
VRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLM
QEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNE
RRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDI
IPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPN
SDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNEL
LKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSK
KRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDD
LLARALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGK
SSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGL
EYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRE
STKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAA
QVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCH
EEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFF
KDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLY
WSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAE
SLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMK
TEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCV

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_1823aa
MKRFGSLRSNKKHKDQNRSTERRQSEPHGLFASGLSSSPSTPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTR
PPLASPTHYAPSKAIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPTFPMVPQQLQHQQHTTVISGHTSP
VRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLM
QEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNE
RRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDI
IPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPN
SDFSQATPNQQTYANSEVDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNEL
LKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSK
KRKKDEEEKQAMYSSTDTFTHLKQVRQLSLLPLMEPIIGVNFAHFLPYGSGQFNSGNRLLGTFGSATLEGVSDYYSQLIYKQNNLSNPPT
PPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLARALAQGPKTVDVPASLPTPPHNNQEELRIQ
DHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGL
ISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVP
FPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKE
SIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLN
KKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEV
YETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQR
DEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQG
HEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCA
RSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIE
YIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_847nt
ATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAAAGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGG
CGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTCCTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCT
CGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCCCTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCT
GCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCCCAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGC
ATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAAAGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTC
TCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTAT
AAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAG
AGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCC
GGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCA

>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_847nt
ATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAAAGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGG
CGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTCCTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCT
CGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCCCTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCT
GCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCCCAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGC
ATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAAAGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTC
TCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTAT
AAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAG
AGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCC
GGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCA

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_475nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_475nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_475nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_475nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_5670nt
ATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAAAGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGG
CGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTCCTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCT
CGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCCCTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCT
GCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCCCAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGC
ATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAAAGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTC
TCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTAT
AAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAG
AGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATT
GAAGATTATCGGATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCA
GGTGCCACTCCACCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGC
CATACTAGCCCTGTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAG
CCCCCAATTGCCCAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGG
GTAGAATTTGATGACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGG
ATCCAACTCATGCAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGT
AGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCT
CCACAACACCAACAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATG
CAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTG
AAGCAGGGACATGGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCA
GTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTG
TATTCTGATATAATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCA
TCAACTCCCCATTCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTT
CCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAAC
AAACTGCCCAATAGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCT
GCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGT
AAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCA
GGGAATGAACTTCTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGAT
GACTGTACAAAGGATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGA
TGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCA
CCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAAT
AATTTAAGTAATCCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACA
ACTGAAGAACTTGCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGA
CCCCAGGACGACTTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAAT
CAGGAAGAATTAAGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGG
GTAGAAGTGAGCAGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGC
ACTGCTGGGAAAAGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCA
AATGGTCCCAGATCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCC
GACCTTCTTCACGTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATC
AACCCGGGTTTGGAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGG
CTGAAGCAGCCTAATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCA
CTCAGACCACAGTGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAG
GATTCCCGAGAAAGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCG
AAAAACTCAGAAAACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAAC
AACATCTCCACTTTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCT
TTTGAAGCAGCCCAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTT
GAAGATTGCAGGCCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAA
CCACCTTGTGAGGATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGT
TGCTTTTGTCATGAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGC
GCTCTGTGGTCCACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGT
GTCTTCTGTCACAAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAA
TGCATGTTTTTTAAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTC
AGGAGGGTCTATGTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGC
CTCATCTTCCACACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCC
AGCCGGCTGTACTGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTC
ATCAGGATTGTGGAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCA
TGTGTGAGAAAAAAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCA
CGCATAGCGGAATCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCC
GTTAACCCCACAGGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACC
AGCACCTCAAAGTCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTAC
CGGAAGATGAAAACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAG
AAACACACCATGGTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGT
GGTGTGTACATGTTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCA
CCTAATTGTGTGGCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTC
TGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGA

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_5841nt
ATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAAAGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGG
CGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTCCTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCT
CGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCCCTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCT
GCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCCCAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGC
ATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAAAGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTC
TCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTAT
AAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAG
AGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATT
GAAGATTATCGGATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCA
GGTGCCACTCCACCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGC
CATACTAGCCCTGTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAG
CCCCCAATTGCCCAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGG
GTAGAATTTGATGACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGG
ATCCAACTCATGCAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGT
AGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCT
CCACAACACCAACAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATG
CAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTG
AAGCAGGGACATGGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCA
GTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTG
TATTCTGATATAATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCA
TCAACTCCCCATTCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTT
CCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAAC
AAACTGCCCAATAGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCT
GCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGT
AAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCA
GGGAATGAACTTCTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGAT
GACTGTACAAAGGATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGA
TGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCA
CCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGG
CAGCTCTCTCTGCTCCCTCTAATGGAACCAATCATTGGAGTGAACTTTGCGCACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGG
AATCGACTTCTAGGAACTTTTGGCAGTGCTACCCTGGAAGGGGTTTCGGACTACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGT
AATCCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAA
CTTGCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGAC
GACTTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAA
TTAAGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTG
AGCAGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGG
AAAAGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCC
AGATCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTT
CACGTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGT
TTGGAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAG
CCTAATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCA
CAGTGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGA
GAAAGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCA
GAAAACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCC
ACTTTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCA
GCCCAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGC
AGGCCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGT
GAGGATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGT
CATGAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGG
TCCACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGT
CACAAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTT
TTTAAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTC
TATGTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTC
CACACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTG
TACTGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATT
GTGGAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGA
AAAAAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCG
GAATCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCC
ACAGGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCA
AAGTCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATG
AAAACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACC
ATGGTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTAC
ATGTTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGT
GTGGCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGAC

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_5298nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAATAATTTAAGTAAT
CCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTT
GCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGAC
TTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTA
AGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGC
AGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAA
AGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGA
TCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCAC
GTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTG
GAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCT
AATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAG
TGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAA
AGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAA
AACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACT
TTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCC
CAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGG
CCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAG
GATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCAT
GAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCC
ACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCAC
AAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTT
AAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTAT
GTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCAC
ACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTAC
TGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTG
GAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAA
AAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAA
TCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACA
GGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAG
TCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAA
ACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATG
GTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATG
TTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTG
GCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTAT

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_5469nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGGCAGCTCTCTCTG
CTCCCTCTAATGGAACCAATCATTGGAGTGAACTTTGCGCACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGGAATCGACTTCTA
GGAACTTTTGGCAGTGCTACCCTGGAAGGGGTTTCGGACTACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGTAATCCTCCAACA
CCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAA
GCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCC
CGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAG
GATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCA
GATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAA
TCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTT
ATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATC
CCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGA
CAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCA
TTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGT
CATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAG
AGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAA
TCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTG
CACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAG
GCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAAT
AAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATA
GATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGT
GATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTC
TATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGT
GCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAA
ACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGT
GATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGT
CAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACT
CGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGC
CATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAA
ATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCT
GGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCC
CGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAG
AGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGG
AAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAG
TACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATG
GATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTG
GTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGAC

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_5298nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAATAATTTAAGTAAT
CCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTT
GCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGAC
TTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTA
AGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGC
AGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAA
AGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGA
TCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCAC
GTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTG
GAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCT
AATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAG
TGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAA
AGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAA
AACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACT
TTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCC
CAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGG
CCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAG
GATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCAT
GAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCC
ACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCAC
AAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTT
AAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTAT
GTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCAC
ACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTAC
TGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTG
GAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAA
AAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAA
TCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACA
GGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAG
TCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAA
ACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATG
GTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATG
TTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTG
GCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTAT

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_5469nt
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGGCAGCTCTCTCTG
CTCCCTCTAATGGAACCAATCATTGGAGTGAACTTTGCGCACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGGAATCGACTTCTA
GGAACTTTTGGCAGTGCTACCCTGGAAGGGGTTTCGGACTACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGTAATCCTCCAACA
CCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAA
GCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCC
CGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAG
GATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCA
GATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAA
TCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTT
ATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATC
CCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGA
CAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCA
TTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGT
CATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAG
AGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAA
TCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTG
CACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAG
GCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAAT
AAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATA
GATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGT
GATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTC
TATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGT
GCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAA
ACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGT
GATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGT
CAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACT
CGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGC
CATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAA
ATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCT
GGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCC
CGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAG
AGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGG
AAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAG
TACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATG
GATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTG
GTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_3259nt
GAGCTGGTTTATTCTGCGGCCGAGGATTACATTTATGCACGAACGGGCTTACTGGTTCCAGATTCCCCACTTGGGCACAGGCATAGGAGG
CTTGTTTTCCAAATTGCTGGTTTTAATTGCACCTGCCTTTCAGATTACCTCTGGGAATCTGTGGGAGGAGCCGAGAGGGTGGAAAATGTT
TCTTAGCTTTGCAAAAGGAAGAAAACTTTGTCACCCAGCGGGAGACCTCAGCCACGAGTAACCCGGGGAGACACCAGAACCGGGACGGGC
TTTGACTGATTTGCCTACGAGGGTTCCGTAGGAAAGGACGCTTGAATTCGGCGCTTCGGCGGCGGCGGCGGCCGCGCGAGTTCCCTGCTC
ACCCTCCCTCTCCGCGGAAGTCCCCACGAGGTGGCTTCAGGGTGTAACAGAGCGCGCGGCTCCAGTCCGAAGGCAGCGGCCGGGGGAGGG
AAGGAGGGGACCGAACCCCCGAGGAGTTTCGCAGAATCAACTTCTGGTTAGAGTTATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAA
AGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGGCGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTC
CTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCTCGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCC
CTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCTGCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCC
CAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGCATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAA
AGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTCTCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTC
TCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTA
TGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACA
CTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGC
TCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACT
GAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGAT
TTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGC
TGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTT
TTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTG
GGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCT
GGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAA
TGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTT
GATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTG
CTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTG
ACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCC
ATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACA
CCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGT
TGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCT
GAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAA
CTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAG
GACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTG
TTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACA
GGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATAT
GGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATT
TTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATG
TTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATTTAGAAGATCACCATTTACAAATA

>In-frame_PRKAG2_ENST00000287878_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_3255nt
GAGCTGGTTTATTCTGCGGCCGAGGATTACATTTATGCACGAACGGGCTTACTGGTTCCAGATTCCCCACTTGGGCACAGGCATAGGAGG
CTTGTTTTCCAAATTGCTGGTTTTAATTGCACCTGCCTTTCAGATTACCTCTGGGAATCTGTGGGAGGAGCCGAGAGGGTGGAAAATGTT
TCTTAGCTTTGCAAAAGGAAGAAAACTTTGTCACCCAGCGGGAGACCTCAGCCACGAGTAACCCGGGGAGACACCAGAACCGGGACGGGC
TTTGACTGATTTGCCTACGAGGGTTCCGTAGGAAAGGACGCTTGAATTCGGCGCTTCGGCGGCGGCGGCGGCCGCGCGAGTTCCCTGCTC
ACCCTCCCTCTCCGCGGAAGTCCCCACGAGGTGGCTTCAGGGTGTAACAGAGCGCGCGGCTCCAGTCCGAAGGCAGCGGCCGGGGGAGGG
AAGGAGGGGACCGAACCCCCGAGGAGTTTCGCAGAATCAACTTCTGGTTAGAGTTATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAA
AGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGGCGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTC
CTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCTCGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCC
CTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCTGCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCC
CAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGCATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAA
AGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTCTCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTC
TCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTA
TGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACA
CTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGC
TCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACT
GAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGAT
TTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGC
TGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTT
TTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTG
GGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCT
GGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAA
TGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTT
GATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTG
CTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTG
ACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCC
ATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACA
CCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGT
TGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCT
GAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAA
CTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAG
GACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTG
TTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACA
GGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATAT
GGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATT
TTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATG
TTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATTTAGAAGATCACCATTTACAAATA

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_2652nt
GCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCACTCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACC
CCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGCACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATG
CTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTCTGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCC
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT
GAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTG
GAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGG
TTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGC
TTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTC
TCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCAC
CAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACC
ACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCA
TGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAAT
AAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAA
ATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATAT
AATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTA
TTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAA
CTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTT
AAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAAC
GTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGA
TGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACA
TTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAA
AATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGT
GATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGT
ATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCT
GTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATT

>In-frame_PRKAG2_ENST00000433631_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_2648nt
GCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCACTCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACC
CCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGCACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATG
CTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTCTGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCC
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAG
AAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGT
GAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTG
GAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGG
TTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGC
TTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTC
TCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCAC
CAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACC
ACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCA
TGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAAT
AAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAA
ATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATAT
AATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTA
TTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAA
CTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTT
AAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAAC
GTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGA
TGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACA
TTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAA
AATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGT
GATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGT
ATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCT
GTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATT

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000262189_chr7_151834009_-_2703nt
GCTTCCGGCAGCTTCTTGCTACTTAAGGACAGCCGGGCTGACGCTCCAGCTGCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCAC
TCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACCCCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGC
ACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATGCTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTC
TGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCCATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACAC
AAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTTTTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACC
CAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCC
CCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAA
GCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAA
GTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGC
TAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTT
ATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTT
CCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTT
TTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATG
GCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTA
AAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGAT
AGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAA
GAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAG
AACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGG
CTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAAT
AACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGA
GCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTT
CAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGC
AAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTT
TAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGG
TTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGT
AGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATG
AAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTT
ATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACA
ATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAAT
TTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATTTAGAAGATCACCATTTACAAATAAAATATTTTACATCTA

>In-frame_PRKAG2_ENST00000492843_chr7_151329155_-_KMT2C_ENST00000355193_chr7_151834009_-_2699nt
GCTTCCGGCAGCTTCTTGCTACTTAAGGACAGCCGGGCTGACGCTCCAGCTGCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCAC
TCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACCCCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGC
ACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATGCTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTC
TGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCCATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACAC
AAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTTTTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACC
CAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCC
CCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAA
GCCGCGGCGCTGGCGGCGGCCCTGGGACCCGCGGAAGCCGGCATGCTGGAGAAGCTGGAGTTCGAGGACGAAGCTCTGCTATGACTATAA
GTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGC
TAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTT
ATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTT
CCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTT
TTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATG
GCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTA
AAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGAT
AGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAA
GAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAG
AACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGG
CTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAAT
AACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGA
GCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTT
CAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGC
AAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTT
TAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGG
TTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGT
AGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATG
AAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTT
ATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACA
ATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAAT

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_8082nt
GAGCTGGTTTATTCTGCGGCCGAGGATTACATTTATGCACGAACGGGCTTACTGGTTCCAGATTCCCCACTTGGGCACAGGCATAGGAGG
CTTGTTTTCCAAATTGCTGGTTTTAATTGCACCTGCCTTTCAGATTACCTCTGGGAATCTGTGGGAGGAGCCGAGAGGGTGGAAAATGTT
TCTTAGCTTTGCAAAAGGAAGAAAACTTTGTCACCCAGCGGGAGACCTCAGCCACGAGTAACCCGGGGAGACACCAGAACCGGGACGGGC
TTTGACTGATTTGCCTACGAGGGTTCCGTAGGAAAGGACGCTTGAATTCGGCGCTTCGGCGGCGGCGGCGGCCGCGCGAGTTCCCTGCTC
ACCCTCCCTCTCCGCGGAAGTCCCCACGAGGTGGCTTCAGGGTGTAACAGAGCGCGCGGCTCCAGTCCGAAGGCAGCGGCCGGGGGAGGG
AAGGAGGGGACCGAACCCCCGAGGAGTTTCGCAGAATCAACTTCTGGTTAGAGTTATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAA
AGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGGCGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTC
CTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCTCGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCC
CTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCTGCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCC
CAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGCATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAA
AGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTCTCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTC
TCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTA
TGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACA
CTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGGATCAAACAGCAGCAGCAATGTGC
AATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCACCCACCATGAGCCAACCCACCTT
TCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCTGTTAGAATGCCCAGTTTACCTGG
ATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCCCAGTTACCAATAAAAACTTGTAC
ACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGATGACAACAATCCCTTTAGTGAAAG
TTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATGCAGGAGGTAGATAGACAAAGAGC
TTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTA
CAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAACAGCAAATGGGGCAGGTTTTACA
GCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTC
ATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACATGGAAATCTTTCTGGGACCAGCTT
CCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTC
TACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATAATCCCAGAGGAAAAAGGGAAAAA
GAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCATTCAGATATAACTGCCCCACCGAC
TCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGT
CGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAATAGTGATTTCTCACAAGCAACTCC
AAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGA
GACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTC
CTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTTCTGAAACACTTGTTGAAAAATAA
AAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAGGATAATAAACTAGTTGAGAAGCA
GAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAG
TGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGA
GAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAATAATTTAAGTAATCCTCCAACACCCCCTGCCTCTCT
TCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAAGCCGGAGTGTTAGT
GAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCCCGAGCTCTTGCTCA
GGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAGGATCACTGTGGTGA
TCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCAGATCTGTCATTGGT
CAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAATCAAGAAGGAATGA
CATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTTATATCTGTAGCAAT
TACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATCCCTAACAGCTATGA
GGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGACAGCATTTACTTCT
CCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCATTTCCTCCAACAAG
CAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGTCATTGTAAAGTGGT
TATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAGAGGGTAGAGAAGGA
CATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAATCCATTCCTTCATT
GCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTGCACTGTCTCCCCCA
GCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAGGCCAAGCCAGATGA
GCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAATAAAAAATGGAGAGG
AATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATAGATGAATTTCTAAA
GAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGTGATGGATTGACAGA
TGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTCTATGAGACTCAGGC
TGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGTGCCACTAGTGGATG
CCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAAACTATGCTTTGCCC
CATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGTGATGAGGTGCGACA
GATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGTCAGCTGCTTCCACA
GCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACTCGCTATGCCAATAG
GCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGCCATGAAGACCTGGT
TCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAAATGCTCCAGCTTTT
CCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCTGGGGTTGAGGCATG
TGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCCCGTTCTGAACCTAA
AATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAGAGCACAGTCACTGG
AGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGGAAATCCAATGTGTA
TCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAGTACATCGGGACTAT
CATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATGGATAACGACCATGT
GATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTGGTGACTTTTGAGAG
AGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCA
GCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTC
CCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTC
TGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAA
CGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTG
GGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGG
GCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAAC
TTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTT
GCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTA
TTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTT
TGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCT
TATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAG
TGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTA
CAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTT
ACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAAC
TTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAA
AATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTA
AAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTG
AACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCA
AGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATT
GTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGT
ATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGT

>In-frame_PRKAG2_ENST00000287878_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_8249nt
GAGCTGGTTTATTCTGCGGCCGAGGATTACATTTATGCACGAACGGGCTTACTGGTTCCAGATTCCCCACTTGGGCACAGGCATAGGAGG
CTTGTTTTCCAAATTGCTGGTTTTAATTGCACCTGCCTTTCAGATTACCTCTGGGAATCTGTGGGAGGAGCCGAGAGGGTGGAAAATGTT
TCTTAGCTTTGCAAAAGGAAGAAAACTTTGTCACCCAGCGGGAGACCTCAGCCACGAGTAACCCGGGGAGACACCAGAACCGGGACGGGC
TTTGACTGATTTGCCTACGAGGGTTCCGTAGGAAAGGACGCTTGAATTCGGCGCTTCGGCGGCGGCGGCGGCCGCGCGAGTTCCCTGCTC
ACCCTCCCTCTCCGCGGAAGTCCCCACGAGGTGGCTTCAGGGTGTAACAGAGCGCGCGGCTCCAGTCCGAAGGCAGCGGCCGGGGGAGGG
AAGGAGGGGACCGAACCCCCGAGGAGTTTCGCAGAATCAACTTCTGGTTAGAGTTATGGGAAGCGCGGTTATGGACACCAAGAAGAAAAA
AGATGTTTCCAGCCCCGGCGGGAGCGGCGGCAAGAAAAATGCCAGCCAGAAGAGGCGTTCGCTGCGCGTGCACATTCCGGACCTGAGCTC
CTTCGCCATGCCGCTCCTGGACGGAGACCTGGAGGGTTCCGGAAAGCATTCCTCTCGAAAGGTGGACAGCCCCTTCGGCCCGGGCAGCCC
CTCCAAAGGGTTCTTCTCCAGAGGCCCCCAGCCCCGGCCCTCCAGCCCCATGTCTGCACCTGTGAGGCCCAAGACCAGCCCCGGCTCTCC
CAAAACCGTGTTCCCGTTCTCCTACCAGGAGTCCCCGCCACGCTCCCCTCGACGCATGAGCTTCAGTGGGATCTTCCGCTCCTCCTCCAA
AGAGTCTTCCCCCAACTCCAACCCTGCTACCTCGCCCGGGGGCATCAGGTTTTTCTCCCGCTCCAGAAAAACCTCCGGCCTCTCCTCCTC
TCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTA
TGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACA
CTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGGATCAAACAGCAGCAGCAATGTGC
AATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCACCCACCATGAGCCAACCCACCTT
TCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCTGTTAGAATGCCCAGTTTACCTGG
ATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCCCAGTTACCAATAAAAACTTGTAC
ACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGATGACAACAATCCCTTTAGTGAAAG
TTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATGCAGGAGGTAGATAGACAAAGAGC
TTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTA
CAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAACAGCAAATGGGGCAGGTTTTACA
GCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTC
ATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACATGGAAATCTTTCTGGGACCAGCTT
CCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTC
TACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATAATCCCAGAGGAAAAAGGGAAAAA
GAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCATTCAGATATAACTGCCCCACCGAC
TCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGT
CGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAATAGTGATTTCTCACAAGCAACTCC
AAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGA
GACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTC
CTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTTCTGAAACACTTGTTGAAAAATAA
AAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAGGATAATAAACTAGTTGAGAAGCA
GAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAG
TGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGA
GAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGGCAGCTCTCTCTGCTCCCTCTAATGGAACCAATCAT
TGGAGTGAACTTTGCGCACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGGAATCGACTTCTAGGAACTTTTGGCAGTGCTACCCT
GGAAGGGGTTTCGGACTACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGTAATCCTCCAACACCCCCTGCCTCTCTTCCTCCTAC
ACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAAGCCGGAGTGTTAGTGAGCCATGA
AGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAA
GACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAGGATCACTGTGGTGATCGAGATAC
TCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCAGATCTGTCATTGGTCAAGGAGGA
GCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAATCAAGAAGGAATGACATCAAAAC
TGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTTATATCTGTAGCAATTACTCTGCA
TCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATCCCTAACAGCTATGAGGTTAGCAG
TGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGACAGCATTTACTTCTCCGTGGGCC
TCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCATTTCCTCCAACAAGCAATGGTCT
TTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGTCATTGTAAAGTGGTTATTCTTGG
AAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAGAGGGTAGAGAAGGACATTGTCTT
CTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAATCCATTCCTTCATTGCCACAATC
ACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTGCACTGTCTCCCCCAGCTCCCAGA
GAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAGGCCAAGCCAGATGAGCTGAAGGT
GACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAATAAAAAATGGAGAGGAATGAAATG
GAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATAGATGAATTTCTAAAGAAATTGGG
CACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGTGATGGATTGACAGATGGACCAGC
AAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTCTATGAGACTCAGGCTGGTGCCTT
AATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGTGCCACTAGTGGATGCCACAGATT
TCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAAACTATGCTTTGCCCCATGCACAA
ACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGTGATGAGGTGCGACAGATTGCTAG
CATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGTCAGCTGCTTCCACAGCAGATGCA
AGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACTCGCTATGCCAATAGGCGCTGCCG
CTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGCCATGAAGACCTGGTTCTAAGTGA
CATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAAATGCTCCAGCTTTTCCCAGCGTA
TTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCTGGGGTTGAGGCATGTGAAAATTA
TACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCCCGTTCTGAACCTAAAATGAGTGC
CCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAGAGCACAGTCACTGGAGAACTGAA
CGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGGAAATCCAATGTGTATCTGGCACG
GTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAGTACATCGGGACTATCATTCGAAA
CGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATGGATAACGACCATGTGATTGACGC
GACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTGGTGACTTTTGAGAGAGGACACAA
AATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGAT
TCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAG
AGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTC
TGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCAC
AGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTT
CATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTA
TGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATG
TTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAAT
ACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAG
TGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGAT
ATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATG
TTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGG
TTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTA
TAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGT
GATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCA
GCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAA
AAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTT
TGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTT
AGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTG
TAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATT
TTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCT
ACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTT

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_7475nt
GCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCACTCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACC
CCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGCACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATG
CTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTCTGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCC
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAATAATTTAAGTAAT
CCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTT
GCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGAC
TTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTA
AGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGC
AGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAA
AGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGA
TCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCAC
GTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTG
GAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCT
AATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAG
TGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAA
AGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAA
AACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACT
TTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCC
CAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGG
CCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAG
GATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCAT
GAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCC
ACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCAC
AAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTT
AAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTAT
GTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCAC
ACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTAC
TGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTG
GAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAA
AAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAA
TCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACA
GGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAG
TCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAA
ACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATG
GTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATG
TTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTG
GCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTAT
AAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTT
GCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTT
TTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCG
TTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTT
TTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGA
TGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTAT
TAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGG
ATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAAT
AAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGC
AGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCA
GGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTA
ATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACA
GAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTC
TTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCA
GCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCC
TTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAG
GGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTT
GTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAA
TGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTT
TTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTA
CAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGA
ATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACACAGATTTAGAAGATCACCATTTACAAATAAAATATTTTACATC

>In-frame_PRKAG2_ENST00000433631_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_7642nt
GCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCACTCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACC
CCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGCACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATG
CTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTCTGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCC
ATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACACAAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTT
TTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACCCAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCT
GAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCCCCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGG
CCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAAGCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGG
ATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACCATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCA
CCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAGCAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCT
GTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGTGCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCC
CAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACAGTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGAT
GACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAACGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATG
CAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATGGAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACA
TCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCTTGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAA
CAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAACAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAG
CGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCACCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACAT
GGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTGAGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGC
AGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGACACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATA
ATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAGAAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCAT
TCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAAACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCC
GACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCCAATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAAT
AGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTATGCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAA
GAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCAGGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGA
AACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCTCCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTT
CTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTTTTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAG
GATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGACTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAG
TTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAGCGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAG
AAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTACTCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGGCAGCTCTCTCTG
CTCCCTCTAATGGAACCAATCATTGGAGTGAACTTTGCGCACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGGAATCGACTTCTA
GGAACTTTTGGCAGTGCTACCCTGGAAGGGGTTTCGGACTACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGTAATCCTCCAACA
CCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAA
GCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCC
CGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAG
GATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCA
GATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAA
TCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTT
ATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATC
CCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGA
CAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCA
TTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGT
CATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAG
AGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAA
TCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTG
CACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAG
GCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAAT
AAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATA
GATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGT
GATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTC
TATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGT
GCCACTAGTGGATGCCACAGATTTCGATGCACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAA
ACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGT
GATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGT
CAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACT
CGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGC
CATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAA
ATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCT
GGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCC
CGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAG
AGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGG
AAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAG
TACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATG
GATAACGACCATGTGATTGACGCGACGCTCACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTG
GTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGAC
TTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCA
GCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTT
TTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAG
TGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTT
GTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCC
TGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGG
GCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTA
AGGGATAATAACTTGCACTAAATACATTTAAATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAAC
TTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAAC
AAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCA
GCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAA
ATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGC
GTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAG
GTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTA
GTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTT
CTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGG
AAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACT
TAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTT
GTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTAC
AGAATAAATCAATTGTATATATTTTTCTCTTGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCT
GACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGA

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000262189_chr7_151860911_-_7526nt
GCTTCCGGCAGCTTCTTGCTACTTAAGGACAGCCGGGCTGACGCTCCAGCTGCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCAC
TCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACCCCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGC
ACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATGCTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTC
TGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCCATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACAC
AAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTTTTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACC
CAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCC
CCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAA
GCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGGATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACC
ATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCACCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAG
CAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCTGTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGT
GCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCCCAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACA
GTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGATGACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAA
CGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATGCAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATG
GAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCT
TGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAACAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAA
CAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCA
CCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACATGGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTG
AGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGA
CACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATAATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAG
AAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCATTCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAA
ACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCC
AATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAATAGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTAT
GCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCA
GGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCT
CCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTTCTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTT
TTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAGGATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGA
CTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAG
CGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTAC
TCTAGCACTGACACGTTTACCCACTTGAAACAGCAGAATAATTTAAGTAATCCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCT
CCTATGGCTTGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACC
AAAACTCTAGGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTT
GATGTGCCAGCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAGGATCACTGTGGTGATCGAGATACTCCTGAC
AGTTTTGTTCCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCA
GAACCGGTGCCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCA
GGCACTTTATATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACA
GCTGCTGAGAACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCA
GATGTCCCATCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCA
GGATCTGCAAACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGA
TATAAGGATTCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGT
GTGCGGAAATCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGT
AATAACTGCTTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAATCCATTCCTTCATTGCCACAATCACCTATG
AGAGAAACGCCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCT
TCTCCCCCTGCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTC
AAGCTGAAGCCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAG
TGGAGCATTCATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCC
CTTAAACCTGATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTA
CTCAACCTTGACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAAT
GTGGAGCTAGCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGC
ACCAACATTTATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAG
GGAATTCATGAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTG
CAACGAGGAGAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTC
CATTCTCCTAAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTG
TGCTCCATTGAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCA
CCTAAAGGTGTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAA
GGAGAGGATCTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTC
CGATACGGCCGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTC
AAGAGGTTTGTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCT
TATAGTAAACAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGG
ATTCAGGGGCTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTA
GCCAACAGGAAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATGGATAACGACCATGTGATTGACGCGACGCTC
ACAGGAGGGCCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATC
ATCAGCTCCAGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGT
CACTGTGGAGCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGAT
TCAACACACCATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTC
CTCAGTCCTTTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGG
TCCAGCACTTTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTT
TTGGTTTTCTAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGT
AAGACTGAAATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAA
ATAAAGTAGACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTA
AATACTTGATTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGA
AGCTATTTTTAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAA
TATTTTGAGAAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAG
GGATGTTACAATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTG
GAAACCGCAGTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGT
TTTGGTAATTTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACT
GTGAATAACTGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAG
AGAATCATGTAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAA
AAAAAAAAAGGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGA
ACTGTTTGTTTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTT
TATTTTGTACTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTG
TTGGTATATTCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCT
TGATAAATAGCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGT
TTTTGTTGTTTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATT

>In-frame_PRKAG2_ENST00000492843_chr7_151372506_-_KMT2C_ENST00000355193_chr7_151860911_-_7693nt
GCTTCCGGCAGCTTCTTGCTACTTAAGGACAGCCGGGCTGACGCTCCAGCTGCTGTGGCCGGAGGTGCAGCCCCGTCAGGACGGCTCCAC
TCCCTGGCGCCTCACAGACTCTGGGGCTGCGGTGAGGTCGCCCTGAAGACCCCCTGGTGAGGACGCTTGAACCCGGGCTGTCACCTGAGC
ACAGGCTGCCACTCTGAGCTTTTGGGGCGCCCTGTGCCTGTCGGGCTGATGCTCCTCTGGCTCCCGGCCACCTGGGGCTGACACCGGTTC
TGTGGGTCCTGATATGTTCACCTGTCGCCACTCCTGTGGCCACAGCTACCCATGAAGCGCTTTGGGAGCCTCAGGAGCAACAAGAAACAC
AAGGACCAAAATCGAAGCACGGAGAGGCGCCAGTCGGAGCCTCATGGCCTTTTCGCCTCCGGCCTCTCCTCCTCTCCGTCAACACCCACC
CAAGTGACCAAGCAGCACACGTTTCCCCTGGAATCCTATAAGCACGAGCCTGAACGGTTAGAGAATCGCATCTATGCCTCGTCTTCCCCC
CCGGACACAGGGCAGAGGTTCTGCCCGTCTTCCTTCCAGAGCCCGACCAGGCCTCCACTGGCATCACCGACACACTATGCTCCCTCCAAA
GCCATTCGTAAACAACAGAAAGAACATGCTGAATTGATTGAAGATTATCGGATCAAACAGCAGCAGCAATGTGCAATGGCCCCACCTACC
ATGATGCCCAGTGTCCAGCCCCAGCCACCCCTAATTCCAGGTGCCACTCCACCCACCATGAGCCAACCCACCTTTCCCATGGTGCCACAG
CAGCTTCAGCACCAGCAGCACACAACAGTTATTTCTGGCCATACTAGCCCTGTTAGAATGCCCAGTTTACCTGGATGGCAACCCAACAGT
GCTCCTGCCCACCTGCCCCTCAATCCTCCTAGAATTCAGCCCCCAATTGCCCAGTTACCAATAAAAACTTGTACACCAGCCCCAGGGACA
GTCTCAAATGCAAATCCACAGAGTGGACCACCACCTCGGGTAGAATTTGATGACAACAATCCCTTTAGTGAAAGTTTTCAAGAACGGGAA
CGTAAGGAACGTTTACGAGAACAGCAAGAGAGACAACGGATCCAACTCATGCAGGAGGTAGATAGACAAAGAGCTTTGCAGCAGAGGATG
GAAATGGAGCAGCATGGTATGGTGGGCTCTGAGATAAGTAGTAGTAGGACATCTGTGTCCCAGATTCCCTTCTACAGTTCCGACTTACCT
TGTGATTTTATGCAACCTCTAGGACCCCTTCAGCAGTCTCCACAACACCAACAGCAAATGGGGCAGGTTTTACAGCAGCAGAATATACAA
CAAGGATCAATTAATTCACCCTCCACCCAAACTTTCATGCAGACTAATGAGCGAAGGCAGGTAGGCCCTCCTTCATTTGTTCCTGATTCA
CCATCAATCCCTGTTGGAAGCCCAAATTTTTCTTCTGTGAAGCAGGGACATGGAAATCTTTCTGGGACCAGCTTCCAGCAGTCCCCAGTG
AGGCCTTCTTTTACACCTGCTTTACCAGCAGCACCTCCAGTAGCTAATAGCAGTCTCCCATGTGGCCAAGATTCTACTATAACCCATGGA
CACAGTTATCCGGGATCAACCCAATCGCTCATTCAGTTGTATTCTGATATAATCCCAGAGGAAAAAGGGAAAAAGAAAAGAACAAGAAAG
AAGAAAAGAGATGATGATGCAGAATCCACCAAGGCTCCATCAACTCCCCATTCAGATATAACTGCCCCACCGACTCCAGGCATCTCAGAA
ACTACCTCTACTCCTGCAGTGAGCACACCCAGTGAGCTTCCTCAACAAGCCGACCAAGAGTCGGTGGAACCAGTCGGCCCATCCACTCCC
AATATGGCAGCAGGCCAGCTATGTACAGAATTAGAGAACAAACTGCCCAATAGTGATTTCTCACAAGCAACTCCAAATCAACAGACGTAT
GCAAATTCAGAAGTAGACAAGCTCTCCATGGAAACCCCTGCCAAAACAGAAGAGATAAAACTGGAAAAGGCTGAGACAGAGTCCTGCCCA
GGCCAAGAGGAGCCTAAATTGGAGGAACAGAATGGTAGTAAGGTAGAAGGAAACGCTGTAGCCTGTCCTGTCTCCTCAGCACAGAGTCCT
CCCCATTCTGCTGGGGCCCCTGCTGCCAAAGGAGACTCAGGGAATGAACTTCTGAAACACTTGTTGAAAAATAAAAAGTCATCTTCTCTT
TTGAATCAAAAACCTGAGGGCAGTATTTGTTCAGAAGATGACTGTACAAAGGATAATAAACTAGTTGAGAAGCAGAACCCAGCTGAAGGA
CTGCAAACTTTGGGGGCTCAAATGCAAGGTGGTTTTGGATGTGGCAACCAGTTGCCAAAAACAGATGGAGGAAGTGAAACCAAGAAACAG
CGAAGCAAACGGACTCAGAGGACGGGTGAGAAAGCAGCACCTCGCTCAAAGAAAAGGAAAAAGGACGAAGAGGAGAAACAAGCTATGTAC
TCTAGCACTGACACGTTTACCCACTTGAAACAGGTGAGGCAGCTCTCTCTGCTCCCTCTAATGGAACCAATCATTGGAGTGAACTTTGCG
CACTTTCTTCCTTATGGCAGTGGCCAATTTAATAGTGGGAATCGACTTCTAGGAACTTTTGGCAGTGCTACCCTGGAAGGGGTTTCGGAC
TACTATTCTCAGTTGATCTACAAGCAGAATAATTTAAGTAATCCTCCAACACCCCCTGCCTCTCTTCCTCCTACACCACCTCCTATGGCT
TGTCAGAAGATGGCCAATGGTTTTGCAACAACTGAAGAACTTGCTGGAAAAGCCGGAGTGTTAGTGAGCCATGAAGTTACCAAAACTCTA
GGACCTAAACCATTTCAGCTGCCCTTCAGACCCCAGGACGACTTGTTGGCCCGAGCTCTTGCTCAGGGCCCCAAGACAGTTGATGTGCCA
GCCTCCCTCCCAACACCACCTCATAACAATCAGGAAGAATTAAGGATACAGGATCACTGTGGTGATCGAGATACTCCTGACAGTTTTGTT
CCCTCATCCTCTCCTGAGAGTGTGGTTGGGGTAGAAGTGAGCAGGTATCCAGATCTGTCATTGGTCAAGGAGGAGCCTCCAGAACCGGTG
CCGTCCCCCATCATTCCAATTCTTCCTAGCACTGCTGGGAAAAGTTCAGAATCAAGAAGGAATGACATCAAAACTGAGCCAGGCACTTTA
TATTTTGCGTCACCTTTTGGTCCTTCCCCAAATGGTCCCAGATCAGGTCTTATATCTGTAGCAATTACTCTGCATCCTACAGCTGCTGAG
AACATTAGCAGTGTTGTGGCTGCATTTTCCGACCTTCTTCACGTCCGAATCCCTAACAGCTATGAGGTTAGCAGTGCTCCAGATGTCCCA
TCCATGGGTTTGGTCAGTAGCCACAGAATCAACCCGGGTTTGGAGTATCGACAGCATTTACTTCTCCGTGGGCCTCCGCCAGGATCTGCA
AACCCTCCCAGATTAGTGAGCTCTTACCGGCTGAAGCAGCCTAATGTACCATTTCCTCCAACAAGCAATGGTCTTTCTGGATATAAGGAT
TCTAGTCATGGTATTGCAGAAAGCGCAGCACTCAGACCACAGTGGTGTTGTCATTGTAAAGTGGTTATTCTTGGAAGTGGTGTGCGGAAA
TCTTTCAAAGATCTGACCCTTTTGAACAAGGATTCCCGAGAAAGCACCAAGAGGGTAGAGAAGGACATTGTCTTCTGTAGTAATAACTGC
TTTATTCTTTATTCATCAACTGCACAAGCGAAAAACTCAGAAAACAAGGAATCCATTCCTTCATTGCCACAATCACCTATGAGAGAAACG
CCTTCCAAAGCATTTCATCAGTACAGCAACAACATCTCCACTTTGGATGTGCACTGTCTCCCCCAGCTCCCAGAGAAAGCTTCTCCCCCT
GCCTCACCACCCATCGCCTTCCCTCCTGCTTTTGAAGCAGCCCAAGTCGAGGCCAAGCCAGATGAGCTGAAGGTGACAGTCAAGCTGAAG
CCTCGGCTAAGAGCTGTCCATGGTGGGTTTGAAGATTGCAGGCCGCTCAATAAAAAATGGAGAGGAATGAAATGGAAGAAGTGGAGCATT
CATATTGTAATCCCTAAGGGGACATTTAAACCACCTTGTGAGGATGAAATAGATGAATTTCTAAAGAAATTGGGCACTTCCCTTAAACCT
GATCCTGTGCCCAAAGACTATCGGAAATGTTGCTTTTGTCATGAAGAAGGTGATGGATTGACAGATGGACCAGCAAGGCTACTCAACCTT
GACTTGGATCTGTGGGTCCACTTGAACTGCGCTCTGTGGTCCACGGAGGTCTATGAGACTCAGGCTGGTGCCTTAATAAATGTGGAGCTA
GCTCTGAGGAGAGGCCTACAAATGAAATGTGTCTTCTGTCACAAGACGGGTGCCACTAGTGGATGCCACAGATTTCGATGCACCAACATT
TATCACTTCACTTGCGCCATTAAAGCACAATGCATGTTTTTTAAGGACAAAACTATGCTTTGCCCCATGCACAAACCAAAGGGAATTCAT
GAGCAAGAATTAAGTTACTTTGCAGTCTTCAGGAGGGTCTATGTTCAGCGTGATGAGGTGCGACAGATTGCTAGCATCGTGCAACGAGGA
GAACGGGACCATACCTTTCGCGTGGGTAGCCTCATCTTCCACACAATTGGTCAGCTGCTTCCACAGCAGATGCAAGCATTCCATTCTCCT
AAAGCACTCTTCCCTGTGGGCTATGAAGCCAGCCGGCTGTACTGGAGCACTCGCTATGCCAATAGGCGCTGCCGCTACCTGTGCTCCATT
GAGGAGAAGGATGGGCGCCCAGTGTTTGTCATCAGGATTGTGGAACAAGGCCATGAAGACCTGGTTCTAAGTGACATCTCACCTAAAGGT
GTCTGGGATAAGATTTTGGAGCCTGTGGCATGTGTGAGAAAAAAGTCTGAAATGCTCCAGCTTTTCCCAGCGTATTTAAAAGGAGAGGAT
CTGTTTGGCCTGACCGTCTCTGCAGTGGCACGCATAGCGGAATCACTTCCTGGGGTTGAGGCATGTGAAAATTATACCTTCCGATACGGC
CGAAATCCTCTCATGGAACTTCCTCTTGCCGTTAACCCCACAGGTTGTGCCCGTTCTGAACCTAAAATGAGTGCCCATGTCAAGAGGTTT
GTGTTAAGGCCTCACACCTTAAACAGCACCAGCACCTCAAAGTCATTTCAGAGCACAGTCACTGGAGAACTGAACGCACCTTATAGTAAA
CAGTTTGTTCACTCCAAGTCATCGCAGTACCGGAAGATGAAAACTGAATGGAAATCCAATGTGTATCTGGCACGGTCTCGGATTCAGGGG
CTGGGCCTGTATGCTGCTCGAGACATTGAGAAACACACCATGGTCATTGAGTACATCGGGACTATCATTCGAAACGAAGTAGCCAACAGG
AAAGAGAAGCTTTATGAGTCTCAGAACCGTGGTGTGTACATGTTCCGCATGGATAACGACCATGTGATTGACGCGACGCTCACAGGAGGG
CCCGCAAGGTATATCAACCATTCGTGTGCACCTAATTGTGTGGCTGAAGTGGTGACTTTTGAGAGAGGACACAAAATTATCATCAGCTCC
AGTCGGAGAATCCAGAAAGGAGAAGAGCTCTGCTATGACTATAAGTTTGACTTTGAAGATGACCAGCACAAGATTCCGTGTCACTGTGGA
GCTGTGAACTGCCGGAAGTGGATGAACTGAAATGCATTCCTTGCTAGCTCAGCGGGCGGCTTGTCCCTAGGAAGAGGCGATTCAACACAC
CATTGGAATTTTGCAGACAGAAAGAGATTTTTGTTTTCTGTTTTATGACTTTTTGAAAAAGCTTCTGGGAGTTCTGATTTCCTCAGTCCT
TTAGGTTAAAGCAGCGCCAGGAGGAAGCTGACAGAAGCAGCGTTCCTGAAGTGGCCGAGGTTAAACGGAATCACAGAATGGTCCAGCACT
TTTGCTTTTTTTTCTTTTCCTTTTCTTTTTTTTTTGTTTGTTTTTTGTTTTGTTTTTCCCTTGTGGGTGGGTTTCATTGTTTTGGTTTTC
TAGTCTCACTAAGGAGAAACTTTTACTGGGGCAAAGAGCCGATGGCTGCCCTGCCCCGGGCAGGGGCCTTCCTATGAATGTAAGACTGAA
ATCACCAGCGAGGGGGACAGAGAGTGCTGGCCACGGCCTTATTAAAAAGGGGCAGGCCCTCTAACTTCAAAATGTTTTTAAATAAAGTAG
ACACCACTGAACAAGGAATGTACTGAAATGACTTCCTTAGGGATAGAGCTAAGGGATAATAACTTGCACTAAATACATTTAAATACTTGA
TTCCATGAGTCAGTTTATTGTAGTTTTTGATTTCTGTAAAATAAGAGAAACTTTTGTATTTATTATTGAATAAGTGAATGAAGCTATTTT
TAAATAAAGTTAGAAGAAAGCCAAGCTGCTGCTGTTACCTGCAGAACTAACAAACCCTGTTACTTTGTACAGATATGTAAATATTTTGAG
AAAAAATACAGTATAAAAATAGTTATTGACCAAATGCTACCAGGCTCTGCAGCAGCTCGGGGGCTTATAAAATGTTCATAGGGATGTTAC
AATATAATTTTGTGTTATAAAATATGCCATTATAATTATGTAATAACCAAAATTTCAACCTAGAGTGTTGGGGGTTTTTTGGAAACCGCA
GTCTATTAGTACTCAATGGTTTTATACACCTTACTTCTGACAGAGCGGGGCGTATGCTACGACTACAACTTTTATAGCTGTTTTGGTAAT
TTAAACTAATTTTTTCATATTATATTGTTGCATCCCTACTTCTTCAGTCAGGTTTTTTTGTGCTTACAATTTGTGATAACTGTGAATAAC
TGCTTAAAAATACACCCAAATGGAGGCTGAATTTTTTCTTCAGCAAAAGTAGTTTTGATTAGAACTTTGTTTCAGCCACAGAGAATCATG
TAAACGTAATAGGATCATGTAGCAGAAACTTAAATCTAACCCTTTAGCCTTCTATTTAACACAAAAATTTGAAAAAGTTAAAAAAAAAAA
GGAGATGTGATTATGCTTACAGCTGCAGGACTCTGGCAATAGGGTTTTTGGAAGATGTAATTTTAAAATGTGTTTGTATGAACTGTTTGT
TTACATTTCTTTAATAAAAAAAACACTGTTTTGTGTTTGCTTGTAGAAACTTAATCAGCATTTTGAACCAGGTTAGCTTTTTATTTTGTA
CTTAAAATTCTGGTACTGACACTTCACAGGCTAAGTATAAAATGAAGTTTTGTGTGCACAATTCAAGTGGACTGTAAACTGTTGGTATAT
TCAGTGATGCAGTTCTGAACTTGTATATGGCATGATGTATTTTTATCTTACAGAATAAATCAATTGTATATATTTTTCTCTTGATAAATA
GCTGTATGAAATTTGTTTCCTGAATATTTTTCTTCTCTTGTACAATATCCTGACATCCTACCAGTATTTGTCCTACCGGGTTTTTGTTGT
TTTCTGTTCTGTATAATAGTATCTAATGTTGGCAAAAATTGAATTTTTTGAAGTATACAGAGTGTTATGGGTTTTGGAATTTGTGGACAC


Top

FusionGenePPI for PRKAG2_KMT2C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PRKAG2PRKAB1, PRKAB2, PRKAG1, PRKAA2, PRKAA1, MAP1B, MAP1LC3A, PGK1, PFAS, FKBP4, EIF3A, TARS, GMPS, GANAB, MAP1A, ASNS, ELAVL1, WDR83, DCLRE1C, NF2, STIM2, GEMIN2, PHKG2, NEFHKMT2CAK1, NCOA6, ASH2L, RBBP5, HIST2H3C, ASCL2, KDM6A, SMARCB1, MAPK14, JUN, PAXIP1, H3F3A, PAGR1, WDR82, CDC73, TSC22D1, KDM4B, ELAVL1, WDR5, HIST1H3A, APPL2, ERP44, HIST3H3, DPY30, MTNR1B, FOXA1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PRKAG2_KMT2C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PRKAG2_KMT2C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePRKAG2C0043202Wolff-Parkinson-White Syndrome4CTD_human;HPO;UNIPROT
HgenePRKAG2C1833236CARDIOMYOPATHY, FAMILIAL HYPERTROPHIC, 6 (disorder)3CTD_human;UNIPROT
HgenePRKAG2C1849813Glycogen Storage Disease of Heart, Lethal Congenital1CTD_human;ORPHANET;UNIPROT
TgeneKMT2CC0001418Adenocarcinoma1CTD_human
TgeneKMT2CC0005695Bladder Neoplasm1CTD_human
TgeneKMT2CC0007138Carcinoma, Transitional Cell1CTD_human
TgeneKMT2CC0010606Adenoid Cystic Carcinoma1CTD_human
TgeneKMT2CC0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneKMT2CC0023897Liver Diseases, Parasitic1CTD_human
TgeneKMT2CC0036920Sezary Syndrome1CTD_human
TgeneKMT2CC0038356Stomach Neoplasms1CTD_human
TgeneKMT2CC0206698Cholangiocarcinoma1CTD_human
TgeneKMT2CC0279626Squamous cell carcinoma of esophagus1CTD_human
TgeneKMT2CC2239176Liver carcinoma1CTD_human