FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28563

FusionGeneSummary for PPWD1_NLN

check button Fusion gene summary
Fusion gene informationFusion gene name: PPWD1_NLN
Fusion gene ID: 28563
HgeneTgene
Gene symbol

PPWD1

NLN

Gene ID

23398

57486

Gene namepeptidylprolyl isomerase domain and WD repeat containing 1neurolysin
Synonyms-AGTBP|EP24.16|MEP|MOP
Cytomap

5q12.3

5q12.3

Type of geneprotein-codingprotein-coding
Descriptionpeptidylprolyl isomerase domain and WD repeat-containing protein 1spliceosome-associated cyclophilinneurolysin, mitochondrialangiotensin binding proteinendopeptidase 24.16microsomal endopeptidasemitochondrial oligopeptidase Mneurolysin (metallopeptidase M3 family)neurotensin endopeptidase
Modification date2018052320180523
UniProtAcc

Q96BP3

Q9BYT8

Ensembl transtripts involved in fusion geneENST00000261308, ENST00000535264, 
ENST00000538977, 
ENST00000380985, 
ENST00000502464, ENST00000515595, 
Fusion gene scores* DoF score2 X 2 X 2=84 X 3 X 3=36
# samples 24
** MAII scorelog2(2/8*10)=1.32192809488736log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PPWD1 [Title/Abstract] AND NLN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPWD1

GO:0000413

protein peptidyl-prolyl isomerization

20676357


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUADTCGA-50-5930-01APPWD1chr5

64875440

+NLNchr5

65076006

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000261308ENST00000380985PPWD1chr5

64875440

+NLNchr5

65076006

+
In-frameENST00000261308ENST00000502464PPWD1chr5

64875440

+NLNchr5

65076006

+
5CDS-intronENST00000261308ENST00000515595PPWD1chr5

64875440

+NLNchr5

65076006

+
In-frameENST00000535264ENST00000380985PPWD1chr5

64875440

+NLNchr5

65076006

+
In-frameENST00000535264ENST00000502464PPWD1chr5

64875440

+NLNchr5

65076006

+
5CDS-intronENST00000535264ENST00000515595PPWD1chr5

64875440

+NLNchr5

65076006

+
In-frameENST00000538977ENST00000380985PPWD1chr5

64875440

+NLNchr5

65076006

+
In-frameENST00000538977ENST00000502464PPWD1chr5

64875440

+NLNchr5

65076006

+
5CDS-intronENST00000538977ENST00000515595PPWD1chr5

64875440

+NLNchr5

65076006

+

Top

FusionProtFeatures for PPWD1_NLN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPWD1

Q96BP3

NLN

Q9BYT8

PPIase that catalyzes the cis-trans isomerization ofproline imidic peptide bonds in oligopeptides and may thereforeassist protein folding (PubMed:20676357). May be involved in pre-mRNA splicing (PubMed:11991638). {ECO:0000269|PubMed:11991638,ECO:0000269|PubMed:20676357}. Hydrolyzes oligopeptides such as neurotensin, bradykininand dynorphin A. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+71112_17450647Compositional biasNote=Poly-Arg
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711124_162450647RepeatNote=WD 2
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711168_208450647RepeatNote=WD 3
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711213_252450647RepeatNote=WD 4
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711271_309450647RepeatNote=WD 5
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711345_386450647RepeatNote=WD 6
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711401_453450647RepeatNote=WD 7
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+71180_118450647RepeatNote=WD 1

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPWD1chr5:64875440chr5:65076006ENST00000261308+711490_645450647DomainPPIase cyclophilin-type


Top

FusionGeneSequence for PPWD1_NLN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_969aa
MAAESGSDFQQRRRRRRDPEEPEKTELSERELAVAVAVSQENDEENEERWVGPLPVEATLAKKRKVLEFERVYLDNLPSASMYERSYMHR
DVITHVVCTKTDFIITASHDGHVKFWKKIEEGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQC
EWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTD
TDLYEFAKCKAYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLIN
IVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYM
EIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEEN
TIILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWDLYYYMT
QTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQP
GCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLS
KHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGY

>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_969aa
MAAESGSDFQQRRRRRRDPEEPEKTELSERELAVAVAVSQENDEENEERWVGPLPVEATLAKKRKVLEFERVYLDNLPSASMYERSYMHR
DVITHVVCTKTDFIITASHDGHVKFWKKIEEGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQC
EWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTD
TDLYEFAKCKAYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLIN
IVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYM
EIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEEN
TIILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWDLYYYMT
QTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQP
GCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLS
KHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGY

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_939aa
MRRTKSAGLDLYLWRQHWPRRGKQPHEVGISNSYLVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIE
EGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRG
DNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGS
DRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVR
ILGKQENIRVMQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYMEIKSMKKRMSELCIDFNKNLNEDDTFLVFS
KAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHADFVLEM
NTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNT
YQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSL
LRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTL
RQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYR

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_939aa
MRRTKSAGLDLYLWRQHWPRRGKQPHEVGISNSYLVLEFERVYLDNLPSASMYERSYMHRDVITHVVCTKTDFIITASHDGHVKFWKKIE
EGIEFVKHFRSHLGVIESIAVSSEGALFCSVGDDKAMKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRG
DNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGMIEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGS
DRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLPDMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVR
ILGKQENIRVMQLALFQGIAKKHRAATTIEMKASENPVLQNIQADPTIVCTSFKKNRFYMEIKSMKKRMSELCIDFNKNLNEDDTFLVFS
KAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVMKKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHADFVLEM
NTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKKKECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNT
YQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSL
LRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTL
RQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYR

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_813aa
MKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGM
IEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLP
DMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKASEN
PVLQNIQADPTIVCTSFKKNRFYMEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVM
KKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKK
KECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVL
GQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVET
DFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAA
TPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLH

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_813aa
MKVFDVVNFDMINMLKLGYFPGQCEWIYCPGDAISSVAASEKSTGKIFIYDGRGDNQPLHIFDKLHTSPLTQIRLNPVYKAVVSSDKSGM
IEYWTGPPHEYKFPKNVNWEYKTDTDLYEFAKCKAYPTSVCFSPDGKKIATIGSDRKVRIFRFVTGKLMRVFDESLSMFTELQQMRQQLP
DMEFGRRMAVERELEKVDAVRLINIVFDETGHFVLYGTMLGIKVINVETNRCVRILGKQENIRVMQLALFQGIAKKHRAATTIEMKASEN
PVLQNIQADPTIVCTSFKKNRFYMEIKSMKKRMSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDSLEKTDDDKYKITLKYPHYFPVM
KKCCIPETRRRMEMAFNTRCKEENTIILQQLLPLRTKVAKLLGYSTHADFVLEMNTAKSTSRVTAFLDDLSQKLKPLGEAEREFILNLKK
KECKDRGFEYDGKINAWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNTYQELLGLSFEQMTDAHVWNKSVTLYTVKDKATGEVL
GQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMAVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVET
DFVEVPSQMLENWVWDVDSLRRLSKHYKDGSPIADDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEYAKYCSEILGVAA
TPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPEVGMKYRNLILKPGGSLDGMDMLHNFLKREPNQKAFLMSRGLH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_2907nt
ATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAACTCAGCGAAAGA
GAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTG
GCCAAGAAGAGGAAAGTCTTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGA
GATGTTATCACCCATGTGGTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAA
GAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCT
GTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGT
GAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGA
GATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCT
TCTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGAC
ACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCT
GATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAG
ATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAAT
ATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGG
ATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAA
ATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATG
GAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCC
AAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCA
CACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAAC
ACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATG
AACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTT
ATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACT
CAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACC
TACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAA
GCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCT
GGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTC
CTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGC
GGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCA
AAACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTG
CGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAA
ATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATAT
CTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGA
AACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTA

>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_2907nt
ATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAACTCAGCGAAAGA
GAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTG
GCCAAGAAGAGGAAAGTCTTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGA
GATGTTATCACCCATGTGGTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAA
GAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCT
GTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGT
GAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGA
GATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCT
TCTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGAC
ACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCT
GATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAG
ATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAAT
ATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGG
ATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAA
ATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATG
GAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCC
AAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCA
CACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAAC
ACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATG
AACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTT
ATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACT
CAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACC
TACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAA
GCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCT
GGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTC
CTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGC
GGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCA
AAACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTG
CGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAA
ATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATAT
CTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGA
AACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTA

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_2817nt
ATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTGGCCAAGAAGAGGAAAGCAGCCACATGAAGTTGGAATT
TCGAACTCTTATTTAGTCTTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGA
GATGTTATCACCCATGTGGTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAA
GAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCT
GTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGT
GAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGA
GATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCT
TCTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGAC
ACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCT
GATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAG
ATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAAT
ATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGG
ATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAA
ATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATG
GAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCC
AAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCA
CACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAAC
ACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATG
AACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTT
ATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACT
CAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACC
TACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAA
GCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCT
GGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTC
CTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGC
GGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCA
AAACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTG
CGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAA
ATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATAT
CTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGA
AACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTA

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_2817nt
ATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTGGCCAAGAAGAGGAAAGCAGCCACATGAAGTTGGAATT
TCGAACTCTTATTTAGTCTTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGA
GATGTTATCACCCATGTGGTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAA
GAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCT
GTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGT
GAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGA
GATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCT
TCTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGAC
ACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCT
GATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAG
ATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAAT
ATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGG
ATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAA
ATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATG
GAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCC
AAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCA
CACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAAC
ACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATG
AACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTT
ATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACT
CAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACC
TACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAA
GCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCT
GGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTC
CTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGC
GGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCA
AAACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTG
CGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAA
ATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATAT
CTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGA
AACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTA

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_2439nt
ATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCA
GGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCAT
ATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATG
ATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTT
GCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATT
TTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCA
GACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACT
GGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAA
AATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAAT
CCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAG
AAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCT
CTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATG
AAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAG
CTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACA
AGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAA
AAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAG
TATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGA
CTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTG
GGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGAT
GGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTG
AGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACT
GACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGA
AGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGC
AAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCT
ACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTT
TCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCT
GGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCAT

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_2439nt
ATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCA
GGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCAT
ATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATG
ATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTT
GCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATT
TTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCA
GACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACT
GGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAA
AATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAAT
CCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAG
AAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCT
CTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATG
AAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAG
CTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACA
AGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAA
AAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAG
TATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGA
CTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTG
GGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGAT
GGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTG
AGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACT
GACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGA
AGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGC
AAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCT
ACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTT
TCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCT
GGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_9347nt
AGAAGACTGCGCCGCTGCTTTGGGATTGGTAGCTGAGTTTTGTGTCGCGCCTTTTCTGACGATGCGAACAACATGGCGGCGGAAAGTGGT
AGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAACTCAGCGAAAGAGAGCTGGCAGTAGCAGTG
GCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTGGCCAAGAAGAGGAAAGTC
TTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGAGATGTTATCACCCATGTG
GTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAGAGGGAATTGAATTTGTT
AAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTGTGGGTGATGATAAAGCA
ATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCA
GGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCAT
ATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATG
ATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTT
GCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATT
TTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCA
GACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACT
GGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAA
AATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAAT
CCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAG
AAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCT
CTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATG
AAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAG
CTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACA
AGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAA
AAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAG
TATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGA
CTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTG
GGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGAT
GGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTG
AGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACT
GACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGA
AGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGC
AAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCT
ACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTT
TCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCT
GGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCAT
GCTCCGTGAACTGGGGATCTTTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGCCTGGAAACTGAAGGGAG
TTTTGCAAGTGAAAATTTAGATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAATGGAATTATAAATACTG
TGACCTAAGAAAAGACCCACTAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTATGAAAGTTTCATATGAA
TGTAACTTGATTTTTTACTATTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCATATATATGATATAATTT
GATCCTTCTTGTATCTTGAAGTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGTAAATATTTTCTTGGAGC
TCTGTGTCAACTTTGATCCTTTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGGGGAATATGCCTCAGTGA
TGCATTTATCTTTGTATATCAGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTCAGTTTTGTCTTTTCTGT
CTAAAGTTCAGTCAAAGAGTATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCTTGTATTAGAGGATTTCG
TAGCTTTTATTAGAGGCTCATTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGAATACTAAAGCAAGTCCA
AGCACATTTTTCTCTTCTCACGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAAAGTGTCAGGTAGACATG
TCACAAATGGCTCTGTAGAGAGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTCCAGAAGAGGAGTGGGTT
TTGGATAGAAGCATTTGAGGACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGACTCTTCAGTAGCCTGTT
CTGTCTGGTGATTTTTATTTTAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCCAATTCTGCAGCAGATCA
GTAAACTCACAGTATTTTTCCTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAAAAAAACAACTTTGAATT
CCCCTGCCTAGGTCTTCCAGTTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTAGCACCTTCCGATTCTCT
AGTCCAAATGAACTTTGTGCTAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCAAGAGCTAGGAGATTCCT
AGATTATATCTGCCAAGCAAATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTGCCCAGCCCTTCTCTTCC
CACACACTCACTCAATGTCACCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTTTTCTCACATCTTTCCCC
CTAGACTTTTCTGTTTTTCAGTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAACTTTACCACTTGAAATC
TTATTTCATAGAAAAACTAAATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATGAACTCATATTTCTTTCA
TACTTTAACGTTAAAACCGAAATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCTAATATTTAAAATCTACC
AAAGAGCAGTCACAAAATTAAAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGAGGATCA
CCTGAGGTCAGAGTTCAAGACCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGGGCATGATGTTGGGTTCC
TGTAGTCCCAGCTACTTAGGAGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCTGAGATCATGCCATTGCA
CTCCAGCCTGGACGACAGAGTGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTTAAAAGAAAGGACTTTTT
AAAAATTCTCTAGCATAATTCAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGTTCTTTTTTTCCAGATCA
GAGCAGAGAATATCACTGACATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTTTAGATTTATGGACTGAG
CCACATATAATAAGGTCTCTCCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTTTTAGGCATTGTTATGTT
GTGAAGGATAAAATCTTCAACATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATGCTGCAGAGAAGAGAAAT
GTCTTGACGTTTTGCCACCTGATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAACAACTAAAAATTGCCTTG
AGTTATCACCTGAGCTACTTATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTAGCTCTTCGGATGAAAAA
TTGCATTGTGGGAGATACCAAAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTTGTAAATGCCTTAAGTAG
CAGGCAGTGACTCAATTTTCTACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGATTCTGCCTCCCCACTAG
GCCAGTGTGTGTTTACCATTTATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACATTAAAATACCATCATACT
TCAGGCTTCTATAACAAAATATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGGAAGTCCCACAATCCACA
TGCTGGTAAATTTGGTTCGTGGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAGACATGTTACAAATAGCT
CTGTAGAGAGCCATGGGAAGAGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCAGTGGCAGGGAGCAAGCC
CTAGAGTGTCTCTTTTTACGAGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCAGTCACCCCCAACAAAGG
CCCCACCCCCTAACCCCATCACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCATAACGAATACTGATTCC
TCAAATAGGGTTTAAACATAGTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATAGATGCAGTGACCACAGC
TTCTTCCCTCAAATCAACACATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACATGCCTTCTCTTATAAAT
GTGTGGTGAGAATAAAAGCAACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGTTGAGGCAGGAGGATCCT
TTGTGCTCAAGAGTTTGAGACCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAGCTAGGGATGGTGGCACA
TGCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCATGAGCCATAATCACGCCA
CTGCACTCCAGCCTGGGTGACAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATACATACCCTCAGTTCTTCG
AAAAACAGTCAACGTCCAAAAAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGATCCACCTAAGTGATTATC
TAGTATCAGCTGTATCAAGGCAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAACAAACACAATAATGCTG
TACGTCTGTAACAAAACAAAATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACACCGTGATTCCTGAGTTTT
GATTTGGTTGAATTCACCTTGTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTACGTACAAGGGGAAGGGG
TGAACAGGAAATAGACTCCCTTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCCCAGAGGCTCACCTCAAT
TGTACTCCTATGATAAAATGTCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGTCCAGCAAGACACGCATT
GCTGTTGATATCTTTGTGGCTAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATTGAAACAGTCTGAGATAG
TTGCATGATGATTAACGTTAAACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAAAAAGGTATCAAATGTAC
AGATAATAGGGCTGGAATTATTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGGGTCACGCCTGTAATCTC
AGCACTTTGGGATGCCAAGATGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGAAACCCGTCTCTACTAAA
GAATACAAAAATTAGCCAGGTGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAATCATTTGAACCCCGGAG
GTGGAGGTTGCAGTGAGCCGACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAAAAGTAAAAAAATAATAA
TGTTTAAAAATATTTCAATGTGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAAGGGGAAGCCTGACTTGA
TAGTAGTATTCAGGAAAAAAGAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACACCGGGGGAGGGGGACGG
GAGGCGAGAACTAAGGCTTTTTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCGGACTCCAGTGTAAGATC
AATTACTGTTGGAATATTGTGTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGTTTGCAGGAGCAGTAACA
AGATGGTGATAACTTTGAAAATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATAATTCAGAAATACAGATG
ATAATTGTTTTCAAATTCTTGAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAATGGAAACAATTAAATTCC
ATTAGAGAAACGGTTGGAAAATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTTGGTTAAAAATACATTCC
GCTGCTGTGGAAAGCCTGTAGCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCAAACCGGCTTTTAGGGCT
TCTCCAGCTTTTAAGATGCGATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGGCTGGCTCTGAAAACTGG
CATTCAGATGATTGCGGCTCCCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCTGTAATCAGTGAAAGTTT
ATCCAGAGGTTAATTACCGGTTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGACCATAGTAAAGCAAAAG
ACTGTTAGAGAATGAGTAAACGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCACTACTGTCTTCATCACA
CACACAGAGGCAAACGTCTGATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTCGAGGCTTGTTTCTGTCC

>In-frame_PPWD1_ENST00000261308_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_9347nt
AGAAGACTGCGCCGCTGCTTTGGGATTGGTAGCTGAGTTTTGTGTCGCGCCTTTTCTGACGATGCGAACAACATGGCGGCGGAAAGTGGT
AGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAACTCAGCGAAAGAGAGCTGGCAGTAGCAGTG
GCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTGGAGGCAACACTGGCCAAGAAGAGGAAAGTC
TTAGAGTTTGAAAGAGTCTATCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGAGATGTTATCACCCATGTG
GTATGCACCAAAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAGAGGGAATTGAATTTGTT
AAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTGTGGGTGATGATAAAGCA
ATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCA
GGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCAT
ATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATG
ATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTT
GCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATT
TTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCA
GACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACT
GGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAA
AATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAAT
CCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAG
AAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCT
CTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATG
AAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAG
CTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACA
AGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAA
AAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAG
TATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGA
CTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTG
GGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGAT
GGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTG
AGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACT
GACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGA
AGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGC
AAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCT
ACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTT
TCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCT
GGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCAT
GCTCCGTGAACTGGGGATCTTTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGCCTGGAAACTGAAGGGAG
TTTTGCAAGTGAAAATTTAGATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAATGGAATTATAAATACTG
TGACCTAAGAAAAGACCCACTAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTATGAAAGTTTCATATGAA
TGTAACTTGATTTTTTACTATTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCATATATATGATATAATTT
GATCCTTCTTGTATCTTGAAGTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGTAAATATTTTCTTGGAGC
TCTGTGTCAACTTTGATCCTTTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGGGGAATATGCCTCAGTGA
TGCATTTATCTTTGTATATCAGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTCAGTTTTGTCTTTTCTGT
CTAAAGTTCAGTCAAAGAGTATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCTTGTATTAGAGGATTTCG
TAGCTTTTATTAGAGGCTCATTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGAATACTAAAGCAAGTCCA
AGCACATTTTTCTCTTCTCACGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAAAGTGTCAGGTAGACATG
TCACAAATGGCTCTGTAGAGAGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTCCAGAAGAGGAGTGGGTT
TTGGATAGAAGCATTTGAGGACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGACTCTTCAGTAGCCTGTT
CTGTCTGGTGATTTTTATTTTAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCCAATTCTGCAGCAGATCA
GTAAACTCACAGTATTTTTCCTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAAAAAAACAACTTTGAATT
CCCCTGCCTAGGTCTTCCAGTTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTAGCACCTTCCGATTCTCT
AGTCCAAATGAACTTTGTGCTAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCAAGAGCTAGGAGATTCCT
AGATTATATCTGCCAAGCAAATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTGCCCAGCCCTTCTCTTCC
CACACACTCACTCAATGTCACCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTTTTCTCACATCTTTCCCC
CTAGACTTTTCTGTTTTTCAGTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAACTTTACCACTTGAAATC
TTATTTCATAGAAAAACTAAATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATGAACTCATATTTCTTTCA
TACTTTAACGTTAAAACCGAAATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCTAATATTTAAAATCTACC
AAAGAGCAGTCACAAAATTAAAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGAGGATCA
CCTGAGGTCAGAGTTCAAGACCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGGGCATGATGTTGGGTTCC
TGTAGTCCCAGCTACTTAGGAGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCTGAGATCATGCCATTGCA
CTCCAGCCTGGACGACAGAGTGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTTAAAAGAAAGGACTTTTT
AAAAATTCTCTAGCATAATTCAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGTTCTTTTTTTCCAGATCA
GAGCAGAGAATATCACTGACATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTTTAGATTTATGGACTGAG
CCACATATAATAAGGTCTCTCCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTTTTAGGCATTGTTATGTT
GTGAAGGATAAAATCTTCAACATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATGCTGCAGAGAAGAGAAAT
GTCTTGACGTTTTGCCACCTGATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAACAACTAAAAATTGCCTTG
AGTTATCACCTGAGCTACTTATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTAGCTCTTCGGATGAAAAA
TTGCATTGTGGGAGATACCAAAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTTGTAAATGCCTTAAGTAG
CAGGCAGTGACTCAATTTTCTACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGATTCTGCCTCCCCACTAG
GCCAGTGTGTGTTTACCATTTATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACATTAAAATACCATCATACT
TCAGGCTTCTATAACAAAATATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGGAAGTCCCACAATCCACA
TGCTGGTAAATTTGGTTCGTGGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAGACATGTTACAAATAGCT
CTGTAGAGAGCCATGGGAAGAGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCAGTGGCAGGGAGCAAGCC
CTAGAGTGTCTCTTTTTACGAGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCAGTCACCCCCAACAAAGG
CCCCACCCCCTAACCCCATCACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCATAACGAATACTGATTCC
TCAAATAGGGTTTAAACATAGTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATAGATGCAGTGACCACAGC
TTCTTCCCTCAAATCAACACATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACATGCCTTCTCTTATAAAT
GTGTGGTGAGAATAAAAGCAACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGTTGAGGCAGGAGGATCCT
TTGTGCTCAAGAGTTTGAGACCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAGCTAGGGATGGTGGCACA
TGCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCATGAGCCATAATCACGCCA
CTGCACTCCAGCCTGGGTGACAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATACATACCCTCAGTTCTTCG
AAAAACAGTCAACGTCCAAAAAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGATCCACCTAAGTGATTATC
TAGTATCAGCTGTATCAAGGCAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAACAAACACAATAATGCTG
TACGTCTGTAACAAAACAAAATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACACCGTGATTCCTGAGTTTT
GATTTGGTTGAATTCACCTTGTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTACGTACAAGGGGAAGGGG
TGAACAGGAAATAGACTCCCTTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCCCAGAGGCTCACCTCAAT
TGTACTCCTATGATAAAATGTCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGTCCAGCAAGACACGCATT
GCTGTTGATATCTTTGTGGCTAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATTGAAACAGTCTGAGATAG
TTGCATGATGATTAACGTTAAACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAAAAAGGTATCAAATGTAC
AGATAATAGGGCTGGAATTATTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGGGTCACGCCTGTAATCTC
AGCACTTTGGGATGCCAAGATGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGAAACCCGTCTCTACTAAA
GAATACAAAAATTAGCCAGGTGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAATCATTTGAACCCCGGAG
GTGGAGGTTGCAGTGAGCCGACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAAAAGTAAAAAAATAATAA
TGTTTAAAAATATTTCAATGTGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAAGGGGAAGCCTGACTTGA
TAGTAGTATTCAGGAAAAAAGAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACACCGGGGGAGGGGGACGG
GAGGCGAGAACTAAGGCTTTTTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCGGACTCCAGTGTAAGATC
AATTACTGTTGGAATATTGTGTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGTTTGCAGGAGCAGTAACA
AGATGGTGATAACTTTGAAAATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATAATTCAGAAATACAGATG
ATAATTGTTTTCAAATTCTTGAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAATGGAAACAATTAAATTCC
ATTAGAGAAACGGTTGGAAAATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTTGGTTAAAAATACATTCC
GCTGCTGTGGAAAGCCTGTAGCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCAAACCGGCTTTTAGGGCT
TCTCCAGCTTTTAAGATGCGATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGGCTGGCTCTGAAAACTGG
CATTCAGATGATTGCGGCTCCCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCTGTAATCAGTGAAAGTTT
ATCCAGAGGTTAATTACCGGTTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGACCATAGTAAAGCAAAAG
ACTGTTAGAGAATGAGTAAACGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCACTACTGTCTTCATCACA
CACACAGAGGCAAACGTCTGATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTCGAGGCTTGTTTCTGTCC

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_9327nt
GACGATGCGAACAACATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACA
GAACTCAGCGAAAGAGAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCT
GTGGAGGCAACACTGGCCAAGAAGAGGAAAGCAGCCACATGAAGTTGGAATTTCGAACTCTTATTTAGTCTTAGAGTTTGAAAGAGTCTA
TCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGAGATGTTATCACCCATGTGGTATGCACCAAAACAGATTT
TATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAGAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCT
GGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTGTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGT
GAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGT
TGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCATATTTTTGACAAACTCCATAC
ATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATGATTGAATACTGGACTGGGCC
TCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCC
AACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAA
ACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACG
AATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGG
AACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATT
GGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCA
AGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATG
TATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGA
CAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGA
AACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAA
GGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCT
AGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGG
TTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTT
CCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGAC
AGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCT
CTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGT
GGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTT
TGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATC
GCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGAAGCCCTATTGCAGACGATCT
GCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCA
TACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCC
AGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAG
CTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCAT
GGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCATGCTCCGTGAACTGGGGATCT
TTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGCCTGGAAACTGAAGGGAGTTTTGCAAGTGAAAATTTAG
ATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAATGGAATTATAAATACTGTGACCTAAGAAAAGACCCAC
TAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTATGAAAGTTTCATATGAATGTAACTTGATTTTTTACTA
TTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCATATATATGATATAATTTGATCCTTCTTGTATCTTGAA
GTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGTAAATATTTTCTTGGAGCTCTGTGTCAACTTTGATCCT
TTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGGGGAATATGCCTCAGTGATGCATTTATCTTTGTATATC
AGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTCAGTTTTGTCTTTTCTGTCTAAAGTTCAGTCAAAGAGT
ATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCTTGTATTAGAGGATTTCGTAGCTTTTATTAGAGGCTCA
TTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGAATACTAAAGCAAGTCCAAGCACATTTTTCTCTTCTCA
CGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAAAGTGTCAGGTAGACATGTCACAAATGGCTCTGTAGAG
AGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTCCAGAAGAGGAGTGGGTTTTGGATAGAAGCATTTGAGG
ACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGACTCTTCAGTAGCCTGTTCTGTCTGGTGATTTTTATTT
TAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCCAATTCTGCAGCAGATCAGTAAACTCACAGTATTTTTC
CTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAAAAAAACAACTTTGAATTCCCCTGCCTAGGTCTTCCAG
TTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTAGCACCTTCCGATTCTCTAGTCCAAATGAACTTTGTGC
TAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCAAGAGCTAGGAGATTCCTAGATTATATCTGCCAAGCAA
ATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTGCCCAGCCCTTCTCTTCCCACACACTCACTCAATGTCA
CCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTTTTCTCACATCTTTCCCCCTAGACTTTTCTGTTTTTCA
GTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAACTTTACCACTTGAAATCTTATTTCATAGAAAAACTAA
ATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATGAACTCATATTTCTTTCATACTTTAACGTTAAAACCGA
AATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCTAATATTTAAAATCTACCAAAGAGCAGTCACAAAATTA
AAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGAGGATCACCTGAGGTCAGAGTTCAAGA
CCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGGGCATGATGTTGGGTTCCTGTAGTCCCAGCTACTTAGG
AGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCTGAGATCATGCCATTGCACTCCAGCCTGGACGACAGAG
TGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTTAAAAGAAAGGACTTTTTAAAAATTCTCTAGCATAATT
CAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGTTCTTTTTTTCCAGATCAGAGCAGAGAATATCACTGAC
ATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTTTAGATTTATGGACTGAGCCACATATAATAAGGTCTCT
CCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTTTTAGGCATTGTTATGTTGTGAAGGATAAAATCTTCAA
CATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATGCTGCAGAGAAGAGAAATGTCTTGACGTTTTGCCACCT
GATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAACAACTAAAAATTGCCTTGAGTTATCACCTGAGCTACTT
ATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTAGCTCTTCGGATGAAAAATTGCATTGTGGGAGATACCA
AAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTTGTAAATGCCTTAAGTAGCAGGCAGTGACTCAATTTTC
TACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGATTCTGCCTCCCCACTAGGCCAGTGTGTGTTTACCATT
TATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACATTAAAATACCATCATACTTCAGGCTTCTATAACAAAAT
ATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGGAAGTCCCACAATCCACATGCTGGTAAATTTGGTTCGT
GGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAGACATGTTACAAATAGCTCTGTAGAGAGCCATGGGAAG
AGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCAGTGGCAGGGAGCAAGCCCTAGAGTGTCTCTTTTTACG
AGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCAGTCACCCCCAACAAAGGCCCCACCCCCTAACCCCATC
ACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCATAACGAATACTGATTCCTCAAATAGGGTTTAAACATA
GTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATAGATGCAGTGACCACAGCTTCTTCCCTCAAATCAACAC
ATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACATGCCTTCTCTTATAAATGTGTGGTGAGAATAAAAGCA
ACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGTTGAGGCAGGAGGATCCTTTGTGCTCAAGAGTTTGAGA
CCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAGCTAGGGATGGTGGCACATGCCTGTAGTCCCAGCTACT
TGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCATGAGCCATAATCACGCCACTGCACTCCAGCCTGGGTGA
CAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATACATACCCTCAGTTCTTCGAAAAACAGTCAACGTCCAAA
AAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGATCCACCTAAGTGATTATCTAGTATCAGCTGTATCAAGG
CAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAACAAACACAATAATGCTGTACGTCTGTAACAAAACAAA
ATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACACCGTGATTCCTGAGTTTTGATTTGGTTGAATTCACCTT
GTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTACGTACAAGGGGAAGGGGTGAACAGGAAATAGACTCCC
TTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCCCAGAGGCTCACCTCAATTGTACTCCTATGATAAAATG
TCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGTCCAGCAAGACACGCATTGCTGTTGATATCTTTGTGGC
TAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATTGAAACAGTCTGAGATAGTTGCATGATGATTAACGTTA
AACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAAAAAGGTATCAAATGTACAGATAATAGGGCTGGAATTA
TTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGGGTCACGCCTGTAATCTCAGCACTTTGGGATGCCAAGA
TGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGAAACCCGTCTCTACTAAAGAATACAAAAATTAGCCAGG
TGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAATCATTTGAACCCCGGAGGTGGAGGTTGCAGTGAGCCG
ACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAAAAGTAAAAAAATAATAATGTTTAAAAATATTTCAATG
TGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAAGGGGAAGCCTGACTTGATAGTAGTATTCAGGAAAAAA
GAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACACCGGGGGAGGGGGACGGGAGGCGAGAACTAAGGCTTT
TTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCGGACTCCAGTGTAAGATCAATTACTGTTGGAATATTGT
GTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGTTTGCAGGAGCAGTAACAAGATGGTGATAACTTTGAAA
ATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATAATTCAGAAATACAGATGATAATTGTTTTCAAATTCTT
GAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAATGGAAACAATTAAATTCCATTAGAGAAACGGTTGGAAA
ATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTTGGTTAAAAATACATTCCGCTGCTGTGGAAAGCCTGTA
GCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCAAACCGGCTTTTAGGGCTTCTCCAGCTTTTAAGATGCG
ATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGGCTGGCTCTGAAAACTGGCATTCAGATGATTGCGGCTC
CCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCTGTAATCAGTGAAAGTTTATCCAGAGGTTAATTACCGG
TTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGACCATAGTAAAGCAAAAGACTGTTAGAGAATGAGTAAA
CGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCACTACTGTCTTCATCACACACACAGAGGCAAACGTCTG
ATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTCGAGGCTTGTTTCTGTCCCCTGTCCTCCACAGTCCTGG

>In-frame_PPWD1_ENST00000535264_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_9327nt
GACGATGCGAACAACATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACA
GAACTCAGCGAAAGAGAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCT
GTGGAGGCAACACTGGCCAAGAAGAGGAAAGCAGCCACATGAAGTTGGAATTTCGAACTCTTATTTAGTCTTAGAGTTTGAAAGAGTCTA
TCTTGATAATCTCCCCAGTGCATCCATGTATGAGCGCAGTTACATGCATAGAGATGTTATCACCCATGTGGTATGCACCAAAACAGATTT
TATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAGAGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCT
GGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTGTGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGT
GAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTGAGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGT
TGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAGATAACCAGCCACTTCATATTTTTGACAAACTCCATAC
ATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTTCTGACAAATCTGGGATGATTGAATACTGGACTGGGCC
TCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACACTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCC
AACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTGATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAA
ACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGATGAGGCAACAGTTACCAGACATGGAATTTGGCCGACG
AATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATATAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGG
AACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGATTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATT
GGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAATGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCA
AGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGGAAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATG
TATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCAAGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGA
CAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCACACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGA
AACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACACCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAA
GGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGAACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCT
AGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTATTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGG
TTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTCAGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTT
CCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCTACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGAC
AGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAGCTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCT
CTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTGGCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGT
GGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCCTGAGACACGACGAGGTGAGGACTTACTTTCATGAGTT
TGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCGGAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATC
GCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAAAACATTATAAAGATGGAAGCCCTATTGCAGACGATCT
GCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGCGCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCA
TACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAATATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCC
AGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATCTTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAG
CTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAAACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCAT
GGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAATGAGTAGAGGCCTGCATGCTCCGTGAACTGGGGATCT
TTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGCCTGGAAACTGAAGGGAGTTTTGCAAGTGAAAATTTAG
ATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAATGGAATTATAAATACTGTGACCTAAGAAAAGACCCAC
TAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTATGAAAGTTTCATATGAATGTAACTTGATTTTTTACTA
TTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCATATATATGATATAATTTGATCCTTCTTGTATCTTGAA
GTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGTAAATATTTTCTTGGAGCTCTGTGTCAACTTTGATCCT
TTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGGGGAATATGCCTCAGTGATGCATTTATCTTTGTATATC
AGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTCAGTTTTGTCTTTTCTGTCTAAAGTTCAGTCAAAGAGT
ATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCTTGTATTAGAGGATTTCGTAGCTTTTATTAGAGGCTCA
TTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGAATACTAAAGCAAGTCCAAGCACATTTTTCTCTTCTCA
CGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAAAGTGTCAGGTAGACATGTCACAAATGGCTCTGTAGAG
AGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTCCAGAAGAGGAGTGGGTTTTGGATAGAAGCATTTGAGG
ACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGACTCTTCAGTAGCCTGTTCTGTCTGGTGATTTTTATTT
TAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCCAATTCTGCAGCAGATCAGTAAACTCACAGTATTTTTC
CTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAAAAAAACAACTTTGAATTCCCCTGCCTAGGTCTTCCAG
TTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTAGCACCTTCCGATTCTCTAGTCCAAATGAACTTTGTGC
TAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCAAGAGCTAGGAGATTCCTAGATTATATCTGCCAAGCAA
ATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTGCCCAGCCCTTCTCTTCCCACACACTCACTCAATGTCA
CCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTTTTCTCACATCTTTCCCCCTAGACTTTTCTGTTTTTCA
GTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAACTTTACCACTTGAAATCTTATTTCATAGAAAAACTAA
ATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATGAACTCATATTTCTTTCATACTTTAACGTTAAAACCGA
AATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCTAATATTTAAAATCTACCAAAGAGCAGTCACAAAATTA
AAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCAAGGCAGGAGGATCACCTGAGGTCAGAGTTCAAGA
CCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGGGCATGATGTTGGGTTCCTGTAGTCCCAGCTACTTAGG
AGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCTGAGATCATGCCATTGCACTCCAGCCTGGACGACAGAG
TGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTTAAAAGAAAGGACTTTTTAAAAATTCTCTAGCATAATT
CAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGTTCTTTTTTTCCAGATCAGAGCAGAGAATATCACTGAC
ATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTTTAGATTTATGGACTGAGCCACATATAATAAGGTCTCT
CCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTTTTAGGCATTGTTATGTTGTGAAGGATAAAATCTTCAA
CATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATGCTGCAGAGAAGAGAAATGTCTTGACGTTTTGCCACCT
GATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAACAACTAAAAATTGCCTTGAGTTATCACCTGAGCTACTT
ATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTAGCTCTTCGGATGAAAAATTGCATTGTGGGAGATACCA
AAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTTGTAAATGCCTTAAGTAGCAGGCAGTGACTCAATTTTC
TACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGATTCTGCCTCCCCACTAGGCCAGTGTGTGTTTACCATT
TATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACATTAAAATACCATCATACTTCAGGCTTCTATAACAAAAT
ATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGGAAGTCCCACAATCCACATGCTGGTAAATTTGGTTCGT
GGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAGACATGTTACAAATAGCTCTGTAGAGAGCCATGGGAAG
AGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCAGTGGCAGGGAGCAAGCCCTAGAGTGTCTCTTTTTACG
AGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCAGTCACCCCCAACAAAGGCCCCACCCCCTAACCCCATC
ACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCATAACGAATACTGATTCCTCAAATAGGGTTTAAACATA
GTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATAGATGCAGTGACCACAGCTTCTTCCCTCAAATCAACAC
ATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACATGCCTTCTCTTATAAATGTGTGGTGAGAATAAAAGCA
ACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGTTGAGGCAGGAGGATCCTTTGTGCTCAAGAGTTTGAGA
CCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAGCTAGGGATGGTGGCACATGCCTGTAGTCCCAGCTACT
TGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCATGAGCCATAATCACGCCACTGCACTCCAGCCTGGGTGA
CAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATACATACCCTCAGTTCTTCGAAAAACAGTCAACGTCCAAA
AAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGATCCACCTAAGTGATTATCTAGTATCAGCTGTATCAAGG
CAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAACAAACACAATAATGCTGTACGTCTGTAACAAAACAAA
ATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACACCGTGATTCCTGAGTTTTGATTTGGTTGAATTCACCTT
GTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTACGTACAAGGGGAAGGGGTGAACAGGAAATAGACTCCC
TTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCCCAGAGGCTCACCTCAATTGTACTCCTATGATAAAATG
TCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGTCCAGCAAGACACGCATTGCTGTTGATATCTTTGTGGC
TAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATTGAAACAGTCTGAGATAGTTGCATGATGATTAACGTTA
AACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAAAAAGGTATCAAATGTACAGATAATAGGGCTGGAATTA
TTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGGGTCACGCCTGTAATCTCAGCACTTTGGGATGCCAAGA
TGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGAAACCCGTCTCTACTAAAGAATACAAAAATTAGCCAGG
TGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAATCATTTGAACCCCGGAGGTGGAGGTTGCAGTGAGCCG
ACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAAAAGTAAAAAAATAATAATGTTTAAAAATATTTCAATG
TGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAAGGGGAAGCCTGACTTGATAGTAGTATTCAGGAAAAAA
GAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACACCGGGGGAGGGGGACGGGAGGCGAGAACTAAGGCTTT
TTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCGGACTCCAGTGTAAGATCAATTACTGTTGGAATATTGT
GTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGTTTGCAGGAGCAGTAACAAGATGGTGATAACTTTGAAA
ATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATAATTCAGAAATACAGATGATAATTGTTTTCAAATTCTT
GAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAATGGAAACAATTAAATTCCATTAGAGAAACGGTTGGAAA
ATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTTGGTTAAAAATACATTCCGCTGCTGTGGAAAGCCTGTA
GCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCAAACCGGCTTTTAGGGCTTCTCCAGCTTTTAAGATGCG
ATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGGCTGGCTCTGAAAACTGGCATTCAGATGATTGCGGCTC
CCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCTGTAATCAGTGAAAGTTTATCCAGAGGTTAATTACCGG
TTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGACCATAGTAAAGCAAAAGACTGTTAGAGAATGAGTAAA
CGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCACTACTGTCTTCATCACACACACAGAGGCAAACGTCTG
ATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTCGAGGCTTGTTTCTGTCCCCTGTCCTCCACAGTCCTGG

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000380985_chr5_65076006_+_9184nt
GATGCGAACAACATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAA
CTCAGCGAAAGAGAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTG
GAGGCAACACTGGCCAAGAAGAGGAAAGAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAG
AGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTG
TGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTG
AGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAG
ATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTT
CTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACA
CTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTG
ATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGA
TGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATA
TAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGA
TTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAA
TGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGG
AAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCA
AGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCAC
ACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACA
CCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGA
ACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTA
TTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTC
AGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCT
ACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAG
CTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTG
GCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCC
TGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCG
GAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAA
AACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGC
GCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAA
TATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATC
TTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAA
ACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAA
TGAGTAGAGGCCTGCATGCTCCGTGAACTGGGGATCTTTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGC
CTGGAAACTGAAGGGAGTTTTGCAAGTGAAAATTTAGATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAA
TGGAATTATAAATACTGTGACCTAAGAAAAGACCCACTAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTA
TGAAAGTTTCATATGAATGTAACTTGATTTTTTACTATTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCA
TATATATGATATAATTTGATCCTTCTTGTATCTTGAAGTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGT
AAATATTTTCTTGGAGCTCTGTGTCAACTTTGATCCTTTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGG
GGAATATGCCTCAGTGATGCATTTATCTTTGTATATCAGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTC
AGTTTTGTCTTTTCTGTCTAAAGTTCAGTCAAAGAGTATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCT
TGTATTAGAGGATTTCGTAGCTTTTATTAGAGGCTCATTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGA
ATACTAAAGCAAGTCCAAGCACATTTTTCTCTTCTCACGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAA
AGTGTCAGGTAGACATGTCACAAATGGCTCTGTAGAGAGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTC
CAGAAGAGGAGTGGGTTTTGGATAGAAGCATTTGAGGACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGA
CTCTTCAGTAGCCTGTTCTGTCTGGTGATTTTTATTTTAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCC
AATTCTGCAGCAGATCAGTAAACTCACAGTATTTTTCCTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAA
AAAAACAACTTTGAATTCCCCTGCCTAGGTCTTCCAGTTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTA
GCACCTTCCGATTCTCTAGTCCAAATGAACTTTGTGCTAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCA
AGAGCTAGGAGATTCCTAGATTATATCTGCCAAGCAAATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTG
CCCAGCCCTTCTCTTCCCACACACTCACTCAATGTCACCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTT
TTCTCACATCTTTCCCCCTAGACTTTTCTGTTTTTCAGTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAA
CTTTACCACTTGAAATCTTATTTCATAGAAAAACTAAATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATG
AACTCATATTTCTTTCATACTTTAACGTTAAAACCGAAATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCT
AATATTTAAAATCTACCAAAGAGCAGTCACAAAATTAAAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGG
CCAAGGCAGGAGGATCACCTGAGGTCAGAGTTCAAGACCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGG
GCATGATGTTGGGTTCCTGTAGTCCCAGCTACTTAGGAGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCT
GAGATCATGCCATTGCACTCCAGCCTGGACGACAGAGTGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTT
AAAAGAAAGGACTTTTTAAAAATTCTCTAGCATAATTCAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGT
TCTTTTTTTCCAGATCAGAGCAGAGAATATCACTGACATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTT
TAGATTTATGGACTGAGCCACATATAATAAGGTCTCTCCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTT
TTAGGCATTGTTATGTTGTGAAGGATAAAATCTTCAACATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATG
CTGCAGAGAAGAGAAATGTCTTGACGTTTTGCCACCTGATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAAC
AACTAAAAATTGCCTTGAGTTATCACCTGAGCTACTTATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTA
GCTCTTCGGATGAAAAATTGCATTGTGGGAGATACCAAAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTT
GTAAATGCCTTAAGTAGCAGGCAGTGACTCAATTTTCTACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGA
TTCTGCCTCCCCACTAGGCCAGTGTGTGTTTACCATTTATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACAT
TAAAATACCATCATACTTCAGGCTTCTATAACAAAATATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGG
AAGTCCCACAATCCACATGCTGGTAAATTTGGTTCGTGGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAG
ACATGTTACAAATAGCTCTGTAGAGAGCCATGGGAAGAGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCA
GTGGCAGGGAGCAAGCCCTAGAGTGTCTCTTTTTACGAGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCA
GTCACCCCCAACAAAGGCCCCACCCCCTAACCCCATCACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCA
TAACGAATACTGATTCCTCAAATAGGGTTTAAACATAGTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATA
GATGCAGTGACCACAGCTTCTTCCCTCAAATCAACACATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACA
TGCCTTCTCTTATAAATGTGTGGTGAGAATAAAAGCAACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGT
TGAGGCAGGAGGATCCTTTGTGCTCAAGAGTTTGAGACCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAG
CTAGGGATGGTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCAT
GAGCCATAATCACGCCACTGCACTCCAGCCTGGGTGACAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATAC
ATACCCTCAGTTCTTCGAAAAACAGTCAACGTCCAAAAAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGAT
CCACCTAAGTGATTATCTAGTATCAGCTGTATCAAGGCAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAA
CAAACACAATAATGCTGTACGTCTGTAACAAAACAAAATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACAC
CGTGATTCCTGAGTTTTGATTTGGTTGAATTCACCTTGTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTA
CGTACAAGGGGAAGGGGTGAACAGGAAATAGACTCCCTTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCC
CAGAGGCTCACCTCAATTGTACTCCTATGATAAAATGTCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGT
CCAGCAAGACACGCATTGCTGTTGATATCTTTGTGGCTAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATT
GAAACAGTCTGAGATAGTTGCATGATGATTAACGTTAAACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAA
AAAGGTATCAAATGTACAGATAATAGGGCTGGAATTATTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGG
GTCACGCCTGTAATCTCAGCACTTTGGGATGCCAAGATGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGA
AACCCGTCTCTACTAAAGAATACAAAAATTAGCCAGGTGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAA
TCATTTGAACCCCGGAGGTGGAGGTTGCAGTGAGCCGACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAA
AAGTAAAAAAATAATAATGTTTAAAAATATTTCAATGTGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAA
GGGGAAGCCTGACTTGATAGTAGTATTCAGGAAAAAAGAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACA
CCGGGGGAGGGGGACGGGAGGCGAGAACTAAGGCTTTTTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCG
GACTCCAGTGTAAGATCAATTACTGTTGGAATATTGTGTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGT
TTGCAGGAGCAGTAACAAGATGGTGATAACTTTGAAAATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATA
ATTCAGAAATACAGATGATAATTGTTTTCAAATTCTTGAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAAT
GGAAACAATTAAATTCCATTAGAGAAACGGTTGGAAAATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTT
GGTTAAAAATACATTCCGCTGCTGTGGAAAGCCTGTAGCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCA
AACCGGCTTTTAGGGCTTCTCCAGCTTTTAAGATGCGATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGG
CTGGCTCTGAAAACTGGCATTCAGATGATTGCGGCTCCCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCT
GTAATCAGTGAAAGTTTATCCAGAGGTTAATTACCGGTTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGA
CCATAGTAAAGCAAAAGACTGTTAGAGAATGAGTAAACGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCA
CTACTGTCTTCATCACACACACAGAGGCAAACGTCTGATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTC
GAGGCTTGTTTCTGTCCCCTGTCCTCCACAGTCCTGGATTGTTAATGAATAGTTCATACATGTTTGTTAAATAAATATACCTTCTTTAAA

>In-frame_PPWD1_ENST00000538977_chr5_64875440_+_NLN_ENST00000502464_chr5_65076006_+_9184nt
GATGCGAACAACATGGCGGCGGAAAGTGGTAGCGATTTTCAGCAGAGACGTAGAAGGCGCCGGGACCCGGAGGAACCGGAAAAAACAGAA
CTCAGCGAAAGAGAGCTGGCAGTAGCAGTGGCGGTGTCCCAGGAGAACGATGAGGAGAACGAAGAGCGCTGGGTTGGACCTTTACCTGTG
GAGGCAACACTGGCCAAGAAGAGGAAAGAACAGATTTTATTATTACTGCCAGTCATGATGGACATGTCAAGTTCTGGAAAAAAATAGAAG
AGGGAATTGAATTTGTTAAACATTTTCGTAGTCACCTGGGAGTTATTGAGAGTATTGCAGTTAGCTCTGAGGGAGCATTGTTCTGTTCTG
TGGGTGATGATAAAGCAATGAAGGTGTTTGATGTAGTGAACTTTGACATGATCAACATGCTGAAACTTGGCTATTTTCCTGGACAGTGTG
AGTGGATCTATTGCCCAGGGGATGCAATTTCTTCAGTTGCTGCTTCCGAAAAGAGTACAGGAAAAATTTTCATTTATGATGGCCGAGGAG
ATAACCAGCCACTTCATATTTTTGACAAACTCCATACATCACCTCTTACTCAGATACGGCTAAACCCAGTTTACAAAGCAGTAGTGTCTT
CTGACAAATCTGGGATGATTGAATACTGGACTGGGCCTCCTCATGAATATAAATTCCCCAAAAATGTGAACTGGGAATATAAAACTGACA
CTGATTTATATGAATTTGCCAAGTGTAAGGCTTATCCAACCAGCGTATGTTTTTCACCAGATGGGAAGAAAATAGCTACTATTGGTTCTG
ATAGAAAAGTTAGAATTTTCAGATTTGTAACTGGAAAACTCATGAGAGTCTTTGATGAATCACTAAGCATGTTTACTGAACTGCAACAGA
TGAGGCAACAGTTACCAGACATGGAATTTGGCCGACGAATGGCTGTAGAACGTGAGTTGGAGAAGGTTGATGCTGTAAGATTAATTAATA
TAGTTTTTGATGAAACTGGACACTTCGTGCTGTATGGAACAATGCTGGGCATTAAAGTTATAAATGTAGAGACAAACCGGTGTGTGCGGA
TTTTAGGCAAACAAGAAAATATTAGAGTGATGCAATTGGCTTTGTTCCAGGGGATAGCCAAAAAGCATCGTGCTGCAACTACTATAGAAA
TGAAAGCTTCTGAAAATCCTGTTCTTCAGAATATTCAAGCTGACCCAACAATAGTCTGTACATCATTCAAAAAGAATAGATTTTATATGG
AAATCAAATCAATGAAGAAAAGAATGAGTGAGCTATGTATTGATTTTAACAAAAACCTCAATGAGGATGATACCTTCCTTGTATTTTCCA
AGGCTGAACTTGGTGCTCTTCCTGATGATTTCATTGACAGTTTAGAAAAGACAGATGATGACAAGTATAAAATTACCTTAAAATATCCAC
ACTATTTCCCTGTCATGAAGAAATGTTGTATCCCTGAAACCAGAAGAAGGATGGAAATGGCTTTTAATACAAGGTGCAAAGAGGAAAACA
CCATAATTTTGCAGCAGCTACTCCCACTGCGAACCAAGGTGGCCAAACTACTCGGTTATAGCACACATGCTGACTTCGTCCTTGAAATGA
ACACTGCAAAGAGCACAAGCCGCGTAACAGCCTTTCTAGATGATTTAAGCCAGAAGTTAAAACCCTTGGGTGAAGCAGAACGAGAGTTTA
TTTTGAATTTGAAGAAAAAGGAATGCAAAGACAGGGGTTTTGAATATGATGGGAAAATCAATGCCTGGGATCTATATTACTACATGACTC
AGACAGAGGAACTCAAGTATTCCATAGACCAAGAGTTCCTCAAGGAATACTTCCCAATTGAGGTGGTCACTGAAGGCTTGCTGAACACCT
ACCAGGAGTTGTTGGGACTTTCATTTGAACAAATGACAGATGCTCATGTTTGGAACAAGAGTGTTACACTTTATACTGTGAAGGATAAAG
CTACAGGAGAAGTATTGGGACAGTTCTATTTGGACCTCTATCCAAGGGAAGGAAAATACAATCATGCGGCCTGCTTCGGTCTCCAGCCTG
GCTGCCTTCTGCCTGATGGAAGCCGGATGATGGCAGTGGCTGCCCTCGTGGTGAACTTCTCACAGCCAGTGGCAGGTCGTCCCTCTCTCC
TGAGACACGACGAGGTGAGGACTTACTTTCATGAGTTTGGTCACGTGATGCATCAGATTTGTGCACAGACTGATTTTGCACGATTTAGCG
GAACAAATGTGGAAACTGACTTTGTAGAGGTGCCATCGCAAATGCTTGAAAATTGGGTGTGGGACGTCGATTCCCTCCGAAGATTGTCAA
AACATTATAAAGATGGAAGCCCTATTGCAGACGATCTGCTTGAAAAACTTGTTGCTTCTAGGCTGGTCAACACAGGTCTTCTGACCCTGC
GCCAGATTGTTTTGAGCAAAGTTGATCAGTCTCTTCATACCAACACATCGCTGGATGCTGCAAGTGAATATGCCAAATACTGCTCAGAAA
TATTAGGAGTTGCAGCTACTCCAGGCACAAATATGCCAGCTACCTTTGGACATTTGGCAGGGGGATACGATGGCCAATATTATGGATATC
TTTGGAGTGAAGTATTTTCCATGGATATGTTTTACAGCTGTTTTAAAAAAGAAGGGATAATGAATCCAGAGGTTGGAATGAAATACAGAA
ACCTAATCCTGAAACCTGGGGGATCTCTGGACGGCATGGACATGCTCCACAATTTCTTGAAACGTGAGCCAAACCAAAAAGCGTTCCTAA
TGAGTAGAGGCCTGCATGCTCCGTGAACTGGGGATCTTTGGTAGCCGTCCATGTCTGGAGGACAAGTCGACATCACCATGTGTTACTGGC
CTGGAAACTGAAGGGAGTTTTGCAAGTGAAAATTTAGATTTCTATTGACATCCTTTTGTTTTCTAATTTTAAAAATTATAAAGATGTAAA
TGGAATTATAAATACTGTGACCTAAGAAAAGACCCACTAGAAAGTAATTGTACTATAAAATTTCATAAAACTGGATTTGATTTCTTTTTA
TGAAAGTTTCATATGAATGTAACTTGATTTTTTACTATTATAATCTAGATAATATGATATAAGAGGGCTAAGAATTTTTAAATTGAATCA
TATATATGATATAATTTGATCCTTCTTGTATCTTGAAGTTTTGTACTTGGGATTTCTGGACTGATAAATGAATCATCACATTCTTCTGGT
AAATATTTTCTTGGAGCTCTGTGTCAACTTTGATCCTTTGTCTCCCAGGAAGGTGTGACCTCTCCTTTGCCTGCATACCTCAAGGCCAGG
GGAATATGCCTCAGTGATGCATTTATCTTTGTATATCAGGCCGCATGATTCCCAACTTTCTGCCACACTTAAATTACGTTCCTCCATTTC
AGTTTTGTCTTTTCTGTCTAAAGTTCAGTCAAAGAGTATCAAAAAATTATGTTTCAGCTAGACTGGTGTAATGTATAAGTTTTTGTATCT
TGTATTAGAGGATTTCGTAGCTTTTATTAGAGGCTCATTTCCACCTCAGCATACAAGATCGTTAGTCTTTTGGCATGTGTGCCAATTAGA
ATACTAAAGCAAGTCCAAGCACATTTTTCTCTTCTCACGTTTCTAATAAGTGTTAGGGACTTTGCCTCTTTTACTTACCACGTCCCCAAA
AGTGTCAGGTAGACATGTCACAAATGGCTCTGTAGAGAGCCATGGGAAGAGAGAGGAGGTGGATGTGGAACATAAAGGGTTCAGAAACTC
CAGAAGAGGAGTGGGTTTTGGATAGAAGCATTTGAGGACAGCTGCTCCAAAGCCTTATGTGTATGATGAAACTTAACCACGGGGAAGAGA
CTCTTCAGTAGCCTGTTCTGTCTGGTGATTTTTATTTTAAGTGAACCTTTGGATCTATCTTTAACTCTCTTTATTGTGAGTCTAAATTCC
AATTCTGCAGCAGATCAGTAAACTCACAGTATTTTTCCTGTGGAAATCTATTCAATAAGGAAACCAAGACAGGATAATAAAATTTAAAAA
AAAAACAACTTTGAATTCCCCTGCCTAGGTCTTCCAGTTGTTTTCCAGCGCATACCTCAGGTATGACTTTGCTAGCCGGGGACAAAATTA
GCACCTTCCGATTCTCTAGTCCAAATGAACTTTGTGCTAAATAAAAAATTATTATACTACATAATAAAGTTACAGATAGCAGGAAATGCA
AGAGCTAGGAGATTCCTAGATTATATCTGCCAAGCAAATACCTTAAACATCCACCTGAAATCCTACTACCCCCTCTTCTGAGATAATTTG
CCCAGCCCTTCTCTTCCCACACACTCACTCAATGTCACCCCCTTCTAATCCCCAAAACTGTTTTTGTGGTCTTTGTAGCCTATAGTAGTT
TTCTCACATCTTTCCCCCTAGACTTTTCTGTTTTTCAGTTTCAGACAAAAAAACTCTTCAGCTTTTTCCAGTGTGTCTCCTTAACAGTAA
CTTTACCACTTGAAATCTTATTTCATAGAAAAACTAAATTGGTGTGGAAAGGCTGCACACAATAAAGTTATATTATTATCCATGAAAATG
AACTCATATTTCTTTCATACTTTAACGTTAAAACCGAAATGCATGAGAGCAAAAGCACCATGGTGTTCTTTCTATTTAGGGCCTACCTCT
AATATTTAAAATCTACCAAAGAGCAGTCACAAAATTAAAACTCAGCCCGGGCGCAGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGG
CCAAGGCAGGAGGATCACCTGAGGTCAGAGTTCAAGACCAGCATGGTCAACATGGTGAAACCCTGTCTCTACAAAAATACAAAAAGCTGG
GCATGATGTTGGGTTCCTGTAGTCCCAGCTACTTAGGAGGCTGAGGCAGGAGAATAGCTTGAACCCGGGAGGTGGAGGTTGCAGTGAGCT
GAGATCATGCCATTGCACTCCAGCCTGGACGACAGAGTGAGATTCAGTCTCAAAAAAAATTAATACTCAAAGAATTATCTAGCATAATTT
AAAAGAAAGGACTTTTTAAAAATTCTCTAGCATAATTCAAAAGAAAGGACTTAACTTTTTTTTTTTTAGTGTGGTCATCCGTCTAGTTGT
TCTTTTTTTCCAGATCAGAGCAGAGAATATCACTGACATGCTTGAAATGGTGGATAACTATGTAAATTGTAATTGGACAAATGTACACTT
TAGATTTATGGACTGAGCCACATATAATAAGGTCTCTCCTGGTAATTGATCCAGGGGATTTAGGCCTCTTTCGGGTTTTTTGTTTTTTTT
TTAGGCATTGTTATGTTGTGAAGGATAAAATCTTCAACATCTTATGCAAATGGATAGTAGGCATGATCCTAAAGGTTTAGTTTTACGATG
CTGCAGAGAAGAGAAATGTCTTGACGTTTTGCCACCTGATGTAGACTTTGTCCCCCTCTAGTATAAATGTTGCATGTTACCTAGATAAAC
AACTAAAAATTGCCTTGAGTTATCACCTGAGCTACTTATGCCAAGGTCTTGCCTTTCTAAAGCTAATAAGGTGAGAGGTGGATATCTGTA
GCTCTTCGGATGAAAAATTGCATTGTGGGAGATACCAAAATTGAGGAAATAGCTCTTCAAAGAAAAATTACTGATATGATCATTGTACTT
GTAAATGCCTTAAGTAGCAGGCAGTGACTCAATTTTCTACTTTACCATTTTACCTTTAGCTTTTATGTATGAATTATAGGTCTGTGGAGA
TTCTGCCTCCCCACTAGGCCAGTGTGTGTTTACCATTTATTCATTTTCTATCATACACAGGTGGATTAAAATTTACATTAAAATTTACAT
TAAAATACCATCATACTTCAGGCTTCTATAACAAAATATCAGACTGGGTGGCTTCAAAAGCAGACATTTCTTACAGTTCTGGAAGCTGGG
AAGTCCCACAATCCACATGCTGGTAAATTTGGTTCGTGGTGAGGCCCCTCTTCCTCTTTTACTGACCACATCCCCAAAAGTGTCAGGTAG
ACATGTTACAAATAGCTCTGTAGAGAGCCATGGGAAGAGACAGGAGGCAGATGTGGAACATAAAGGGTTTAGAAACTTCTGCAGGCAGCA
GTGGCAGGGAGCAAGCCCTAGAGTGTCTCTTTTTACGAGAGCAGGAATCCCATCATGAGAGTTCCTTCCTCATGACTTTATCTAAACCCA
GTCACCCCCAACAAAGGCCCCACCCCCTAACCCCATCACATTGGCTGTTACGGCTTCAATGTAGGGGATGGGGCACAAACATTCAGTCCA
TAACGAATACTGATTCCTCAAATAGGGTTTAAACATAGTTAACTGAGCCCCCAAAGAATGTTAAAAGAGAAAATCCATTTTATTTGAATA
GATGCAGTGACCACAGCTTCTTCCCTCAAATCAACACATTACAGTTAGATGTCTCCCATCTGAAATTGGATAGCCCACTGAAATTGAACA
TGCCTTCTCTTATAAATGTGTGGTGAGAATAAAAGCAACAAAGAAATGAATGTGGTGGCTCACACCTGTAATCCTAACACTTTGGAAGGT
TGAGGCAGGAGGATCCTTTGTGCTCAAGAGTTTGAGACCAGCCTGAGCAACACAGTGAGACCCTGTCTCTACAAAAACTAAAAAAATTAG
CTAGGGATGGTGGCACATGCCTGTAGTCCCAGCTACTTGGGAGGCTGAGGTGGGAGGATTGCTTGAGCCCAAGAAGGTCAAGGCTGCCAT
GAGCCATAATCACGCCACTGCACTCCAGCCTGGGTGACAGAGACCCTGTCTTAAAATAAAATAAAAAAAAAAGGAAAAGGAAAGACATAC
ATACCCTCAGTTCTTCGAAAAACAGTCAACGTCCAAAAAGTTTATTTTTTGAGTCACCTTTAATAGAGAAATTTCCCACTGGAAACAGAT
CCACCTAAGTGATTATCTAGTATCAGCTGTATCAAGGCAAAAGGTAAAGGTTATAAGATGTAAATATTAGACCAAAATAGCCTTTTTTAA
CAAACACAATAATGCTGTACGTCTGTAACAAAACAAAATTTGAAAAATTGAGGTAATGTACACAGCGATGCACACACCCCCACACCACAC
CGTGATTCCTGAGTTTTGATTTGGTTGAATTCACCTTGTAGTTCCCTTTCCTGAGAAAATACAGGTTCAACACATCTAGTCCACGATGTA
CGTACAAGGGGAAGGGGTGAACAGGAAATAGACTCCCTTATTCTGCTCACATGAGCTGGAACCTGTACTAGCTGCATATTTCATAGACCC
CAGAGGCTCACCTCAATTGTACTCCTATGATAAAATGTCTCTAGCATTTGTCATGAGAGAAACTGGCTAGAAATAGTTTGTTCATTGCGT
CCAGCAAGACACGCATTGCTGTTGATATCTTTGTGGCTAAGATGGAGAATGTGACTGGATAATAGTTATCCAGGTGGATTACTAGCTATT
GAAACAGTCTGAGATAGTTGCATGATGATTAACGTTAAACTGGGAGTAATTTCAAGTCATTTGGCTAAAAATGAAAAAAAAGTCCCATAA
AAAGGTATCAAATGTACAGATAATAGGGCTGGAATTATTAAGTATGATGATGTTATTAACATCTAAAATTATTTTGGCCGGGCAAGGTGG
GTCACGCCTGTAATCTCAGCACTTTGGGATGCCAAGATGGGTGGATCACCTGAGTTCAGGAGTTCAAGACCAGCTTGGCCAACATGGCGA
AACCCGTCTCTACTAAAGAATACAAAAATTAGCCAGGTGTTGTGGCACATGCCTGTACTCCCAGCTACTCAGGAGGCTGAGGCAGAAGAA
TCATTTGAACCCCGGAGGTGGAGGTTGCAGTGAGCCGACATTGTGCCGCTTCATTCCAGCCTGGGCAACAGAGTGAAACTCTTGTCTCAA
AAGTAAAAAAATAATAATGTTTAAAAATATTTCAATGTGGAGACAAGCTCAAAATGAAATTAGACACATTCCATTACCCAGGTAAAAGAA
GGGGAAGCCTGACTTGATAGTAGTATTCAGGAAAAAAGAGTTGGCAGTTTTATTTGGCCAAATTCCAATATCAGCTCATGGTACAGCACA
CCGGGGGAGGGGGACGGGAGGCGAGAACTAAGGCTTTTTAAGAATGTGTTGATGGAAGTATGTGCCTAGATCAAAAGAATAATCCCCCCG
GACTCCAGTGTAAGATCAATTACTGTTGGAATATTGTGTTCCTTTCTAGATATCACATTTTAAGCAGACTTTGGCCAAGTAGTACAGTGT
TTGCAGGAGCAGTAACAAGATGGTGATAACTTTGAAAATACTTCTCAAAAGAAAAATAAAAAAGAATTAGGGAAGTTCAGTCTGGAGATA
ATTCAGAAATACAGATGATAATTGTTTTCAAATTCTTGAAGGAAATGGGAGAGAGAATAGGCTAATTCTGTATTGCTTCAGAAACCAAAT
GGAAACAATTAAATTCCATTAGAGAAACGGTTGGAAAATATGAGGAGGATTTAGTTCAGTACGAGGAAGCTGTTTCTAATACTTTTTGTT
GGTTAAAAATACATTCCGCTGCTGTGGAAAGCCTGTAGCTGCCAGGAGTGTTACAGAGGGCATTCCTCCCTTGAGTTGACATTTGTGCCA
AACCGGCTTTTAGGGCTTCTCCAGCTTTTAAGATGCGATAATGATAAGATGATCATCGGGAAAACATCCCTCAGATGAAACGTTCACAGG
CTGGCTCTGAAAACTGGCATTCAGATGATTGCGGCTCCCCCATACTGTAGGAATATTGTTTATGGCTTAAGGTTGCCTCGCTCCTCATCT
GTAATCAGTGAAAGTTTATCCAGAGGTTAATTACCGGTTTTCTGGTGGGTATCTGGGAACTGAGGATGGGAGATTAACTGTTGTATATGA
CCATAGTAAAGCAAAAGACTGTTAGAGAATGAGTAAACGTTCGTTTTCCTCCCTACAGAATTTACAGTTACTCTCTGTCCATTCCACTCA
CTACTGTCTTCATCACACACACAGAGGCAAACGTCTGATTCAGATAGCCAGGTGTGCCATGCATGCACTCCACCATATTGTGATCTCTTC
GAGGCTTGTTTCTGTCCCCTGTCCTCCACAGTCCTGGATTGTTAATGAATAGTTCATACATGTTTGTTAAATAAATATACCTTCTTTAAA


Top

FusionGenePPI for PPWD1_NLN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPWD1EED, ADRBK1, ACOX1, DDX6, PTPRF, PTBP3, NTRK1, SEC13, ZNF232NLNAPP, FPGT, LDLRAP1, SYNE1, HIF1A, DYNLL1, RASSF8, NCAPD3, GAR1, MRPL9, RUFY1, KLC4, ZNF526, MBP, RGS20, SMTNL2, SPACA4, DLST, PDHA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPWD1_NLN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPWD1_NLN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource