FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2861

FusionGeneSummary for ARSG_AP2B1

check button Fusion gene summary
Fusion gene informationFusion gene name: ARSG_AP2B1
Fusion gene ID: 2861
HgeneTgene
Gene symbol

ARSG

AP2B1

Gene ID

22901

163

Gene namearylsulfatase Gadaptor related protein complex 2 subunit beta 1
Synonyms-ADTB2|AP105B|AP2-BETA|CLAPB1
Cytomap

17q24.2

17q12

Type of geneprotein-codingprotein-coding
Descriptionarylsulfatase GASGAP-2 complex subunit betaadapter-related protein complex 2 beta subunitadapter-related protein complex 2 subunit betaadaptin, beta 2 (beta)adaptor protein complex AP-2 subunit betaadaptor related protein complex 2 beta 1 subunitadaptor-related prote
Modification date2018052220180522
UniProtAcc

Q96EG1

P63010

Ensembl transtripts involved in fusion geneENST00000448504, ENST00000452479, 
ENST00000582154, 
ENST00000262325, 
ENST00000592545, ENST00000538556, 
ENST00000312678, ENST00000589344, 
ENST00000537622, ENST00000545922, 
Fusion gene scores* DoF score10 X 8 X 3=2409 X 10 X 7=630
# samples 910
** MAII scorelog2(9/240*10)=-1.41503749927884
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/630*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARSG [Title/Abstract] AND AP2B1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARSG

GO:0006790

sulfur compound metabolic process

18283100


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-1103-01AARSGchr17

66366665

+AP2B1chr17

34044214

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000448504ENST00000262325ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000448504ENST00000592545ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000448504ENST00000538556ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000448504ENST00000312678ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000448504ENST00000589344ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000448504ENST00000537622ARSGchr17

66366665

+AP2B1chr17

34044214

+
5CDS-3UTRENST00000448504ENST00000545922ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000262325ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000592545ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000538556ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000312678ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000589344ARSGchr17

66366665

+AP2B1chr17

34044214

+
In-frameENST00000452479ENST00000537622ARSGchr17

66366665

+AP2B1chr17

34044214

+
5CDS-3UTRENST00000452479ENST00000545922ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000262325ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000592545ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000538556ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000312678ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000589344ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3CDSENST00000582154ENST00000537622ARSGchr17

66366665

+AP2B1chr17

34044214

+
3UTR-3UTRENST00000582154ENST00000545922ARSGchr17

66366665

+AP2B1chr17

34044214

+

Top

FusionProtFeatures for ARSG_AP2B1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARSG

Q96EG1

AP2B1

P63010

Displays arylsulfatase activity at acidic pH withpseudosubstrates, such as p-nitrocatechol sulfate and also, butwith lower activity, p-nitrophenyl sulfate and 4-methylumbelliferyl sulfate. {ECO:0000269|PubMed:18283100}. Component of the adaptor protein complex 2 (AP-2).Adaptor protein complexes function in protein transport viatransport vesicles in different membrane traffic pathways. Adaptorprotein complexes are vesicle coat components and appear to beinvolved in cargo selection and vesicle formation. AP-2 isinvolved in clathrin-dependent endocytosis in which cargo proteinsare incorporated into vesicles surrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with theearly endosome. The clathrin lattice serves as a mechanicalscaffold but is itself unable to bind directly to membranecomponents. Clathrin-associated adaptor protein (AP) complexeswhich can bind directly to both the clathrin lattice and to thelipid and protein components of membranes are considered to be themajor clathrin adaptors contributing the CCV formation. AP-2 alsoserves as a cargo receptor to selectively sort the membraneproteins involved in receptor-mediated endocytosis. AP-2 seems toplay a role in the recycling of synaptic vesicle membranes fromthe presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi)and [ED]-X-X-X-L-[LI] endocytosis signal motifs within thecytosolic tails of transmembrane cargo molecules. AP-2 may alsoplay a role in maintaining normal post-endocytic traffickingthrough the ARF6-regulated, non-clathrin pathway. The AP-2 betasubunit acts via its C-terminal appendage domain as a scaffoldingplatform for endocytic accessory proteins; at least some clathrin-associated sorting proteins (CLASPs) are recognized by their [DE]-X(1,2)-F-X-X-[FL]-X-X-X-R motif. The AP-2 beta subunit binds toclathrin heavy chain, promoting clathrin lattice assembly;clathrin displaces at least some CLASPs from AP2B1 which probablythen can be positioned for further coat assembly.{ECO:0000269|PubMed:14745134, ECO:0000269|PubMed:14985334,ECO:0000269|PubMed:15473838, ECO:0000269|PubMed:19033387}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAP2B1chr17:66366665chr17:34044214ENST00000262325+1821576_716861938Compositional biasNote=Pro-rich (stalk region)
TgeneAP2B1chr17:66366665chr17:34044214ENST00000312678+1922576_716875952Compositional biasNote=Pro-rich (stalk region)
TgeneAP2B1chr17:66366665chr17:34044214ENST00000537622+1922576_716875952Compositional biasNote=Pro-rich (stalk region)
TgeneAP2B1chr17:66366665chr17:34044214ENST00000538556+1922576_716804881Compositional biasNote=Pro-rich (stalk region)
TgeneAP2B1chr17:66366665chr17:34044214ENST00000589344+1922576_716875952Compositional biasNote=Pro-rich (stalk region)


Top

FusionGeneSequence for ARSG_AP2B1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_404aa
MGWLFLKVLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGMRFVDFHAAASTCSPSRAS
LLTGRLGLRNGVTRNFAVTSVGGLPLNETTLAEVLQQAGYVTGIIGKWHLGHHGSYHPNFRGFDYYFGIPYSHDMGCTDTPGYNHPPCPA
CPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPLPVTQLPAAPRGRSLYG
AGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLT

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_240aa
MGCTDTPGYNHPPCPACPQGDGPSRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHVPL
PVTQLPAAPRGRSLYGAGLWEMDSLVGQIKDKVDHTVKENTFLWFTGDNGPWAQKCELAGSVGPFTGFWQTRQDTVSSKLQNNNVYTIAK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_1212nt
ATGGGCTGGCTTTTTCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAA
ACAAGAGGACAGAAGCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGAC
ACTGCCAACCTTGATAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCC
TTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACC
TTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTC
CGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCG
TGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTG
GAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCC
TTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGT
GCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACA
GGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTT
TCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACT
AATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCT

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_720nt
ATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGAC
TGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCT
GAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTA
CCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAG
GACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGC
AGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAG
AGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGA
AACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_4726nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG
GAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTAGTCTAACCTGTGCTAACATTAGGGCAC
AACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCACCTCTTGCCACCTGCTGCTGCTATCTGT
CCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGTGTAGTTTGGTATTTTGTAATTGAGAGC
TCATTTCAAAAGCAGAAAAAGACAACAAATATTAAAGCAAGGAAAAGTGTAACTGAAACACTGCACTTTACTGTTTTATACTTTTGTACA
TATGAGAAATCAAGGGATTAGTGCAACCAGTAGAAAGCATTGAAATGACTGTCATTAACCACACAGTCCTGGAGGCAGAGATGCAGTTAC
CTACCCTAGCTTTTGATGGGTTCTCTTACCTGTAGTAGCCTTATCCCTGGTCATTTGGATTTTCAGTTTGCTTTTTTCTTTTTTTCCCCT
CCAAACTCCTTTTCCTTGGCCAAGCCTTCATGCTTCCCCCTTTCCATATTATAATCTCATTTGATTGCTCTGCAGTTGGGAACGGTGATC
TTCTTGAATGATGTTTCAGTGTGCAAAAACTATAGAGCCTGTCAGCACCAAAGCTGACAGAAGTTATACCTTACTCCTTTCCTTTCCCCT
GAACAAACCTGCTAATCCCACTAATTCAGGAATTTGAGTAGAGATGGGGAACAAGAACCCAGATGCTGTCCCCTCACCCCCTCTCCTGTA
TTTCTCAGGTCCAGTTCAAATCTAAAATTCTACTTTTAGAGTTGAAACAGAGTAATAACTTATCTAACCCTCTTTTCCTACAAAGGAGAA
AGATAAAAGGCACAAAGGTTACCGCCAAGGCCCGTCAGCTGTGTAGTGGCAAAGCCGAGACCGAGTCTCCTAAGTCCCCGTCAGTGTGGT
TTTCACCACAGGACTGTCTCTTGTCGTTTTCCCCTAATGCCTTCTCCTGCCTTTTCTGTGCCTAGTTTTTGGCTCTTCACATATTCCATA
TTGATTTTGACGCTCTGTATATTGGCATCAGGTGGCAGCTGAATATCTTTTGAATTACTCGAAGGTAAAGCCAGATGCCAGAATGAAGGT
GTAGCCAGTGTTTCCCATATGCCCCTGGAGCCCCACTTATTGAGGCCAGCAGAATAGGTGCAGAGATGAAGTGAGCTTAGAGATGTTGCA
AATGCTCTTTATCCCTTCAGCTCTCTGATCTGCTCTTTCTTCATGATACTTAGTCTGCAGGGCATATTAAGATCATCCCAGAGGTTCAGG
CAGTTCCTGTCATCTCTGAAAAGACTGGGGGATATGAAATCTTCCCCCTACCCCACTTAATGCGTTGGATATGATTTTTCAAAGAATGCT
TCATGCCCAAAATACCAGCCTGTTTAGCAGTGTTACACTGTTTGATCTGCGGGCACTTGTTGCATTGCCTGGCACCCAATATTCAGGGTC
CATGACTAAGACTGGTCTTCTCAGATGCCCTGCTTAAATCAGGGGCACTTCAGGCTCCACAGGCGTCATGTTGGACTGAGACCTAACTCA
CTGGACTCAGAGGAGGAATCGTGGAAAACAAGAGCAAAACTACCCCACACCCCTATTTCATGTCTGAAATAACCCTGTTTCATACCAGTT
GCAAAGCTTGTGGGGAGCGGTCCCACAAAGCACTTTCTTAAACCTTGAGAATCTCCAAGAGAAAAATATTTGGGGAAGGAGGGAGGAAAT
ATGTCCCTTGCACACCACCCCTGAAGCACATGGCAGTAGGAAACAGCATAGGATTGTATGTGGGAGGTGGATAGGTCGGTGATGTGTGGA
GCGGAAAAGCAGGTTGGTAAAGTTCCCTTCTTGGGACTTATTCCTGGAGTCAGTGGATACAAGTAGTGCAGAAGGTTCACACTGCAAATA
GTGTTCTCATCTCAAAGCAAACTATCATTCCAGAAGGAAAAGTGTGTCAGGGCAAGCAGACAACACAATTTCCTATCAGAATATGTCCCT
CAACCCCCGAAACAAGGCTTCTCTCAGCCTCCCCACCAGTGATGGATAACAGCTCCTATTCTCAGCTGACCTGACTGAGCCAACCCATGA
ACTCTTCACTCCTTGGGGAAGCCACCTCCCATCACACCCCTGAGCAGAGTTAGGGAGGAATTCTACTTCCCATAAAAGGACCTCTCCTGA
GAGGCAAAACCTGTTGCCTCCACCACGGCTTCCCTCTTGGCTCATTCCAAGCTTGGCCAAATTGGGGAAGTGGGATGGAGGTTGCCCTGC
ATCCCCCCTCCTCTGCCTGAGTGTGTCTTTGTAATGTCAGCTGGCATCATACAAAGAGCAGGAGAAGCAAACACCCAGAACTCTTTTGCT
GGTCAGAGATTCCCTGAGTGTCTGTCCTCACCCAAGCCTGCTCTGTGTCTGTGTTGTGAAGCTTGAGACTCTGGAAAGAAATGGGGAGGG
GGGGCAGGGGAAATGTTGCCCTAAGAATGCTTCTCATTCCTCTGTTCTTATTGGGTCCTGTTTTTCGGGAGGGTGGGGGTTGGGGGAAGC

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_2395nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG
GAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTAGTCTAACCTGTGCTAACATTAGGGCAC
AACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCACCTCTTGCCACCTGCTGCTGCTATCTGT
CCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGTGTAGTTTGGTATTTTGTAATTGAGAGC

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_2395nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG
GAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTAGTCTAACCTGTGCTAACATTAGGGCAC
AACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCACCTCTTGCCACCTGCTGCTGCTATCTGT
CCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGTGTAGTTTGGTATTTTGTAATTGAGAGC

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_2684nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG
GAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTAGTCTAACCTGTGCTAACATTAGGGCAC
AACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCACCTCTTGCCACCTGCTGCTGCTATCTGT
CCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGTGTAGTTTGGTATTTTGTAATTGAGAGC
TCATTTCAAAAGCAGAAAAAGACAACAAATATTAAAGCAAGGAAAAGTGTAACTGAAACACTGCACTTTACTGTTTTATACTTTTGTACA
TATGAGAAATCAAGGGATTAGTGCAACCAGTAGAAAGCATTGAAATGACTGTCATTAACCACACAGTCCTGGAGGCAGAGATGCAGTTAC
CTACCCTAGCTTTTGATGGGTTCTCTTACCTGTAGTAGCCTTATCCCTGGTCATTTGGATTTTCAGTTTGCTTTTTTCTTTTTTTCCCCT

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_2074nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG

>In-frame_ARSG_ENST00000448504_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_2398nt
GGCTGCGCCCAGGCCGGCGGGCCCAGCAGCTGCGAACCGCCGGCGCACCACCTGTTTCCGCGCCCGGGGACTTCCCCGGCGGGGCTCAGA
AGTGTGGGATCGGTCGCTTGGCTTCCCCTGGCGTCAGCGACCCAGGGTAACCTCCTCCACTGCTGCGTGCCGTGCAGGCCTGCCTGTGTG
AGAGCCACGTGTGCCGCGCTCTGGGCACAGCCTTGGAAAGTCAGGACCGCGACGGCAGCAGAGCAGAAACCTTACAGAAACATGAAGCCC
TCAACCATCTGCTACTCAGTTATTCGGGGCTGACGGCGGCTTCTAGAACATCCAGGTGTTCTGCAGATGCGAGAACTCATCCTGTAGTCA
CCAGATGGAGTCCCAAACAGCCAAGCAGATGTAAGGCCTGTGCTGTGGCTCTGAGGCCCTGAATACAGAAGGGTCACTTTCTTAGTGGCC
AAAGAGCAGTTGTTGACATTGATGTCTAATTATTGAACACGACCAGTCATTTTACTGAGCTGCGGTGAGGAAACACTGACCATAGAAGAT
CAAGCCAAATGAGGGATTGCAAATTTCCTGATTCTTTTGAATTAGGATTCCAGATGGGGGCCTCATTTCTACAGCCCCCAACATTCCTAT
AGCCGTTATCACTGCCATCACCACTGCCACCAGCATCTTCTTGCAGATTCCACCCCTGCTCCCCAGAGACTTCCTGCTTTGAAAGTGAGC
AGAAAGGAAGCTCTCAGAAAAATCTCTAGTGGTGGCTGCCGTCGCTCCAGACAATCGGAATCCTGCCTTCACCACCATGGGCTGGCTTTT
TCTAAAGGTTTTGTTGGCGGGAGTGAGTTTCTCAGGATTTCTTTATCCTCTTGTGGATTTTTGCATCAGTGGGAAAACAAGAGGACAGAA
GCCAAACTTTGTGATTATTTTGGCCGATGACATGGGGTGGGGTGACCTGGGAGCAAACTGGGCAGAAACAAAGGACACTGCCAACCTTGA
TAAGATGGCTTCGGAGGGAATGAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACCCTCCCGGGCTTCCTTGCTCACCGGCCG
GCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCTCAACGAGACCACCTTGGCAGAGGTGCT
GCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTATCACCCCAACTTCCGTGGTTTTGATTA
CTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCCTCCTTGTCCAGCGTGTCCACAGGGTGA
TGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAACCTCAACATTGTGGAGCAGCCGGTGAA
CTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCACCAGCGGGAGGCCCTTCCTGCTCTATGT
GGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAGAAGCCTGTATGGTGCAGGGCTCTGGGA
GATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATTCCTCTGGTTTACAGGAGACAATGGCCC
GTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCGTCAAGACACTGTTTCCAGCAAGTTGCA
AAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATCCCTGAAGCTCACTAATGGCATTTGGAT
TTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGCTCCTGAAGTCTCTCAATACATCTATCA
GGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGATCGGTGCAAGTCAAGAACTCTTAACTG
GAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTAGTCTAACCTGTGCTAACATTAGGGCAC
AACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCACCTCTTGCCACCTGCTGCTGCTATCTGT
CCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGTGTAGTTTGGTATTTTGTAATTGAGAGC

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000262325_chr17_34044214_+_3763nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA
TCGGTGCAAGTCAAGAACTCTTAACTGGAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTA
GTCTAACCTGTGCTAACATTAGGGCACAACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCAC
CTCTTGCCACCTGCTGCTGCTATCTGTCCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGT
GTAGTTTGGTATTTTGTAATTGAGAGCTCATTTCAAAAGCAGAAAAAGACAACAAATATTAAAGCAAGGAAAAGTGTAACTGAAACACTG
CACTTTACTGTTTTATACTTTTGTACATATGAGAAATCAAGGGATTAGTGCAACCAGTAGAAAGCATTGAAATGACTGTCATTAACCACA
CAGTCCTGGAGGCAGAGATGCAGTTACCTACCCTAGCTTTTGATGGGTTCTCTTACCTGTAGTAGCCTTATCCCTGGTCATTTGGATTTT
CAGTTTGCTTTTTTCTTTTTTTCCCCTCCAAACTCCTTTTCCTTGGCCAAGCCTTCATGCTTCCCCCTTTCCATATTATAATCTCATTTG
ATTGCTCTGCAGTTGGGAACGGTGATCTTCTTGAATGATGTTTCAGTGTGCAAAAACTATAGAGCCTGTCAGCACCAAAGCTGACAGAAG
TTATACCTTACTCCTTTCCTTTCCCCTGAACAAACCTGCTAATCCCACTAATTCAGGAATTTGAGTAGAGATGGGGAACAAGAACCCAGA
TGCTGTCCCCTCACCCCCTCTCCTGTATTTCTCAGGTCCAGTTCAAATCTAAAATTCTACTTTTAGAGTTGAAACAGAGTAATAACTTAT
CTAACCCTCTTTTCCTACAAAGGAGAAAGATAAAAGGCACAAAGGTTACCGCCAAGGCCCGTCAGCTGTGTAGTGGCAAAGCCGAGACCG
AGTCTCCTAAGTCCCCGTCAGTGTGGTTTTCACCACAGGACTGTCTCTTGTCGTTTTCCCCTAATGCCTTCTCCTGCCTTTTCTGTGCCT
AGTTTTTGGCTCTTCACATATTCCATATTGATTTTGACGCTCTGTATATTGGCATCAGGTGGCAGCTGAATATCTTTTGAATTACTCGAA
GGTAAAGCCAGATGCCAGAATGAAGGTGTAGCCAGTGTTTCCCATATGCCCCTGGAGCCCCACTTATTGAGGCCAGCAGAATAGGTGCAG
AGATGAAGTGAGCTTAGAGATGTTGCAAATGCTCTTTATCCCTTCAGCTCTCTGATCTGCTCTTTCTTCATGATACTTAGTCTGCAGGGC
ATATTAAGATCATCCCAGAGGTTCAGGCAGTTCCTGTCATCTCTGAAAAGACTGGGGGATATGAAATCTTCCCCCTACCCCACTTAATGC
GTTGGATATGATTTTTCAAAGAATGCTTCATGCCCAAAATACCAGCCTGTTTAGCAGTGTTACACTGTTTGATCTGCGGGCACTTGTTGC
ATTGCCTGGCACCCAATATTCAGGGTCCATGACTAAGACTGGTCTTCTCAGATGCCCTGCTTAAATCAGGGGCACTTCAGGCTCCACAGG
CGTCATGTTGGACTGAGACCTAACTCACTGGACTCAGAGGAGGAATCGTGGAAAACAAGAGCAAAACTACCCCACACCCCTATTTCATGT
CTGAAATAACCCTGTTTCATACCAGTTGCAAAGCTTGTGGGGAGCGGTCCCACAAAGCACTTTCTTAAACCTTGAGAATCTCCAAGAGAA
AAATATTTGGGGAAGGAGGGAGGAAATATGTCCCTTGCACACCACCCCTGAAGCACATGGCAGTAGGAAACAGCATAGGATTGTATGTGG
GAGGTGGATAGGTCGGTGATGTGTGGAGCGGAAAAGCAGGTTGGTAAAGTTCCCTTCTTGGGACTTATTCCTGGAGTCAGTGGATACAAG
TAGTGCAGAAGGTTCACACTGCAAATAGTGTTCTCATCTCAAAGCAAACTATCATTCCAGAAGGAAAAGTGTGTCAGGGCAAGCAGACAA
CACAATTTCCTATCAGAATATGTCCCTCAACCCCCGAAACAAGGCTTCTCTCAGCCTCCCCACCAGTGATGGATAACAGCTCCTATTCTC
AGCTGACCTGACTGAGCCAACCCATGAACTCTTCACTCCTTGGGGAAGCCACCTCCCATCACACCCCTGAGCAGAGTTAGGGAGGAATTC
TACTTCCCATAAAAGGACCTCTCCTGAGAGGCAAAACCTGTTGCCTCCACCACGGCTTCCCTCTTGGCTCATTCCAAGCTTGGCCAAATT
GGGGAAGTGGGATGGAGGTTGCCCTGCATCCCCCCTCCTCTGCCTGAGTGTGTCTTTGTAATGTCAGCTGGCATCATACAAAGAGCAGGA
GAAGCAAACACCCAGAACTCTTTTGCTGGTCAGAGATTCCCTGAGTGTCTGTCCTCACCCAAGCCTGCTCTGTGTCTGTGTTGTGAAGCT
TGAGACTCTGGAAAGAAATGGGGAGGGGGGGCAGGGGAAATGTTGCCCTAAGAATGCTTCTCATTCCTCTGTTCTTATTGGGTCCTGTTT

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000592545_chr17_34044214_+_1432nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA
TCGGTGCAAGTCAAGAACTCTTAACTGGAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTA
GTCTAACCTGTGCTAACATTAGGGCACAACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCAC
CTCTTGCCACCTGCTGCTGCTATCTGTCCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGT

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000538556_chr17_34044214_+_1432nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA
TCGGTGCAAGTCAAGAACTCTTAACTGGAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTA
GTCTAACCTGTGCTAACATTAGGGCACAACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCAC
CTCTTGCCACCTGCTGCTGCTATCTGTCCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGT

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000312678_chr17_34044214_+_1721nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA
TCGGTGCAAGTCAAGAACTCTTAACTGGAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTA
GTCTAACCTGTGCTAACATTAGGGCACAACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCAC
CTCTTGCCACCTGCTGCTGCTATCTGTCCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGT
GTAGTTTGGTATTTTGTAATTGAGAGCTCATTTCAAAAGCAGAAAAAGACAACAAATATTAAAGCAAGGAAAAGTGTAACTGAAACACTG
CACTTTACTGTTTTATACTTTTGTACATATGAGAAATCAAGGGATTAGTGCAACCAGTAGAAAGCATTGAAATGACTGTCATTAACCACA
CAGTCCTGGAGGCAGAGATGCAGTTACCTACCCTAGCTTTTGATGGGTTCTCTTACCTGTAGTAGCCTTATCCCTGGTCATTTGGATTTT
CAGTTTGCTTTTTTCTTTTTTTCCCCTCCAAACTCCTTTTCCTTGGCCAAGCCTTCATGCTTCCCCCTTTCCATATTATAATCTCATTTG

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000589344_chr17_34044214_+_1111nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA

>In-frame_ARSG_ENST00000452479_chr17_66366665_+_AP2B1_ENST00000537622_chr17_34044214_+_1435nt
GCGCCGGTCGCGCGCCCGCCAGCCTGCCGCCTGGGCTGGGGGTCACGAAAGGTTTGTGGATTTCCATGCAGCTGCCTCCACCTGCTCACC
CTCCCGGGCTTCCTTGCTCACCGGCCGGCTTGGCCTTCGCAATGGAGTCACACGCAACTTTGCAGTCACTTCTGTGGGAGGCCTTCCGCT
CAACGAGACCACCTTGGCAGAGGTGCTGCAGCAGGCGGGTTACGTCACTGGGATAATAGGCAAATGGCATCTTGGACACCACGGCTCTTA
TCACCCCAACTTCCGTGGTTTTGATTACTACTTTGGAATCCCATATAGCCATGATATGGGCTGTACTGATACTCCAGGCTACAACCACCC
TCCTTGTCCAGCGTGTCCACAGGGTGATGGACCATCAAGGAACCTTCAAAGAGACTGTTACACTGACGTGGCCCTCCCTCTTTATGAAAA
CCTCAACATTGTGGAGCAGCCGGTGAACTTGAGCAGCCTTGCCCAGAAGTATGCTGAGAAAGCAACCCAGTTCATCCAGCGTGCAAGCAC
CAGCGGGAGGCCCTTCCTGCTCTATGTGGCTCTGGCCCACATGCACGTGCCCTTACCTGTGACTCAGCTACCAGCAGCGCCACGGGGCAG
AAGCCTGTATGGTGCAGGGCTCTGGGAGATGGACAGTCTGGTGGGCCAGATCAAGGACAAAGTTGACCACACAGTGAAGGAAAACACATT
CCTCTGGTTTACAGGAGACAATGGCCCGTGGGCTCAGAAGTGTGAGCTAGCGGGCAGTGTGGGTCCCTTCACTGGATTTTGGCAAACTCG
TCAAGACACTGTTTCCAGCAAGTTGCAAAACAACAATGTTTATACTATTGCCAAGAGGAATGTGGAAGGGCAGGACATGCTGTACCAATC
CCTGAAGCTCACTAATGGCATTTGGATTTTGGCCGAACTACGTATCCAGCCAGGAAACCCCAATTACACGCTGTCACTGAAGTGTAGAGC
TCCTGAAGTCTCTCAATACATCTATCAGGTCTACGACAGCATTTTGAAAAACTAACAAGACTGGTCCAGTACCCTTCAACCATGCTGTGA
TCGGTGCAAGTCAAGAACTCTTAACTGGAAGAAATTGTATTGCTGCGTAGAATCTGAACACACTGAGGCCACCTAGCAAGGTAGTAACTA
GTCTAACCTGTGCTAACATTAGGGCACAACCTGTTGGATAGTTTTAGCTTCCTGTGAACATTTGTAACCACTGCTTCAGTCACCTCCCAC
CTCTTGCCACCTGCTGCTGCTATCTGTCCTTACTTGTGGGCTTCTCCATGCTGTGCCAATGGCTGGCTTTTTCTACACCCTCTTTTGAGT


Top

FusionGenePPI for ARSG_AP2B1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARSGPTPRK, SRPK2, SUMF1, YDJC, GSK3A, TMEM214, MESDC2, CTAGE5, TUBA4A, DPH1, IDE, CGRRF1, QRSL1, LYZL2, TOR3A, FBXO21, BACE2, TUBB8, SPCS1, CANX, EIF2AK3AP2B1KIAA0408, DHX58, MLH1, AP1M1, MEA1, TUBGCP4, LDLRAP1, THAP1, POM121, NECAP2, ATP6V1G1, NUP54, TERF2IP, FAM46C, RIBC2, AP1M2, AP2M1, RNPS1, TGFBR1, TGFBR2, BUB1B, CLINT1, ARRB2, OSBPL10, APC, ITSN1, SIRT7, CLTC, AMPH, CUL3, ABL1, SHC1, CRK, EPS15, ERBB2, FN1, VCAM1, DAB2, ITGA4, MMS19, RNF11, EGFR, GRB2, PLOD2, EPN1, LNPEP, NUSAP1, SEC24C, XPO7, RPA3, RPA2, RPA1, EPHA2, GTF2I, PIP5K1C, SLC25A6, KPNA2, U2AF1, RAPGEF3, TXN2, AFF4, XRCC6BP1, NEU4, AAK1, HSPB1, AP1S1, AP1S2, AP1G1, AP2A1, AP2A2, CAB39, AP2S1, COX5B, NUP50, TOMM40, VAPA, NTRK1, CEP128, ODF2, XPO1, CLTB, DBN1, FLNA, GAK, MYH9, PICALM, LIMA1, GTSE1, ANLN, MYO19, TFRC, MCM2, MEX3C, TFAP2A, DIEXF, MYO6, ARFGAP1, RUNDC3A, SNX9, UBC, OCRL, TRIM25, BRCA1, SLC2A8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneAP2B1chr17:66366665chr17:34044214ENST00000538556+1922841_937804881ARRB1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneAP2B1chr17:66366665chr17:34044214ENST00000262325+1821841_937861938ARRB1
TgeneAP2B1chr17:66366665chr17:34044214ENST00000312678+1922841_937875952ARRB1
TgeneAP2B1chr17:66366665chr17:34044214ENST00000537622+1922841_937875952ARRB1
TgeneAP2B1chr17:66366665chr17:34044214ENST00000589344+1922841_937875952ARRB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARSG_AP2B1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARSG_AP2B1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAP2B1C0086132Depressive Symptoms1PSYGENET