FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28549

FusionGeneSummary for PPP6R3_YAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP6R3_YAP1
Fusion gene ID: 28549
HgeneTgene
Gene symbol

PPP6R3

YAP1

Gene ID

55291

10413

Gene nameprotein phosphatase 6 regulatory subunit 3Yes associated protein 1
SynonymsC11orf23|PP6R3|SAP190|SAPL|SAPLa|SAPS3COB1|YAP|YAP2|YAP65|YKI
Cytomap

11q13.2

11q22.1

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein phosphatase 6 regulatory subunit 3SAPS domain family, member 3sporulation-induced transcript 4-associated protein SAPLtranscriptional coactivator YAP165 kDa Yes-associated proteinprotein yorkie homologyes-associated protein 1yes-associated protein 2yes-associated protein YAP65 homologyorkie homolog
Modification date2018052020180527
UniProtAcc

Q5H9R7

P46937

Ensembl transtripts involved in fusion geneENST00000393799, ENST00000530427, 
ENST00000393800, ENST00000534534, 
ENST00000524845, ENST00000265637, 
ENST00000524904, ENST00000393801, 
ENST00000265636, ENST00000529710, 
ENST00000527403, 
ENST00000526343, 
ENST00000282441, ENST00000537274, 
ENST00000345877, ENST00000531439, 
ENST00000524575, ENST00000528834, 
Fusion gene scores* DoF score18 X 11 X 10=198013 X 7 X 11=1001
# samples 2813
** MAII scorelog2(28/1980*10)=-2.82200169802201
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(13/1001*10)=-2.94485844580754
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPP6R3 [Title/Abstract] AND YAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPP6R3

GO:0043666

regulation of phosphoprotein phosphatase activity

16716191

TgeneYAP1

GO:0006974

cellular response to DNA damage stimulus

18280240

TgeneYAP1

GO:0008283

cell proliferation

17974916

TgeneYAP1

GO:0032570

response to progesterone

16772533

TgeneYAP1

GO:0033148

positive regulation of intracellular estrogen receptor signaling pathway

16772533

TgeneYAP1

GO:0045893

positive regulation of transcription, DNA-templated

20368466

TgeneYAP1

GO:0045944

positive regulation of transcription by RNA polymerase II

25796446

TgeneYAP1

GO:0050767

regulation of neurogenesis

25433207

TgeneYAP1

GO:0050847

progesterone receptor signaling pathway

16772533

TgeneYAP1

GO:0060242

contact inhibition

17974916

TgeneYAP1

GO:0065003

protein-containing complex assembly

20368466

TgeneYAP1

GO:0071480

cellular response to gamma radiation

18280240

TgeneYAP1

GO:0072091

regulation of stem cell proliferation

25433207


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-BT-A20N-01APPP6R3chr11

68326147

+YAP1chr11

102098200

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393799ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393799ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393799ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393799ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393799ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393799ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000393799ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000530427ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3UTRENST00000530427ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393800ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000393800ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3CDSENST00000534534ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
intron-3UTRENST00000534534ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524845ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000524845ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265637ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000265637ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000524904ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000524904ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000393801ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000393801ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000265636ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000265636ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000529710ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000529710ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000526343PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000282441PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000537274PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000345877PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000531439PPP6R3chr11

68326147

+YAP1chr11

102098200

+
In-frameENST00000527403ENST00000524575PPP6R3chr11

68326147

+YAP1chr11

102098200

+
5CDS-3UTRENST00000527403ENST00000528834PPP6R3chr11

68326147

+YAP1chr11

102098200

+

Top

FusionProtFeatures for PPP6R3_YAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP6R3

Q5H9R7

YAP1

P46937


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+69298_359209327Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+69230_263209327DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+69291_504209327RegionNote=Transactivation domain

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+69298_359387505Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+6986_100387505Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+47298_359337455Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+4786_100337455Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+6986_100209327Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+47298_359333451Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+4786_100333451Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+58298_359371489Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+5886_100371489Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+58298_359375493Coiled coilOntology_term=ECO:0000255
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+5886_100375493Coiled coilOntology_term=ECO:0000269
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+693_49387505Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+473_49337455Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+693_49209327Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+473_49333451Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+583_49371489Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+583_49375493Compositional biasNote=Pro-rich
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+69171_204387505DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+69230_263387505DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+47171_204337455DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+47230_263337455DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000524575+69171_204209327DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+47171_204333451DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+47230_263333451DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+58171_204371489DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+58230_263371489DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+58171_204375493DomainWW 1
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+58230_263375493DomainWW 2
TgeneYAP1chr11:68326147chr11:102098200ENST00000282441+69291_504387505RegionNote=Transactivation domain
TgeneYAP1chr11:68326147chr11:102098200ENST00000345877+47291_504337455RegionNote=Transactivation domain
TgeneYAP1chr11:68326147chr11:102098200ENST00000526343+47291_504333451RegionNote=Transactivation domain
TgeneYAP1chr11:68326147chr11:102098200ENST00000531439+58291_504371489RegionNote=Transactivation domain
TgeneYAP1chr11:68326147chr11:102098200ENST00000537274+58291_504375493RegionNote=Transactivation domain


Top

FusionGeneSequence for PPP6R3_YAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_399aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLEKQEIIEQLLSNIFHKEKNESAIVSAIQ
ILLTLLETRRPTGTTHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1197nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAG
ATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGC
TACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCA
CAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAA
GGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2116nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA
GAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTC
CATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTG
TCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTA
AAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCA
TTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCC
AGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAA
CCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAG

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4947nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA
GAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTC
CATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTG
TCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTA
AAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCA
TTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCC
AGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAA
CCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAG
CTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTG
CATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAAC
CTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGT
TTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGT
AGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGT
AGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTG
GATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTA
TTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTT
TACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACG
ACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTA
TAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTA
TACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAAC
AAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTT
AAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGA
AAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTG
GAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCAT
AATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAG
TTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGA
AGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCT
TAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATA
AAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGA
GATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTA
CGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTAT
GTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTG
CTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTAT
GGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAA
AAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCA
GAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCA
ATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAG
AATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTT
AATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTA

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4947nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA
GAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTC
CATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTG
TCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTA
AAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCA
TTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCC
AGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAA
CCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAG
CTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTG
CATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAAC
CTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGT
TTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGT
AGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGT
AGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTG
GATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTA
TTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTT
TACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACG
ACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTA
TAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTA
TACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAAC
AAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTT
AAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGA
AAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTG
GAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCAT
AATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAG
TTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGA
AGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCT
TAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATA
AAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGA
GATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTA
CGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTAT
GTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTG
CTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTAT
GGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAA
AAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCA
GAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCA
ATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAG
AATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTT
AATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTA

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4947nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA
GAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTC
CATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTG
TCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTA
AAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCA
TTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCC
AGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAA
CCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAG
CTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTG
CATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAAC
CTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGT
TTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGT
AGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGT
AGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTG
GATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTA
TTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTT
TACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACG
ACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTA
TAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTA
TACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAAC
AAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTT
AAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGA
AAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTG
GAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCAT
AATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAG
TTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGA
AGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCT
TAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATA
AAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGA
GATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTA
CGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTAT
GTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTG
CTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTAT
GGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAA
AAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCA
GAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCA
ATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAG
AATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTT
AATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTA

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1487nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA

>In-frame_PPP6R3_ENST00000393799_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1676nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATA
TTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTAC
AGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAG
CAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGA
GAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAA
GAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTC
CATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTG

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2103nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA
CATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTG
CAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTG
TTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCA
TTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATA
CTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACAT
GATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGA
CTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATG

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4934nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA
CATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTG
CAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTG
TTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCA
TTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATA
CTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACAT
GATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGA
CTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATG
AGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGT
TTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGAC
CATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACC
TTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATC
CTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCA
CTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGG
GGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGG
ACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAG
CTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAAT
ATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGT
TAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTT
ACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGA
ATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAA
TGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTT
GGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTT
TTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCT
AAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTA
ATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTAC
TTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTG
GGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTA
CACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTAC
CCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGT
ACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTA
ATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAA
CCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCA
CATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGG
GAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAA
ATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTT
AACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTG
CCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGT
CAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTG

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4934nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA
CATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTG
CAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTG
TTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCA
TTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATA
CTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACAT
GATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGA
CTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATG
AGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGT
TTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGAC
CATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACC
TTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATC
CTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCA
CTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGG
GGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGG
ACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAG
CTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAAT
ATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGT
TAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTT
ACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGA
ATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAA
TGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTT
GGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTT
TTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCT
AAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTA
ATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTAC
TTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTG
GGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTA
CACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTAC
CCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGT
ACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTA
ATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAA
CCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCA
CATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGG
GAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAA
ATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTT
AACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTG
CCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGT
CAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTG

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4934nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA
CATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTG
CAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTG
TTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCA
TTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATA
CTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACAT
GATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGA
CTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATG
AGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGT
TTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGAC
CATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACC
TTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATC
CTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCA
CTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGG
GGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGG
ACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAG
CTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAAT
ATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGT
TAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTT
ACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGA
ATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAA
TGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTT
GGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTT
TTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCT
AAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTA
ATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTAC
TTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTG
GGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTA
CACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTAC
CCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGT
ACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTA
ATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAA
CCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCA
CATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGG
GAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAA
ATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTT
AACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTG
CCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGT
CAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTG

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1474nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA

>In-frame_PPP6R3_ENST00000393800_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1663nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAG
AAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTAC
TTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAA
CCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCC
CAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGC
CAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTA
CATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTG
CAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTG

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2085nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT
CTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAA
GTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAG
ATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAA
GCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTAT
TTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAA

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4916nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT
CTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAA
GTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAG
ATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAA
GCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTAT
TTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAA
TATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTT
TTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTT
AATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTA
TCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTG
CTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGG
TTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTC
TGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCG
ATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTG
CCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTT
CTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCA
GATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTA
ACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAA
GCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCC
TTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTT
CCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCA
GTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAA
ACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAA
TGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATA
ATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGG
GTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAA
GGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGC
CCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACC
TAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACT
GCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTA
AATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCA
GATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAA
ATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGT
GTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTG
GTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTT
TTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGT
ACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTA

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4916nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT
CTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAA
GTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAG
ATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAA
GCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTAT
TTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAA
TATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTT
TTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTT
AATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTA
TCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTG
CTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGG
TTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTC
TGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCG
ATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTG
CCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTT
CTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCA
GATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTA
ACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAA
GCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCC
TTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTT
CCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCA
GTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAA
ACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAA
TGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATA
ATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGG
GTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAA
GGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGC
CCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACC
TAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACT
GCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTA
AATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCA
GATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAA
ATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGT
GTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTG
GTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTT
TTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGT
ACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTA

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4916nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT
CTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAA
GTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAG
ATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAA
GCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTAT
TTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAA
TATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTT
TTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTT
AATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTA
TCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTG
CTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGG
TTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTC
TGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCG
ATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTG
CCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTT
CTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCA
GATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTA
ACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAA
GCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCC
TTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTT
CCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCA
GTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAA
ACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAA
TGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATA
ATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGG
GTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAA
GGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGC
CCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACC
TAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACT
GCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTA
AATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCA
GATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAA
ATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGT
GTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTG
GTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTT
TTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGT
ACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTA

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1456nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC

>In-frame_PPP6R3_ENST00000524845_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1645nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTC
TATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAA
CTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGA
ACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCA
TTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTT
TGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTC
AGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATAC
AGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_1931nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG
CTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAA
GCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCAT
TGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACT
ACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTA
ACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGG
AAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAG
GCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTAT

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4762nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG
CTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAA
GCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCAT
TGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACT
ACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTA
ACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGG
AAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAG
GCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTAT
AAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTT
TGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGG
CAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTT
TTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGG
AATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTT
ATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAG
TGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTC
TCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCT
TCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAG
ATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGG
TTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCT
TTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAAC
GAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGG
TCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGC
CTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGT
AAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAA
TTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTA
GAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATC
AAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGG
GGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGAC
TTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCT
TCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATG
CCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCT
TGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTT
ACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTG
ATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATG
AACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAG
ACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATT
CAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTG
TGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGC
ACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTAC

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4762nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG
CTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAA
GCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCAT
TGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACT
ACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTA
ACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGG
AAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAG
GCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTAT
AAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTT
TGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGG
CAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTT
TTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGG
AATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTT
ATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAG
TGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTC
TCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCT
TCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAG
ATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGG
TTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCT
TTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAAC
GAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGG
TCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGC
CTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGT
AAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAA
TTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTA
GAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATC
AAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGG
GGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGAC
TTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCT
TCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATG
CCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCT
TGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTT
ACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTG
ATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATG
AACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAG
ACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATT
CAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTG
TGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGC
ACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTAC

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4762nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG
CTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAA
GCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCAT
TGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACT
ACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTA
ACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGG
AAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAG
GCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTAT
AAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTT
TGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGG
CAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTT
TTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGG
AATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTT
ATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAG
TGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTC
TCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCT
TCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAG
ATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGG
TTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCT
TTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAAC
GAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGG
TCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGC
CTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGT
AAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAA
TTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTA
GAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATC
AAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGG
GGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGAC
TTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCT
TCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATG
CCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCT
TGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTT
ACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTG
ATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATG
AACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAG
ACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATT
CAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTG
TGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGC
ACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTAC

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1302nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG

>In-frame_PPP6R3_ENST00000265637_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1491nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCT
GACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGT
CCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAA
CCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGA
GCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAG
CTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAA
GCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2079nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG
ACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAA
AGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCA
CAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGC
CTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTT
CATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAA
AATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTT
TTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4910nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG
ACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAA
AGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCA
CAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGC
CTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTT
CATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAA
AATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTT
TTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATT
AATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTT
GTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGT
TGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCT
CTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCC
AGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGG
CAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCA
TACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGA
ATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAG
TTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACT
TACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAA
TAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGA
GTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATG
AAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTT
TCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCC
AATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTC
AAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCA
GAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAA
ATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGC
CAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTG
AAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGC
TGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTT
ATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAG
TCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCT
TGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTA
TCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTT
CCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATG
TTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATT
CAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACAT
CTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGT
ATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAAT
GTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4910nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG
ACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAA
AGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCA
CAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGC
CTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTT
CATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAA
AATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTT
TTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATT
AATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTT
GTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGT
TGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCT
CTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCC
AGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGG
CAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCA
TACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGA
ATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAG
TTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACT
TACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAA
TAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGA
GTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATG
AAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTT
TCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCC
AATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTC
AAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCA
GAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAA
ATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGC
CAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTG
AAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGC
TGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTT
ATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAG
TCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCT
TGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTA
TCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTT
CCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATG
TTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATT
CAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACAT
CTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGT
ATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAAT
GTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4910nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG
ACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAA
AGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCA
CAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGC
CTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTT
CATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAA
AATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTT
TTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATT
AATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTT
GTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGT
TGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCT
CTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCC
AGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGG
CAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCA
TACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGA
ATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAG
TTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACT
TACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAA
TAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGA
GTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATG
AAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTT
TCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCC
AATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTC
AAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCA
GAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAA
ATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGC
CAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTG
AAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGC
TGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTT
ATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAG
TCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCT
TGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTA
TCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTT
CCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATG
TTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATT
CAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACAT
CTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGT
ATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAAT
GTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAAT

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1450nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG

>In-frame_PPP6R3_ENST00000524904_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1639nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAA
ATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCA
CCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTG
TGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTG
GGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTT
CTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAG
ACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAA
AGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCA

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2064nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG
ACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATC
TGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTC
CAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAG
AATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGG
ATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTT
AGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGAT
ATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTA

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4895nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG
ACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATC
TGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTC
CAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAG
AATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGG
ATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTT
AGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGAT
ATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTA
TCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATA
CTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTC
GGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGG
TTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATAC
ATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAA
TGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTT
TGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTAT
CTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGT
TCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATT
CTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCC
TACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGT
AGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGG
AGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTT
GTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAAC
AGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAA
GTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCA
CTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTT
GAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAAT
TACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATT
AAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGAC
CTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCA
GTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGT
AGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTG
AGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTA
GCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATT
TGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTG
TTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTA
TTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAA
TCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGC
TCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTAT
TCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTT
TTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4895nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG
ACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATC
TGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTC
CAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAG
AATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGG
ATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTT
AGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGAT
ATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTA
TCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATA
CTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTC
GGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGG
TTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATAC
ATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAA
TGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTT
TGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTAT
CTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGT
TCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATT
CTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCC
TACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGT
AGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGG
AGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTT
GTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAAC
AGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAA
GTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCA
CTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTT
GAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAAT
TACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATT
AAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGAC
CTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCA
GTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGT
AGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTG
AGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTA
GCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATT
TGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTG
TTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTA
TTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAA
TCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGC
TCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTAT
TCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTT
TTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4895nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG
ACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATC
TGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTC
CAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAG
AATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGG
ATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTT
AGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGAT
ATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTA
TCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATA
CTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTC
GGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGG
TTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATAC
ATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAA
TGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTT
TGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTAT
CTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGT
TCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATT
CTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCC
TACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGT
AGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGG
AGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTT
GTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAAC
AGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAA
GTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCA
CTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTT
GAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAAT
TACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATT
AAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGAC
CTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCA
GTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGT
AGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTG
AGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTA
GCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATT
TGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTG
TTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTA
TTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAA
TCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGC
TCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTAT
TCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTT
TTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTT

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1435nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG

>In-frame_PPP6R3_ENST00000393801_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1624nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGG
AGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAG
ATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATA
CAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACC
TTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATG
ACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATC
TGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTC
CAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAG

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2126nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1497nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA

>In-frame_PPP6R3_ENST00000265636_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1686nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2126nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4957nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG
CTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCT
TTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGGGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGT
TCACCAATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCT
TCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCTGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAG
ATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTT
ATTTTAGGAGCTTATAAGGCATGAGACAATTTCCATATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTT
TGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTT
TTGTCGGAACCTAGGCAAATGACCATATTAGTGAATCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTC
ATTTCCTGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATA
ATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTTCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATA
CATGACTAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGC
TATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACGCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGA
AATGGCTTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTT
TATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTTCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAA
CACATTAACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGA
TAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGTGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATA
ATCATGATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTT
TTAAAGGAACAAAACGAGCATGAATTAACTCTTCAATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACC
TCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAA
GCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATTTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGG
GCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTT
GATCACTCATAATAATTGACTCTAAGGCTTTTATTAAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACT
GCAGATGGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTT
AATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGCCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATT
AGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTT
CTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATA
TGAATATGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGC
TTTGATCTTACGATGCCCTCTGTACTGACCTGAAGGAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCT
CTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTAT
TCTTGAATTGCTTTTACAATAAACCAATTTTATAATCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAG
ATCTACTTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCC
TTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGCTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATG
GAACATGGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAA
GTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAGCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATG
TTGTTATAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAG
AGAATTCTTTAATGCACACTTGTCAAATATATATATATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCAT
ATGTTAGGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATGTGGTTCAAATATATTCTTTCCTTA

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1497nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA

>In-frame_PPP6R3_ENST00000529710_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1686nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGCAGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGC
AATCCAGATATTGCTGACTTTACTTGAGACACGACGACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCAT
GAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTTCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCT
GCCCTCACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAA
CATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGAAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAA
GCTAGATAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCAC
CGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCTAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTG

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000526343_chr11_102098200_+_2001nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA
GCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGC
TAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGC
TGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTG
GGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGA
AGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTC
TGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTT
CAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCA

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000282441_chr11_102098200_+_4832nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA
GCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGC
TAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGC
TGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTG
GGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGA
AGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTC
TGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTT
CAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCA
TATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTT
TTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAA
TCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCT
CGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTT
TCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAA
ATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCAC
GCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAA
GTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTT
TCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAG
ATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAG
TGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGAT
GATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCA
ATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAAT
AAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGAT
TTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTA
CTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATT
AAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTAC
CTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTG
CCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGG
GGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCC
ATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTA
ATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAG
GAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGC
TTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAA
TCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGA
GTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTG
CTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATT
AATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTA
GCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACA
ATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATA
TATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000537274_chr11_102098200_+_4832nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA
GCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGC
TAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGC
TGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTG
GGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGA
AGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTC
TGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTT
CAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCA
TATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTT
TTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAA
TCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCT
CGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTT
TCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAA
ATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCAC
GCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAA
GTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTT
TCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAG
ATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAG
TGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGAT
GATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCA
ATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAAT
AAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGAT
TTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTA
CTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATT
AAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTAC
CTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTG
CCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGG
GGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCC
ATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTA
ATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAG
GAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGC
TTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAA
TCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGA
GTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTG
CTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATT
AATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTA
GCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACA
ATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATA
TATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000345877_chr11_102098200_+_4832nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA
GCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGC
TAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGC
TGACCTCTTTCACAGTTGGCTCTAAAGAATCAAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTG
GGGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCAATCATTTTAACTAAATACTCAGACTTAGA
AGTCAGATGCTTCATGTCACAGCATTTAGTTTGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTC
TGACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCTGAAACCAAGGCTGAAGACTGTTTTACTTT
CAGTATTTTCTTTTCCTCCTAGTGCTATCATTAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCA
TATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGGTGTGCATTTTGTTCTGTTTTGTTGGGTTT
TTTGTTTTTTTTGTTTTTGGCAGGGTCGGTGGGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAA
TCTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCCTGGTTTTTTTTACCACCTTATTTAAATCT
CGATTATCTGCTCTCTCTTTTATATACATACACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTT
TCCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGACTAGTAGTTTATATTTCACTGGTAGTTTAA
ATCTGGTTGGGGCAGTCTGCAGATGTTTGAAGTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCAC
GCCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGCTTTATTTTCTCCCTTGGACTAATTTTTAA
GTCTCGATTGGAATTCAGTGAGTAGGTTCATAATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTT
TCTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATTAACGACTAGATTAAAATATTGCCTTCAAG
ATTGTTCTTACTTACAAGACTTGCTCCTACTTCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAG
TGATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATGATTATACCTTTATTTTTACAGGAAGAGAT
GATGTAACTAGAGTATGTGTCTACAGGAGTAATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCA
ATATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTGTTTTAAGGGTCTTTCAATGTTTCTAGAAT
AAGCCCTTATTTTCAAGGGTTCATAACAGGCATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGAT
TTTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAAGTTGGAAGTAAGAAGTTTTATTTTAAGTA
CTTTCAGTGCTCAAAAAAATGCAATCACTGTGTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATT
AAGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGATGGAGTTTTAGAGTAGTAATGAAATTCTAC
CTAGAATGCAAAATTGGGTATATGAATTACATAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTG
CCTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTTAGCTTAGGGGGAGGGTGGGAAAGTTTGGG
GGGGGGGTTGTGAAGATTTAGGGGGACCTTGATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCC
ATTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATATGGAGATCTTCCTTTACCCCTCAACTTTA
ATTTGCCCAGTTATACCTCAGTGTTGTAGCAGTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAG
GAGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTTTTATGTCCTTGTTCCTAATGTAAAAGTGC
TTAACTGCTTCTTGGTTGTATTGGGTAGCATTGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAA
TCTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTACTTATGGTTGATGGAGCACATTGATTTGGA
GTTTCAGATCTTCCAAAGCACTATTTGTTGTAATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTG
CTACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACATGGCAGAAAGACTGAAAAATAACAGTAATT
AATTGTGTAATTCAGAATTCATACCAATCAGTGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTA
GCGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTATAAGAATTGTGGGTGTGCCTATCATAACA
ATTGTTTTCTGTATCTTGAAAAAGTATTCTCCACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATA
TATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTAGGTACTTACATAAATTGTTACATTATTTT

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000531439_chr11_102098200_+_1372nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA

>In-frame_PPP6R3_ENST00000527403_chr11_68326147_+_YAP1_ENST00000524575_chr11_102098200_+_1561nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAAGCAAGAAATTATAGAGC
AGCTTCTATCAAATATTTTCCACAAGGAGAAAAATGAGTCAGCCATAGTCAGTGCAATCCAGATATTGCTGACTTTACTTGAGACACGAC
GACCAACTGGCACCTATCACTCTCGAGATGAGAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACT
TCCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTCACAGCAGAACCGTTTCCCAGACTACCTTG
AAGCCATTCCTGGGACAAATGTGGACCTTGGAACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGG
AAGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGATAAAGAAAGCTTTCTTACATGGTTATAGA
GCCCTCAGGCAGACTGAATTCTAAATCTGTGAAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGC
TAATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTCCTTGTCCATTGCTGCTGTTAATGTATTGC


Top

FusionGenePPI for PPP6R3_YAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP6R3KDM6A, TNFAIP3, USP21, USP36, USP49, PPP6C, PRKDC, HDAC1, HDAC2, ELAVL1, SIRT7, TERF2IP, TINF2, TFAP4, GRK5, PFAS, BRCA1, ECT2, NOTCH1, LATS1, GPSM1, HDAC11, USP10, ANKRD28, MOB1A, MOB1B, ACAD11, ANKRD44, ANKRD52, AP1B1, AP2A1, AP2A2, AURKA, DNAJC11, ECH1, ERLIN2, PPP6R1, PPP6R2, CDC37, ENAH, ETFA, HSP90AA1, HSP90AB1, RUVBL2, SRRT, TPM1, USP7, CSNK1E, SNAI2, RNF2, GPHA2, RPS6KB2, UNK, DIEXF, NSUN5, EIF4A3, TIPRL, NTRK1, CEP44, CEP19, XPO1, ZNRF2, ZNF746, TRMT2A, TRIM25, TESYAP1ERBB4, TP53BP2, KIF5A, SLC9A3R1, YWHAQ, RUNX3, RUNX2, RUNX1, TP73, TP63, WBP1, SMAD7, SMAD6, SCAMP3, AMOT, ITCH, EP300, BTRC, YWHAG, FBXW11, SMAD1, SMAD5, SMAD3, EGFR, ELAVL1, KLF5, LATS2, LATS1, PML, SUMO1, PTPN14, NFE2, POLR2A, AMOTL2, SRSF2, AHCYL1, UBQLN2, SULT1A1, UNK, UBA2, ZFYVE19, VPS4B, PRDX1, IGBP1, THUMPD1, ZPR1, NUBP2, UBE2L3, PIN1, USP9X, TTC9C, UCHL3, UBE2D1, UFM1, UBE2C, UBXN7, VPS25, TEAD1, CREB1, PPP1CA, AMOTL1, ARID1A, ARID1B, ATPIF1, BCL9L, CCDC85C, DPF2, INADL, LIN7C, MPDZ, MPP5, NF2, PARD3, PDLIM7, RAE1, RAPGEF2, RASSF8, SLC9A3R2, SMARCD1, TEAD3, TJP2, WBP2, YWHAB, YWHAE, YWHAH, YWHAZ, MAP2K1, ARFIP1, PAPOLA, PRMT3, RTF1, STAT1, TSNAX, TOM1, FBXW7, ABL1, ENO1, MOV10, NXF1, FAM189B, PRRG4, CYYR1, TEAD4, ARRDC1, LDLRAD4, STUB1, CPVL, ERP44, FASN, HSPH1, HSPA4L, HSPA4, HYOU1, MCMBP, RAPGEF6, PTCH1, PRRG2, NEDD8, TEAD2, XPO1, SMAD2, ENAH, CDH1, PTPN21, DEFA6, BAG4, CTNNB1, NUDT5, PRKD1, XRCC5, XRCC6, AHNAK, EPRS, THBS1, EEF1A1, EEF1A1P5, WWC3, TUBB, HRNR, PFKP, RPL6, COPA, VCP, EIF3B, CAD, RBM10, SUN2, SLC25A5, PSMD2, ACTN1, RRBP1, DDX3X, RPS4X, FAM120A, NCL, CSTF1, TMPO, MAP4, USP15, RPL7A, SNRPB, RPL18, SF3B3, FLG2, HSPB1, CCT2, SND1, PRPF8, EIF4B, HSP90B1, NPM1, PPP2R1A, CYFIP1, MATR3, TUBB6, HNRNPA2B1, RPS6, PSMC2, EIF3L, HNRNPR, IMMT, PHB2, RPS8, PTRF, RPL10A, PARP1, HIST1H1E, LMNB1, PA2G4, HNRNPF, ITGB1, NUMA1, SRSF6, TGM2, OGDH, PDIA3, RPL24, PHGDH, IPO5, TSR1, TRIP6, YBX1, SMARCA4, ATAD3A, RPL19, CCT5, PGAM5, SEC16A, AJUBA, PSMC5, UPF1, RPL15, XRN2, RPL13A, PSMC6, CNN2, HDAC1, HDAC2, SFN, SUPT16H, RBBP7, PRDX6, SEPT2, UQCRC2, MVD, MYH10, PLOD2, PSMD6, ADSS, PAICS, FUBP1, CIAPIN1, SFXN1, PSMA5, RPL9, DNAJC10, PTBP1, ANXA5, KPNA2, WDR1, C11orf84, H2AFY, JUN, RTN4, RPL14, H1FX, IGFBP7, ACTL6A, RPL17, ZYX, PSMB4, TWF1, HIST1H1B, TK1, CDC20, RAN, RPL21, SV2B, HN1L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP6R3_YAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP6R3_YAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneYAP1C0027819Neuroblastoma1CTD_human
TgeneYAP1C0919267ovarian neoplasm1CTD_human
TgeneYAP1C1168401Squamous cell carcinoma of the head and neck1CTD_human