FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28547

FusionGeneSummary for PPP6R3_SSH2

check button Fusion gene summary
Fusion gene informationFusion gene name: PPP6R3_SSH2
Fusion gene ID: 28547
HgeneTgene
Gene symbol

PPP6R3

SSH2

Gene ID

55291

85464

Gene nameprotein phosphatase 6 regulatory subunit 3slingshot protein phosphatase 2
SynonymsC11orf23|PP6R3|SAP190|SAPL|SAPLa|SAPS3SSH-2|SSH-2L
Cytomap

11q13.2

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein phosphatase 6 regulatory subunit 3SAPS domain family, member 3sporulation-induced transcript 4-associated protein SAPLprotein phosphatase Slingshot homolog 2SSH-like protein 2
Modification date2018052020180523
UniProtAcc

Q5H9R7

Q76I76

Ensembl transtripts involved in fusion geneENST00000393799, ENST00000530427, 
ENST00000393800, ENST00000534534, 
ENST00000524845, ENST00000265637, 
ENST00000524904, ENST00000393801, 
ENST00000265636, ENST00000529710, 
ENST00000527403, 
ENST00000269033, 
ENST00000540801, ENST00000324677, 
ENST00000582084, ENST00000590153, 
ENST00000579954, 
Fusion gene scores* DoF score18 X 11 X 10=198015 X 11 X 8=1320
# samples 2815
** MAII scorelog2(28/1980*10)=-2.82200169802201
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1320*10)=-3.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPP6R3 [Title/Abstract] AND SSH2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPP6R3

GO:0043666

regulation of phosphoprotein phosphatase activity

16716191


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A1HK-01APPP6R3chr11

68321725

+SSH2chr17

28030080

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393799ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000393799ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000393799ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393799ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393799ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393799ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-3CDSENST00000530427ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-3CDSENST00000530427ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-5UTRENST00000530427ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000530427ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000530427ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000530427ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000393800ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000393800ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000393800ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393800ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393800ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393800ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-3CDSENST00000534534ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-3CDSENST00000534534ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-5UTRENST00000534534ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000534534ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000534534ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
intron-intronENST00000534534ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000524845ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000524845ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000524845ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524845ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524845ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524845ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000265637ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000265637ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000265637ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265637ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265637ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265637ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000524904ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000524904ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000524904ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524904ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524904ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000524904ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000393801ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000393801ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000393801ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393801ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393801ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000393801ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000265636ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000265636ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000265636ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265636ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265636ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000265636ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000529710ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000529710ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000529710ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000529710ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000529710ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000529710ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000527403ENST00000269033PPP6R3chr11

68321725

+SSH2chr17

28030080

-
In-frameENST00000527403ENST00000540801PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-5UTRENST00000527403ENST00000324677PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000527403ENST00000582084PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000527403ENST00000590153PPP6R3chr11

68321725

+SSH2chr17

28030080

-
5CDS-intronENST00000527403ENST00000579954PPP6R3chr11

68321725

+SSH2chr17

28030080

-

Top

FusionProtFeatures for PPP6R3_SSH2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPP6R3

Q5H9R7

SSH2

Q76I76

Protein phosphatase which regulates actin filamentdynamics. Dephosphorylates and activates the actinbinding/depolymerizing factor cofilin, which subsequently binds toactin filaments and stimulates their disassembly. Inhibitoryphosphorylation of cofilin is mediated by LIMK1, which may also bedephosphorylated and inactivated by this protein.{ECO:0000269|PubMed:11832213}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSSH2chr11:68321725chr17:28030080ENST00000269033-115307_447351424DomainNote=Tyrosine-protein phosphatase

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PPP6R3_SSH2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_1632aa
MFWKFDLHSSSHIDTLLEREDVTLKELMDEEDVLQECKAQNRKLIEFLLKAECLEDLVSFIIEEPPQDMDEKIRYKTPNISCELLTSDVS
QMNDRLGEDESLLMKLTSFLLNDSPLNPLLASFFSKVLSILISRKPEQIVDFLKKKHDFVDLIIKHIGTSAIMDLLLRLLTCIEPPQPRQ
DVLNWLNEEKIIQRLVEIVHPSQEEDRHSNASQSLCEIVRLSRDQMLQIQNSTEPDPLLATLENISESFLTVKGAALFLPRGNGSSTPRI
SHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRTMVVVSTNGRQDTEESIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHL
DGDGGFSVSTDNRVHIFKPVSVQAMWSALQSLHKACEVARAHNYYPGSLFLTWVSTTESHINSDQSSVNEWNAMQDVQSHRPDSPALFTD
IPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVILGQMDSPTQIFEHVFLGSEWNASNLEDLQNR
GVRTILNVTREIDNFFPGVFETHNIRVTDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIATAMKETGWNLDRATDTV
KERRTVTKPNPSFMRQLEETQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELNKKDITTSADQIAEVKTMESHPPIPPVFVEHMV
PQDANQKGLCTKERMICLEFTSREFHAGQIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETDAL
KADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFVELSQETRSRSFSHSRMEELGGGRNESCRLSVV
EVAPSKVTADDQRSSSLSNTPHASEESSMDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTPKK
NSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEEGEPAEGEQELQGSGMHPGAKWYPGSVRRATLE
FEERLRQEQEHHGAAPTCTSLSTRKNSKNDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVLEF
DHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIETTHIVTSPNHTGPGSEIATSEKSGEQGLRKVNMEKSVTV
LCTLDENLNRTLDPNQVSLHPQVLPLPHSSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHLEG
FTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPTKDSQLSSADLSLISKLGDNTGELQEKMDPLPVACRLPHSSSSENIKSLSHSPGVVK
ERAKEIESRVVFQAGLTKPSQMRRSASLAKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPTKS
FVEQLTTTECIVQSKPVERPLVQTAKEFGSSQQTLLPRAGLELTSSEGGLPVLQTQGLQCACPAPGLAVAPRQQHGRTHPLRRLKKANDK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_4896nt
ATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAG
GAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTC
ATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCC
CAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTT
GCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTA
GACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAA
GATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAAT
GCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCC
ACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATC
AGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTG
GCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATC
GTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTG
GATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAG
AGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCAT
ATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGAC
ATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCC
AAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTT
GGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGA
GGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAA
GAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGC
AAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTG
AAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGG
CATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAG
GATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTC
CCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATT
GAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCA
TCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTG
AAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCA
AGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTC
TCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTA
GAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGAT
GAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATT
GTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAG
AACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCC
CAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAA
CCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAG
TTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGAT
TCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAA
GGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTT
GACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCA
TACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAAT
CACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTG
CTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCC
TCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAG
ACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGC
TTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGT
GAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAA
ATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAG
GAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAA
TTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTC
CTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCT
TTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCT
AGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGT
GCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10066nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGC
CACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCT
GTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTC
CTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGAT
GGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGC
TTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATC
AACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATA
CCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAA
GAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGT
CAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGG
GTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAG
GCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAA
ATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAA
GAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCAT
AACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGAT
ATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCA
CAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAG
GATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCC
AAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAA
GCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGC
CCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCC
CAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAA
GTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAG
GAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTC
ACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAAC
AGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAG
CCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCA
GCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTC
GAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCT
TCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGC
AAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGAC
CACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATAC
CAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCAC
ACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTC
TGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCC
CCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACA
GCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTC
ACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAG
GTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATG
GACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAG
CGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTA
GGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTC
AGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTT
GTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGT
CAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCA
TGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAA
CGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTA
ATATGTAAGGAACATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTC
AGTGTGTATGTGTGTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACC
TCAAAAAAGTCATTTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGA
GAAAAGGCATGGTTTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGT
GATGATGGTTTGGTTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGC
CCTTTAGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGA
TAATGGCCGGCTCTGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGT
GGTCTTCTGTAGAGGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGG
ATCCACACAGATGGGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAA
AAGCAGCAATCGAAAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCT
TCTGAGTTTAATGGCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGAT
TATATTTGAATTGTTACATATGTTTAACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTC
CTGGAAGGTTTGTCATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGG
TAATTTTGATTTATTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAAT
CTGTACAATATGTTGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCC
TCAGAGACACCCCTAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCC
AGTATCTCAACCACAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCC
AGGGGCAAGTGCCCACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAAC
AAGCCTCTTGTAGCTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTG
CTTTCGTTGATGTCCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAAT
GCACAGACTGTCAGCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGG
CCACTGGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCAC
TTGCTAAAAGCGTCTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACT
CAGTTTTGTGATTCCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGG
ATTTCCAGAGCTCTTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGG
GTGGGGAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTAC
AAGCAGGACCAAAGTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGA
CAAAACCCACTAATACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAA
TTTACCTGCCTAAATAAACATCTTCTACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATT
GGGTGTTCCTGGGTTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCA
GACTTTTATAATCTCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAA
TAGGAAAAACTTTGACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCAC
TTATTTTGGAGGAGTGTATGTGCATGTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGA
GCATACAGAACTTGAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACT
GTAGTAGACATGTAGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTA
TCATCTTAGTCTCTTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTAT
CCCTACTGATAGTTCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTAC
TCTGCTCACAGGCCCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTC
ACCTGTTTCATCTGAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCAT
TATGCAAAAAGTCACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTA
CATTTTGAATATTAAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGA
GCAGGGCCATCATGGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTC
TATGGAAATAGTTGTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTG
TTTTGCTTTTTGATGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCA
AACTAAAAGATCAAGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAA
GCAGGAAGCTGCACACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTC
CAGCCTGGAAATGGAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAG
GATTTCTAAACTGGAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGC
TGGTGGCAGCGTCCTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCC
CACAGGGAAATGTTTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTT
TCTTTCTGCTTTGTTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACC
CCAAACTTTTATGCTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGG
TCTCATCTCCTTCCTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAA

>In-frame_PPP6R3_ENST00000393799_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5255nt
GAACTCAAGGCCTGCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGG
CGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAA
CTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATG
TTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAA
GATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATT
ATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAG
ATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCC
AGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGAC
CTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGAT
GTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCA
TCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACT
CTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGC
CACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCT
GTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTC
CTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGAT
GGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGC
TTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATC
AACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATA
CCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAA
GAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGT
CAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGG
GTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAG
GCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAA
ATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAA
GAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCAT
AACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGAT
ATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCA
CAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAG
GATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCC
AAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAA
GCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGC
CCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCC
CAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAA
GTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAG
GAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTC
ACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAAC
AGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAG
CCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCA
GCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTC
GAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCT
TCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGC
AAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGAC
CACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATAC
CAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCAC
ACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTC
TGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCC
CCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACA
GCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTC
ACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAG
GTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATG
GACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAG
CGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTA
GGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTC
AGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTT
GTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGT
CAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCA
TGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAA
CGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTA

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10053nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCA
GCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACA
AGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAA
GTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATT
TCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGT
TCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTT
GTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAAT
CCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTG
AACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAG
AGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCC
CTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCT
TGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCC
TGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTC
GCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGG
TAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGA
GATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAG
CAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATC
AGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACT
TAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTC
AGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATG
TCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTT
GCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGT
CACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCA
AAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGG
CAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGT
CCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGC
TGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCA
AAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAAC
AAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTAC
GGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACC
TAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACA
GTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATC
CTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAA
CACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGA
GTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATG
AAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACA
GACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTG
TCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCA
GCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGG
ACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTG
TAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAA
TCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACC
TCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAG
GCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCA
CAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGC
TCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAG
GGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACC
CCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAAC
ATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGTGTATGTGT
GTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAAAAAGTCAT
TTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAAGGCATGGT
TTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGATGGTTTGG
TTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTTAGAGTTCC
TGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATGGCCGGCTC
TGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCTTCTGTAGA
GGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCACACAGATG
GGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCAGCAATCGA
AAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGAGTTTAATG
GCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATATTTGAATTG
TTACATATGTTTAACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGAAGGTTTGT
CATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATTTTGATTTA
TTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTACAATATGT
TGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGAGACACCCC
TAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTATCTCAACCA
CAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGGCAAGTGCC
CACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCCTCTTGTAG
CTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTCGTTGATGT
CCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACAGACTGTCA
GCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACTGGGTCTTA
AGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCTAAAAGCGT
CTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTTTTGTGATT
CCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTCCAGAGCTC
TTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGGGAGAGGGT
TTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCAGGACCAAA
GTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAACCCACTAA
TACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTACCTGCCTAA
ATAAACATCTTCTACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTGTTCCTGGG
TTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTTTTATAATC
TCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGAAAAACTTT
GACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATTTTGGAGGA
GTGTATGTGCATGTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATACAGAACTT
GAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGTAGACATGT
AGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATCTTAGTCTC
TTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTACTGATAGT
TCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGCTCACAGGC
CCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTGTTTCATCT
GAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGCAAAAAGTC
ACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTTTGAATATT
AAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGGGCCATCAT
GGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGGAAATAGTT
GTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTGCTTTTTGA
TGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTAAAAGATCA
AGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGGAAGCTGCA
CACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCCTGGAAATG
GAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTTCTAAACTG
GAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTGGCAGCGTC
CTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAGGGAAATGT
TTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTTCTGCTTTG
TTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAACTTTTATG
CTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCATCTCCTTC
CTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTGAACTTGTG

>In-frame_PPP6R3_ENST00000393800_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5242nt
GCTTGATACGTCCGCCATTTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCA
CCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGAT
AACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTG
ATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGG
AATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCAC
CTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGAC
TGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCA
AGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGC
ACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGT
TAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTT
GTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCA
GCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACA
AGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAA
GTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATT
TCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGT
TCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTT
GTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAAT
CCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTG
AACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAG
AGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCC
CTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCT
TGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCC
TGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTC
GCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGG
TAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGA
GATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAG
CAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATC
AGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACT
TAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTC
AGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATG
TCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTT
GCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGT
CACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCA
AAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGG
CAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGT
CCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGC
TGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCA
AAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAAC
AAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTAC
GGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACC
TAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACA
GTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATC
CTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAA
CACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGA
GTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATG
AAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACA
GACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTG
TCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCA
GCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGG
ACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTG
TAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAA
TCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACC
TCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAG
GCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCA
CAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGC
TCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAG
GGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACC
CCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAAC

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10035nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTG
TCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCC
AACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAA
CACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTA
GCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATA
ACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGC
ATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGA
ATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAA
TTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGG
TGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGC
ATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGA
TAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACA
CTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGA
TTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAA
GCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTG
ACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGG
TGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCA
AAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGAT
GCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAG
AAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGG
AAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAG
ATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATT
CAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACC
AGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCA
GCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTG
GGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCC
AGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCA
ACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAG
GGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATC
ATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAA
GTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCT
CACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGT
CAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTC
CCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTG
AGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTC
TGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAA
CCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATT
TACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCT
CTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCG
CAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCAC
ATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTT
TCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTAC
CAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGG
ACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTG
TGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTG
AATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCC
GTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGT
GATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAA
TTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAAGGGGAA
AGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAAAAAGTCATTTTCAGAGAACACCTTTA
TCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAGGGAAGG
AAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTGAGGCAT
CGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAGGTTCCG
CTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATGGCCGGCTCTGCAAATTTATCATATAG
TTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGATAAGAGG
AGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCACACAGATGGGCATCTTGGCTCTCCCT
GCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGTTCTTGT
AAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCTTCCAGT
TTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATATTTGAATTGTTACATATGTTTAACATC
CATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAAGTTTGT
ACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGAAGGAGT
AGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTACAATATGTTGATGGTGGCTGTAGTTG
TTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCATTAGGT
CACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGTATATGT
GAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCCATTTAG
GATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAAAACAGA
TTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTCGTTGATGTCCACGTTACTGAGGATTG
ACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACAGACTGTCAGCATGATGTCAGAGGCCA
GAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTGAAGTTG
TGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCAGTGATT
ATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTTTTGTGATTCCTGGATATTTGTGTGTT
GTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAATACCCT
GCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGTTAAGAG
AGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGTTCCCTC
TTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAACCCACTAATACTGTGGGGAAAAAAAA
TTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTACCTGCCTAAATAAACATCTTCTACAGA
ATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTGTTCCTGGGTTATTTACATAGCTGAGC
AGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTTTTATAATCTCCAGTGGCATCTTTCCC
TTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGAAAAACTTTGACTCTTGCCCAGTGCCT
GCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATTTTGGAGGAGTGTATGTGCATGTGTAC
ACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATACAGAACTTGAGCTGAACCTGGTCAGT
AGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGTAGACATGTAGTACTATAGTACCGTAA
TATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATCTTAGTCTCTTCAGGATCTTTAGTATT
TTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCATTTTGC
AAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGCTCACAGGCCCCAGACAGATGCTGTTG
GGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGTTCTGAA
GTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGCATTTAA
AAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTTTGAATATTAAAATGTGCATCATCTTG
TCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTGTGAGTA
AGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGGAAATAGTTGTCATTTCCTCAGTGATG
GTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGATGAAAT
TTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTAAAAGATCAAGGCATGTATTAGACACA
AGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGGAAGCTGCACACTCCTAACCCTTCTCC
CAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGGCCCTGG
CTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTTCTAAACTGGAATCATCCTTAATCACC
TTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTGGCAGCGTCCTGTGTACACATGCAGAG
CTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAGGGAAATGTTTGATTTTTATGTTCTGT
TGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACTTGTTCT
AACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAACTTTTATGCTCATGTTTTATTAAAGC
AGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCTGGTGGT
TGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTGAACTTGTGCGCAAATGTGCAGATTCA

>In-frame_PPP6R3_ENST00000524845_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5224nt
TTTGGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTT
TCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGG
AGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCC
ACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACC
GCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAA
AGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCT
TGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTA
TCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTA
TCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTA
TCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGA
GCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTG
TCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCC
AACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAA
CACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTA
GCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATA
ACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGC
ATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGA
ATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAA
TTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGG
TGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGC
ATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGA
TAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACA
CTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGA
TTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAA
GCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTG
ACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGG
TGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCA
AAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGAT
GCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAG
AAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGG
AAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAG
ATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATT
CAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACC
AGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCA
GCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTG
GGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCC
AGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCA
ACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAG
GGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATC
ATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAA
GTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCT
CACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGT
CAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTC
CCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTG
AGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTC
TGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAA
CCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATT
TACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCT
CTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCG
CAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCAC
ATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTT
TCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTAC
CAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGG
ACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTG
TGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTG
AATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCC
GTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGT
GATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAA

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_9881nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAG
ACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAG
ACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGG
AATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGA
TGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACA
CAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTC
AGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTAC
TGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGAT
AAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAAT
GGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACG
GTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAAC
GGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGG
GGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAG
ACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAA
ACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCAC
CACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGA
TGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGA
ATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGC
CTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGA
CATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCA
ACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGA
AACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGC
CCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACA
GTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGA
AATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCAT
CCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGA
ACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGA
GGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGA
GCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGT
GGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGG
GAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTT
GCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGA
GTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGG
GCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCAC
ACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGA
GCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGC
ACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGA
GCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCC
ATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCC
ATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGC
TAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTA
CTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAAC
AGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGA
ACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCA
GTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCC
AGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGAC
AACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATG
TAAGGAACATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGT
GTATGTGTGTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAA
AAAGTCATTTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAA
GGCATGGTTTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGA
TGGTTTGGTTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTT
AGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATG
GCCGGCTCTGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCT
TCTGTAGAGGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCA
CACAGATGGGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCA
GCAATCGAAAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGA
GTTTAATGGCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATAT
TTGAATTGTTACATATGTTTAACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGA
AGGTTTGTCATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATT
TTGATTTATTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTA
CAATATGTTGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGA
GACACCCCTAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTAT
CTCAACCACAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGG
CAAGTGCCCACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCC
TCTTGTAGCTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTC
GTTGATGTCCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACA
GACTGTCAGCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACT
GGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCT
AAAAGCGTCTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTT
TTGTGATTCCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTC
CAGAGCTCTTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGG
GAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCA
GGACCAAAGTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAA
CCCACTAATACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTAC
CTGCCTAAATAAACATCTTCTACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTG
TTCCTGGGTTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTT
TTATAATCTCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGA
AAAACTTTGACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATT
TTGGAGGAGTGTATGTGCATGTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATA
CAGAACTTGAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGT
AGACATGTAGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATC
TTAGTCTCTTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTA
CTGATAGTTCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGC
TCACAGGCCCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTG
TTTCATCTGAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGC
AAAAAGTCACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTT
TGAATATTAAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGG
GCCATCATGGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGG
AAATAGTTGTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTG
CTTTTTGATGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTA
AAAGATCAAGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGG
AAGCTGCACACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCC
TGGAAATGGAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTT
CTAAACTGGAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTG
GCAGCGTCCTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAG
GGAAATGTTTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTT
CTGCTTTGTTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAA
CTTTTATGCTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCA
TCTCCTTCCTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTG

>In-frame_PPP6R3_ENST00000265637_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5070nt
GGGCGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGACCAGCATGTTTTG
GAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGT
TTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGA
AGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAA
TGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTT
CTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTAT
TATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCT
GAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACA
ATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGA
AAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAG
ACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAG
ACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGG
AATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGA
TGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACA
CAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTC
AGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTAC
TGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGAT
AAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAAT
GGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACG
GTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAAC
GGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGG
GGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAG
ACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAA
ACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCAC
CACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGA
TGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGA
ATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGC
CTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGA
CATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCA
ACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGA
AACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGC
CCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACA
GTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGA
AATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCAT
CCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGA
ACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGA
GGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGA
GCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGT
GGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGG
GAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTT
GCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGA
GTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGG
GCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCAC
ACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGA
GCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGC
ACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGA
GCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCC
ATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCC
ATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGC
TAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTA
CTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAAC
AGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGA
ACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCA
GTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCC
AGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGAC
AACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATG

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10029nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAG
GTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGC
ATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCT
ATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTT
GTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAG
TTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACT
ACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAA
TGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAA
CCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCA
ACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGT
TCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATA
ACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACA
AATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCT
ATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCA
TGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCT
CAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGA
CCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAA
GAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCAT
CAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGG
CCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAAT
TGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCA
GTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGA
TGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAA
GCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAG
ACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGA
TTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTC
CAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAG
AAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGC
ACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTG
CTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATG
AAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGT
CCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATA
CTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTC
CCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGA
GCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACC
CCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCA
TCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGT
CTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAG
AACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACC
TAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCT
CTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGG
CAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGA
GGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAG
AGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGA
GCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGA
CTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGC
AACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCT
GAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAATTTTAT
AATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAAGGGGAAAGAGAG
ATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAAAAAGTCATTTTCAGAGAACACCTTTATCAAAG
GCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAGGGAAGGAAGCAG
ATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTGAGGCATCGAATG
GGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGC
TTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATGGCCGGCTCTGCAAATTTATCATATAGTTTTTT
TCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGATAAGAGGAGGAAG
ACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCACACAGATGGGCATCTTGGCTCTCCCTGCCAGA
AAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGTTCTTGTAAAATG
AATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCTTCCAGTTTATTT
TCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATATTTGAATTGTTACATATGTTTAACATCCATTGA
ATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAAGTTTGTACACAG
TATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGAAGGAGTAGAGTT
GCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTACAATATGTTGATGGTGGCTGTAGTTGTTTAAA
TGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCATTAGGTCACAGC
GTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGTATATGTGAGTTG
CCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCCATTTAGGATGCT
GTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAAAACAGATTTAGT
CTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTCGTTGATGTCCACGTTACTGAGGATTGACTGAG
TATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACAGACTGTCAGCATGATGTCAGAGGCCAGAGTTT
GGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGA
AGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCAGTGATTATGTGT
ACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTTTTGTGATTCCTGGATATTTGTGTGTTGTAAAG
TGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAATACCCTGCCTTC
TTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGC
ATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGTTCCCTCTTCTCC
CCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAACCCACTAATACTGTGGGGAAAAAAAATTTTCA
AGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTACCTGCCTAAATAAACATCTTCTACAGAATATCT
GTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTGTTCCTGGGTTATTTACATAGCTGAGCAGTGTC
CAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTTTTATAATCTCCAGTGGCATCTTTCCCTTTTCT
TTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGAAAAACTTTGACTCTTGCCCAGTGCCTGCCTGC
CTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATTTTGGAGGAGTGTATGTGCATGTGTACACATAT
GTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATACAGAACTTGAGCTGAACCTGGTCAGTAGAAAG
GGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGTAGACATGTAGTACTATAGTACCGTAATATTCA
TCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATCTTAGTCTCTTCAGGATCTTTAGTATTTTCCTG
GTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCATTTTGCAAACTA
CCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGCTCACAGGCCCCAGACAGATGCTGTTGGGTAAA
CTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGTTCTGAAGTGATC
TAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGCATTTAAAAATTT
TTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTTTGAATATTAAAATGTGCATCATCTTGTCGGCC
ATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTGTGAGTAAGTGGG
TATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGGAAATAGTTGTCATTTCCTCAGTGATGGTGTGT
CTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGATGAAATTTTAGC
TGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTAAAAGATCAAGGCATGTATTAGACACAAGCATA
TTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGGAAGCTGCACACTCCTAACCCTTCTCCCAGGGT
GTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGGCCCTGGCTCCTG
CTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTTCTAAACTGGAATCATCCTTAATCACCTTGAAG
ATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTGGCAGCGTCCTGTGTACACATGCAGAGCTAATA
CCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAGGGAAATGTTTGATTTTTATGTTCTGTTGGATT
TTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACTTGTTCTAACATG
GAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAACTTTTATGCTCATGTTTTATTAAAGCAGGTGC
TCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCTGGTGGTTGGGAT
GTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTGAACTTGTGCGCAAATGTGCAGATTCAATGTTC

>In-frame_PPP6R3_ENST00000524904_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5218nt
CGCTTCGCTGATGGTGTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATAT
CCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCAC
AAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAG
ACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAAC
TTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCA
GATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAA
TGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCA
GAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGG
ATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGA
GGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAG
ACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAG
GTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGC
ATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCT
ATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTT
GTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAG
TTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACT
ACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAA
TGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAA
CCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCA
ACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGT
TCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATA
ACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACA
AATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCT
ATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCA
TGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCT
CAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGA
CCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAA
GAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCAT
CAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGG
CCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAAT
TGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCA
GTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGA
TGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAA
GCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAG
ACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGA
TTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTC
CAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAG
AAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGC
ACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTG
CTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATG
AAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGT
CCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATA
CTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTC
CCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGA
GCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACC
CCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCA
TCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGT
CTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAG
AACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACC
TAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCT
CTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGG
CAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGA
GGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAG
AGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGA
GCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGA
CTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGC
AACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCT

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10014nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTC
TACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGT
TCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTT
CAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAG
TTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAAC
CTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCC
TATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGT
CCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGA
TCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCA
AGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAAT
GGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAG
TCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAG
CAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAAT
ATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAG
AGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAAC
CCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACC
CACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGG
AGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGA
ATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAG
ACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGA
AAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTG
ACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTG
GAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTA
ATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGT
CTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAG
ACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTG
GACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCA
CACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGT
GGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTA
CCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAAC
ATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGA
ATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGG
AAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAA
TCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGC
TGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTC
TGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTG
AAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATT
ACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGG
AAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCA
AACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACA
TAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAAC
CATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCT
GTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACC
CAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGA
GGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAG
GCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTC
ACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTG
ACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATT
TTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGC
AAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAAAAAGTCATTTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTT
TCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGA
GATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCC
AGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCT
TCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATGGCCGGCTCTGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTAT
TTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGG
TGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCACACAGATGGGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCA
GTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGG
TTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTG
TTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATATTTGAATTGTTACATATGTTTAACATCCATTGAATGCAACGTTTTATT
TTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAA
TATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACAC
AGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTACAATATGTTGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATC
ACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGA
TTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCT
CCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTG
TTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACC
TCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTCGTTGATGTCCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACA
GGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACAGACTGTCAGCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGG
CAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTC
TGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGC
TCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTTTTGTGATTCCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGG
TATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCAC
CACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAA
CCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTA
ATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAACCCACTAATACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGT
CTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTACCTGCCTAAATAAACATCTTCTACAGAATATCTGTCATTCAACCATGC
CAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTGTTCCTGGGTTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCA
GTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTTTTATAATCTCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTG
ACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGAAAAACTTTGACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCT
CTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATTTTGGAGGAGTGTATGTGCATGTGTACACATATGTACATATATAAAAA
CAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATACAGAACTTGAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCT
TTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGTAGACATGTAGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTA
GTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATCTTAGTCTCTTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTT
GAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGG
ACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGCTCACAGGCCCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTAT
GAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTA
AAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATT
CTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTTTGAATATTAAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGG
CATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTG
ACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGGAAATAGTTGTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTT
GTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAAT
CCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTAAAAGATCAAGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACT
CCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGGAAGCTGCACACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGAC
GTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAAC
CAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTTCTAAACTGGAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCA
TTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTGGCAGCGTCCTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACT
GGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAGGGAAATGTTTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCA
TATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGA
AGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAACTTTTATGCTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTG
GGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCA
TAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTGAACTTGTGCGCAAATGTGCAGATTCAATGTTCTTGTTACAGATTGAA

>In-frame_PPP6R3_ENST00000393801_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5203nt
GTCGGTGAGCGCGTTTCCCGCCTGAGCGCAACTAGCGGCGGGTCGTGGGCACCTCCAGGAGAGCTTGTTTCATATCCATATCCCACTGTA
TTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATT
TCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAA
GAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGT
TAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAA
ATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCT
TCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGA
TTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGC
TCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAG
TTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAA
TTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTC
TACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGT
TCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTT
CAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAG
TTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAAC
CTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCC
TATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGT
CCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGA
TCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCA
AGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAAT
GGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAG
TCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAG
CAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAAT
ATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAG
AGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAAC
CCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACC
CACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGG
AGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGA
ATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAG
ACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGA
AAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTG
ACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTG
GAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTA
ATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGT
CTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAG
ACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTG
GACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCA
CACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGT
GGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTA
CCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAAC
ATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGA
ATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGG
AAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAA
TCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGC
TGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTC
TGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTG
AAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATT
ACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGG
AAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCA
AACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACA
TAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAAC
CATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCT
GTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACC
CAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGA
GGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAG
GCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTC
ACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTG

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10076nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACC
AAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACAT
CAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGA
AAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAAT
TCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGC
ACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGA
GAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTT
CACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATAT
TACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGT
GATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACA
GAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATA
TGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGT
GCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGA
CTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAA
ACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAA
CAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACA
TATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGG
ACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTG
CCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGA
TGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGA
GTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGT
GGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTC
AGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTC
AATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAA
AGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACC
AAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTG
CACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGA
AGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCAC
CTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAA
GAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAAT
GAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCT
GGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGT
GATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATC
ACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGT
CACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCA
TTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGC
CCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCT
GGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAG
TGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACA
GGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGT
GGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCT
CGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCA
GCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCAC
CAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATT
TGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACT
GCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAA
TGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGG
GGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTG
GGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAA
AAATCAAACCTCAAAAAAGTCATTTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTT
TGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCC
CTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATC
CAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAG
TAAGACATGATAATGGCCGGCTCTGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATG
AAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTG
GGTTGGTGGGATCCACACAGATGGGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGA
CATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATT
CTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAA
TTTCATAGATTATATTTGAATTGTTACATATGTTTAACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTT
TTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCA
TGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGT
TGATAGGAATCTGTACAATATGTTGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGT
AACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAAC
ATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGA
GGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCC
TGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCT
TGCAGATTTGCTTTCGTTGATGTCCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGA
AAATACAAATGCACAGACTGTCAGCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGG
TAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGA
CAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTAT
CTCATCCACTCAGTTTTGTGATTCCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGAC
AGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAAC
TTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACAC
TAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAAC
AAAGATGGGACAAAACCCACTAATACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTT
TATCATTTAATTTACCTGCCTAAATAAACATCTTCTACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGAC
TCCCAGAATTGGGTGTTCCTGGGTTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGT
CTTCTCTTCAGACTTTTATAATCTCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGG
CAAAGATGAATAGGAAAAACTTTGACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCAT
AGACTCTCACTTATTTTGGAGGAGTGTATGTGCATGTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAA
AGCCCCAGGAGCATACAGAACTTGAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACT
AATGGATACTGTAGTAGACATGTAGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGG
ATCATTCCTATCATCTTAGTCTCTTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCT
GTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGC
TCTGAGGTACTCTGCTCACAGGCCCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCAC
AGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTT
AAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGAT
ACTTTGTTTACATTTTGAATATTAAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTC
CTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATC
CAGCACTCTCTATGGAAATAGTTGTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTG
TTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTT
TTCCCTTCCAAACTAAAAGATCAAGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCC
TGCCACCAAAGCAGGAAGCTGCACACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTC
TGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGG
TCTAGGATAGGATTTCTAAACTGGAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTC
AAAGCAATGCTGGTGGCAGCGTCCTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAA
TCAGTAAGCCCACAGGGAAATGTTTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTT
TTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCC
CCAAGCCACCCCAAACTTTTATGCTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAA
TATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCA

>In-frame_PPP6R3_ENST00000265636_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5265nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACC
AAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACAT
CAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGA
AAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAAT
TCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGC
ACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGA
GAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTT
CACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATAT
TACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGT
GATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACA
GAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATA
TGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGT
GCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGA
CTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAA
ACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAA
CAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACA
TATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGG
ACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTG
CCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGA
TGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGA
GTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGT
GGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTC
AGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTC
AATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAA
AGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACC
AAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTG
CACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGA
AGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCAC
CTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAA
GAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAAT
GAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCT
GGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGT
GATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATC
ACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGT
CACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCA
TTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGC
CCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCT
GGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAG
TGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACA
GGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGT
GGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCT
CGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCA
GCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCAC
CAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATT
TGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACT
GCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAA
TGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGG

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_10076nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACC
AAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACAT
CAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGA
AAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAAT
TCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGC
ACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGA
GAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTT
CACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATAT
TACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGT
GATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACA
GAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATA
TGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGT
GCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGA
CTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAA
ACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAA
CAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACA
TATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGG
ACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTG
CCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGA
TGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGA
GTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGT
GGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTC
AGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTC
AATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAA
AGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACC
AAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTG
CACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGA
AGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCAC
CTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAA
GAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAAT
GAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCT
GGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGT
GATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATC
ACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGT
CACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCA
TTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGC
CCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCT
GGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAG
TGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACA
GGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGT
GGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCT
CGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCA
GCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCAC
CAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATT
TGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACT
GCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAA
TGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGG
GGCAGGTGTAATATGTAAGGAACATGCACTTTATTGGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTG
GGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAAGGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAA
AAATCAAACCTCAAAAAAGTCATTTTCAGAGAACACCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTT
TGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAGGGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCC
CTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTGAGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATC
CAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAGGTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAG
TAAGACATGATAATGGCCGGCTCTGCAAATTTATCATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATG
AAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGATAAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTG
GGTTGGTGGGATCCACACAGATGGGCATCTTGGCTCTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGA
CATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGTTCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATT
CTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCTTCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAA
TTTCATAGATTATATTTGAATTGTTACATATGTTTAACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTT
TTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAAGTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCA
TGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGAAGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGT
TGATAGGAATCTGTACAATATGTTGATGGTGGCTGTAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGT
AACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCATTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAAC
ATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGTATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGA
GGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCCATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCC
TGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAAAACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCT
TGCAGATTTGCTTTCGTTGATGTCCACGTTACTGAGGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGA
AAATACAAATGCACAGACTGTCAGCATGATGTCAGAGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGG
TAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTGAAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGA
CAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCAGTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTAT
CTCATCCACTCAGTTTTGTGATTCCTGGATATTTGTGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGAC
AGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAATACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAAC
TTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGTTAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACAC
TAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGTTCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAAC
AAAGATGGGACAAAACCCACTAATACTGTGGGGAAAAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTT
TATCATTTAATTTACCTGCCTAAATAAACATCTTCTACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGAC
TCCCAGAATTGGGTGTTCCTGGGTTATTTACATAGCTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGT
CTTCTCTTCAGACTTTTATAATCTCCAGTGGCATCTTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGG
CAAAGATGAATAGGAAAAACTTTGACTCTTGCCCAGTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCAT
AGACTCTCACTTATTTTGGAGGAGTGTATGTGCATGTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAA
AGCCCCAGGAGCATACAGAACTTGAGCTGAACCTGGTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACT
AATGGATACTGTAGTAGACATGTAGTACTATAGTACCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGG
ATCATTCCTATCATCTTAGTCTCTTCAGGATCTTTAGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCT
GTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCATTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGC
TCTGAGGTACTCTGCTCACAGGCCCCAGACAGATGCTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCAC
AGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGTTCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTT
AAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGCATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGAT
ACTTTGTTTACATTTTGAATATTAAAATGTGCATCATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTC
CTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTGTGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATC
CAGCACTCTCTATGGAAATAGTTGTCATTTCCTCAGTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTG
TTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGATGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTT
TTCCCTTCCAAACTAAAAGATCAAGGCATGTATTAGACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCC
TGCCACCAAAGCAGGAAGCTGCACACTCCTAACCCTTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTC
TGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGGCCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGG
TCTAGGATAGGATTTCTAAACTGGAATCATCCTTAATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTC
AAAGCAATGCTGGTGGCAGCGTCCTGTGTACACATGCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAA
TCAGTAAGCCCACAGGGAAATGTTTGATTTTTATGTTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTT
TTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACTTGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCC
CCAAGCCACCCCAAACTTTTATGCTCATGTTTTATTAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAA
TATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCTGGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCA

>In-frame_PPP6R3_ENST00000529710_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5265nt
CGTGGGCACCTCCAGATAAGAAAACAAGCTCAGAGAGATGTGGTGACTTGCTCAAATAGTGACAGAACTTCCTCGGCCATATGGAGGGGT
CATATAATACCCTTGTGTCTTCAGTTTGAGGAGAGCTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAAT
TGGAGGAAAACTGTTACCAGGATAACCTGTAATGGGCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAA
GACCAGCATGTTTTGGAAATTTGATCTTCACTCATCATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAAT
GGATGAGGAAGATGTTTTACAGGAATGTAAAGCTCAGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGT
CTCATTCATTATAGAAGAACCACCTCAAGACATGGATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGA
TGTCTCCCAGATGAATGATAGACTGGGAGAAGATGAATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCC
ACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTATTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGA
TTTTGTAGACCTTATTATAAAGCACATAGGAACTTCTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCC
CAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGAAAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACA
TTCAAATGCATCACAATCACTTTGTGAAATTGTTCGCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCT
GCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTCTAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACC
AAGAATCAGCCACAGACGGAACAAGCATGCAGGCGATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACAT
CAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGAATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGA
AAGCATCGTCCTAGGAATGGATTTCTCCTCTAATGACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAAT
TCATTTGGATGGTGATGGTGGGTTCAGTGTATCGACGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGC
ACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCAGAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGA
GAGCCATATCAACTCAGATCAATCCTCAGTCAATGAATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTT
CACCGACATACCTACTGAACGTGAACGAACAGAAAGGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATAT
TACATCCAAAGAGATAAGAACAGAGTTGGAAATGCAAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGT
GATCCTTGGTCAAATGGATAGCCCTACACAGATATTTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACA
GAACCGAGGGGTACGGTATATCTTGAATGTCACTCGAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATA
TGATGAAGAGGCAACGGATCTCCTGGCGTACTGGAATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGT
GCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCACCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGA
CTATGTGAAAGAAAGACGAACGGTAACCAAGCCCAACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAA
ACAGCGGCATAACAAACTATGGAGATCTCATTCAGATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAA
CAAGAAGGATATCACCACCTCAGCAGACCAGATTGCTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACA
TATGGTCCCACAAGATGCAAATCAGAAAGGCCTGTGTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGG
ACAGATTGAGGATGAATTAAACTTAAATGACATCAATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTG
CCATGCATCCAAAGCCTTAATTCAGCCTGGACATGTCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGA
TGCACTGAAAGCAGACATGAATGTCCACCTACTGCCTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGA
GTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAATCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGT
GGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTTCCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTC
AGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTGATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTC
AATGGATGAGGAACAGTCAAAGGCAATTTCAGAACTGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAA
AGAAATTGTCACTGAAATTGAGTCCATCAGTCAAGGAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACC
AAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGAGGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTG
CACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGATGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGA
AGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGGGCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCAC
CTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAGAGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAA
GAATGATTCTTCTGTGGCAGACCTAGCACCAAAAGGGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAAT
GAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGGCTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCT
GGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCCCAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGT
GATTCCATACCAGGAGTCTGAAACACAAGCAGTCCCTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATC
ACCCAATCACACTGGGCCAGGGAGTGAAATAGCCACCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGT
CACTGTGCTCTGCACACTGGATGAAAATCTAAACAGGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCA
TTCTTCCTCCCCTGAGCACAACAGACCCACTGACCATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGC
CCTGGAGACAGCAGCACCTTTTGTCAGTCATACAACCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCT
GGAGGGCTTCACAGAGCAGAGCAGCACTACAGATGAGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAG
TGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAAGTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACA
GGAGAAAATGGACCCATTGCCTGTAGCCTGTCGACTCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGT
GGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAGTGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCT
CGCCAAATTAGGTTACTTGGACCTCTGTAAAGACTGCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCA
GCCTTTCCTCAGAACAGACTCAGGCATGCACGCGATGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCAC
CAAGTCTTTTGTAGAACAACTCACAACAACAGAGTGTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATT
TGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAGGACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACT
GCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGGCACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAA
TGACAAAAAACGGACAACCAACCCCTTCTATAATACCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGG

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000269033_chr17_28030080_-_9951nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTC
TAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCG
ATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGA
ATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATG
ACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGA
CGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCA
GAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATG
AATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAA
GGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGC
AAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATAT
TTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTC
GAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGA
ATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCA
CCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCA
ACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAG
ATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTG
CTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGT
GTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCA
ATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATG
TCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGC
CTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAA
TCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTT
CCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTG
ATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAAC
TGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAG
GAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGA
GGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGA
TGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGG
GCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAG
AGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAG
GGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGG
CTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCC
CAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCC
CTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCA
CCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACA
GGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACC
ATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAA
CCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATG
AGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAA
GTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGAC
TCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAG
TGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACT
GCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGA
TGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGT
GTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAG
GACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGG
CACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATA
CCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATT
GGTTAATTTTATAATATTTTGGTCATTTTACTGTTTCTGGTGCATGCAGGGTTTGGGTGTTTTTCAGTGTGTATGTGTGTGTATATGTAA
GGGGAAAGAGAGATTGATCTGGATGGCAAGACCGTTTATCATTTTTTATTTAAAAAAATCAAACCTCAAAAAAGTCATTTTCAGAGAACA
CCTTTATCAAAGGCAAATTGCTGTTTTTCAGTCAGCTGCCACCTGCTTCTCATTTTGCCCTCTGAGAAAAGGCATGGTTTCTTAATTGAG
GGAAGGAAGCAGATTCGGAGGGGTGGAGATAAAGCTGGGGATTGGAGATGTTCCCCTGCCTTTGTGATGATGGTTTGGTTTCCAGACCTG
AGGCATCGAATGGGCTAAAGGTCAGCCAGAAGTCAGAGGGCTCTCAGCCTTCATCCAGCCGCAGCCCTTTAGAGTTCCTGAAGGAGGCAG
GTTCCGCTTTGCTTTAAAAGAGGGTCTTCCGGTGTTCCAGAGTGTATCGTTACAGTAAGACATGATAATGGCCGGCTCTGCAAATTTATC
ATATAGTTTTTTTCCCAAGAAAATTATTTTTGAAATTAAAACAGGACCCCAAATGAAATCCAAGTGGTCTTCTGTAGAGGAAAGCATGAT
AAGAGGAGGAAGACATAAAGTTGGGGGTGGAGAGGCTGCTGCCCAGAAACTGCTGGGTTGGTGGGATCCACACAGATGGGCATCTTGGCT
CTCCCTGCCAGAAAAATGTGCTCTGCAGTGTCCTCCCAACTGAAAACAACAGTGACATGTTTGAAAAGCAGCAATCGAAAGTCAGTGTGT
TCTTGTAAAATGAATATGTATGTAGGGTTTTAACCCTTCCATTACTTGAATAATTCTTTGGGCCTTCTGAGTTTAATGGCCATATTTTCT
TCCAGTTTATTTTCCTTCCCCATGCTGTTGTCCCCATGCTGCCTATTTTTTTAAATTTCATAGATTATATTTGAATTGTTACATATGTTT
AACATCCATTGAATGCAACGTTTTATTTTTGGTATTATCACTGTTAACACTTTTTTTTCCTTTTCCTGGAAGGTTTGTCATTTCTCTAAA
GTTTGTACACAGTATTTATGTACATAATATTGTCACTGTCTTAGTGTCTTGTTCATGTTGTAGGGTAATTTTGATTTATTCTTTTTAAGA
AGGAGTAGAGTTGCAACTGGAAAACACAGACACCAGAAATGAAAGTGTTGGGTGTTGATAGGAATCTGTACAATATGTTGATGGTGGCTG
TAGTTGTTTAAATGGAGACTTCCAATCACCAGCTCCTGCCAAATTATGCATTAGTAACTTTTTCCTCAGAGACACCCCTAAAGGCTCCCA
TTAGGTCACAGCGTGACTGAAAGCTGATTTCTCTGTGAGACTGAAATCCCAGAACATTGTTTGCCAGTATCTCAACCACAGCCAGGAAGT
ATATGTGAGTTGCCCAGAGTGGAAGCTCCTAGTAGAGGCTGAAGGCCACAGGGGAGGCCTCAGCCAGGGGCAAGTGCCCACAGTGACTCC
ATTTAGGATGCTGTCGTTTTGCTACTGTTGTGGAGATCCTTAACGCAGCAGCGCCTGTCATAAACAAGCCTCTTGTAGCTTCTTACAGAA
AACAGATTTAGTCTAGCATGAAACACCTCTGCATCTCATTGAAACTGAAGAGGCTTGCAGATTTGCTTTCGTTGATGTCCACGTTACTGA
GGATTGACTGAGTATAGACTGGAGACAGGTTTTTGGCTTATCACAGCACTGAGGAAAATACAAATGCACAGACTGTCAGCATGATGTCAG
AGGCCAGAGTTTGGTGGGGGCAGATGGCAGGGCGACCCAAAAGATGCAGAAAAGGTAGACTGGGGCCACTGGGTCTTAAGAGGAGCTGTG
AAGTTGTGTGGAAGCCAAGGCTGGGTCTGACATCCCTGCCAGGAAGCAGGTTGGACAGAAACCACTTGCTAAAAGCGTCTCTATGGTGCA
GTGATTATGTGTACCCTGTGCTGTTGCTCAGTAGTCTCCTTGAATGTTCAAGTATCTCATCCACTCAGTTTTGTGATTCCTGGATATTTG
TGTGTTGTAAAGTGTTTTGTTAGGTGGTATGAACCAATGTGAGGAGGCTTGAGACAGGGTTATGGATTTCCAGAGCTCTTCCATGTAGAA
TACCCTGCCTTCTTGAAGCAGTTCCACCACCAATATGATGGGGAAGGGCAGGAACTTATGGCAGGGTGGGGAGAGGGTTTGCCTGGAAGT
TAAGAGAGTGGCATCCACTTGTGGTAACCCCTTACGATGATGACATCCCACACACTAAGAGGTACAAGCAGGACCAAAGTTTTGGACTGT
TCCCTCTTCTCCCCTCCACTGTGTTTAATGTTCACTCACTGCATTAAATAACAACAAAGATGGGACAAAACCCACTAATACTGTGGGGAA
AAAAAATTTTCAAGAGCAGAGGAAAGTCTTTCTGCCTTTTTATAATTACTTTTTTTATCATTTAATTTACCTGCCTAAATAAACATCTTC
TACAGAATATCTGTCATTCAACCATGCCAAGGAGTTTGTGCCAGCCTTTTCAGACTCCCAGAATTGGGTGTTCCTGGGTTATTTACATAG
CTGAGCAGTGTCCAGGGGAGGTGCGCAGTGAACTGTCAAGGACTTTCCAGACTGTCTTCTCTTCAGACTTTTATAATCTCCAGTGGCATC
TTTCCCTTTTCTTTTGTTCATGACCTGACCTGAAGCAGCAGATTTGATAGACTGGCAAAGATGAATAGGAAAAACTTTGACTCTTGCCCA
GTGCCTGCCTGCCTCTCTCTCTCTCCTCTCTCTCTCTCTCTTTTTAAACCACCATAGACTCTCACTTATTTTGGAGGAGTGTATGTGCAT
GTGTACACATATGTACATATATAAAAACAGTTGATGTTTTGGTGTATGGGGTAAAAGCCCCAGGAGCATACAGAACTTGAGCTGAACCTG
GTCAGTAGAAAGGGAAACCCCAACCCTTTCTTGATTTTTGGAGACACCCAGGACTAATGGATACTGTAGTAGACATGTAGTACTATAGTA
CCGTAATATTCATCTCTCCTCATTTTAGTTGCCTTTCAGATTCTAAATGTTTGGGATCATTCCTATCATCTTAGTCTCTTCAGGATCTTT
AGTATTTTCCTGGTTCTGAGGAGGCTTGAGACAGGGTTATGGATTTCCTTGTTCTGTGTCTTTATCCCTACTGATAGTTCCTCTTTCTCA
TTTTGCAAACTACCCAGAGCTCCAAGGACAGCCTGAAGATCTCAGTGCCTCAGGCTCTGAGGTACTCTGCTCACAGGCCCCAGACAGATG
CTGTTGGGTAAACTCAAAGCTTCCTATGAGAAGCTTCTGAGATGTAGCAGGTCACAGAAGTGTTCACCTGTTTCATCTGAGGATTTCAGT
TCTGAAGTGATCTAGGCATGTTTGGTAAAAATGTTTTTGTGAGAGTTCTTTTTTTAAGAAAGCATTATGCAAAAAGTCACTTTTAAGGGC
ATTTAAAAATTTTTAAGTAAAGCCATTCTTTGGCTTTTTTGGACTATTTGTGGATACTTTGTTTACATTTTGAATATTAAAATGTGCATC
ATCTTGTCGGCCATGCAGTCCTGCAGGCATCAGTGCCCTGGCTGTCCTGTGAGTCCTCATGCAGAGCAGGGCCATCATGGTCAGCCCTTG
TGAGTAAGTGGGTATACGCTGAAGCTGACTTCCGTCTGTGTCCTGCCCTCCCATCCAGCACTCTCTATGGAAATAGTTGTCATTTCCTCA
GTGATGGTGTGTCTTATAGTGATGGTTGTAATGGTGAATGGCTAGTGTCATTTTGTTTAATTTTGTTTTGCTTTTTGATGGTGGATAAGA
TGAAATTTTAGCTGTTTCAGCATCAATCCAACTTAAAAGCATCTTGGACTTTGTTTTCCCTTCCAAACTAAAAGATCAAGGCATGTATTA
GACACAAGCATATTTGCTGCCTCAACTCCTCTGACACCCATATTAGGAAAAGGCCTGCCACCAAAGCAGGAAGCTGCACACTCCTAACCC
TTCTCCCAGGGTGTGGGGTCCCTTGACGTCATGAAGAGCTATTGCAAGGTGCTTCTGTACTTTTCCAGCCTGGAAATGGAGGGTGACTGG
CCCTGGCTCCTGCTATGAGAAGATAACCAGCCTCATTTTCTCAGTGCCCCAGAGGTCTAGGATAGGATTTCTAAACTGGAATCATCCTTA
ATCACCTTGAAGATCCCTTAAGAGGCATTTGACTGGTGCTGCCGTCTGTGTCCTCAAAGCAATGCTGGTGGCAGCGTCCTGTGTACACAT
GCAGAGCTAATACCCAAACTAAAAACTGGGTAACTGGCCCTGAAGTGCTTCCCAATCAGTAAGCCCACAGGGAAATGTTTGATTTTTATG
TTCTGTTGGATTTTGGTTTGCTTGGCATATCTAAAGGTGCCTTTACTTTTCTTTTTTTTTTTTTTTCTTTCTGCTTTGTTTTGTAGGACT
TGTTCTAACATGGAAAACAAGTCCAGAAGACTCTCCTCTGACTGTTACCTTTGCCCCAAGCCACCCCAAACTTTTATGCTCATGTTTTAT
TAAAGCAGGTGCTCCCTGGAATCTCTGGGACATTTTTGAGGCATTTGAAGCAGAATATAGAGTGGTCTCATCTCCTTCCTTAATCTTCCT
GGTGGTTGGGATGTTCCACTTGTATCATAGATTTTTTTATTACAGATATGCTCCACTGTTTTTAAATGTGAACTTGTGCGCAAATGTGCA

>In-frame_PPP6R3_ENST00000527403_chr11_68321725_+_SSH2_ENST00000540801_chr17_28030080_-_5140nt
CTTGTTTCATATCCATATCCCACTGTATTCCTGCTAATCTGCTAATGCAGTAAATTGGAGGAAAACTGTTACCAGGATAACCTGTAATGG
GCAAGGAGCCACAAAGAAGAAAACATTTCTTTTAATTTTTAAACTTGGTTTGAAAGACCAGCATGTTTTGGAAATTTGATCTTCACTCAT
CATCCCACATAGACACACTTCTAGAAAGAGAAGATGTAACACTGAAGGAGTTAATGGATGAGGAAGATGTTTTACAGGAATGTAAAGCTC
AGAACCGCAAACTTATAGAGTTTCTGTTAAAAGCAGAATGTCTCGAAGATTTAGTCTCATTCATTATAGAAGAACCACCTCAAGACATGG
ATGAAAAGATCAGATACAAGTATCCAAATATATCTTGTGAGTTGCTCACTTCTGATGTCTCCCAGATGAATGATAGACTGGGAGAAGATG
AATCCTTGCTAATGAAATTATATAGCTTCCTCCTAAACGATTCCCCTTTGAATCCACTACTTGCCAGTTTCTTCAGCAAGGTGCTAAGTA
TTCTTATCAGCAGAAAACCAGAACAGATTGTGGATTTCTTAAAGAAGAAGCATGATTTTGTAGACCTTATTATAAAGCACATAGGAACTT
CTGCTATCATGGATTTGTTGCTCAGGCTCCTGACGTGTATCGAACCTCCACAGCCCAGGCAAGATGTGCTGAATTGGTTAAATGAGGAGA
AAATTATCCAGAGGCTTGTGGAAATAGTTCATCCATCGCAAGAAGAAGATCGACATTCAAATGCATCACAATCACTTTGTGAAATTGTTC
GCCTGAGCAGAGACCAGATGTTACAAATTCAGAACAGTACAGAGCCCGACCCCCTGCTTGCCACTCTAGAAAACATCAGCGAGAGCTTTC
TAACTGTCAAAGGTGCTGCCCTTTTTCTACCACGGGGAAATGGCTCATCCACACCAAGAATCAGCCACAGACGGAACAAGCATGCAGGCG
ATCTCCAACAGCATCTCCAAGCAATGTTCATTTTACTCCGCCCAGAAGACAACATCAGGCTGGCTGTAAGACTGGAAAGTACTTACCAGA
ATCGAACACGCTATATGGTAGTGGTTTCAACTAATGGTAGACAAGACACTGAAGAAAGCATCGTCCTAGGAATGGATTTCTCCTCTAATG
ACAGTAGCACTTGTACCATGGGCTTAGTTTTGCCTCTCTGGAGCGACACGCTAATTCATTTGGATGGTGATGGTGGGTTCAGTGTATCGA
CGGATAACAGAGTTCACATATTCAAACCTGTATCTGTGCAGGCAATGTGGTCTGCACTACAGAGCTTACACAAGGCTTGTGAAGTCGCCA
GAGCGCATAACTACTACCCAGGCAGCCTATTTCTCACTTGGGTGAGTTATTATGAGAGCCATATCAACTCAGATCAATCCTCAGTCAATG
AATGGAATGCAATGCAAGATGTACAGTCCCACCGGCCCGACTCTCCAGCTCTCTTCACCGACATACCTACTGAACGTGAACGAACAGAAA
GGCTAATTAAAACCAAATTAAGGGAGATCATGATGCAGAAGGATTTGGAGAATATTACATCCAAAGAGATAAGAACAGAGTTGGAAATGC
AAATGGTGTGCAACTTGCGGGAATTCAAGGAATTTATAGACAATGAAATGATAGTGATCCTTGGTCAAATGGATAGCCCTACACAGATAT
TTGAGCATGTGTTCCTGGGCTCAGAATGGAATGCCTCCAACTTAGAGGACTTACAGAACCGAGGGGTACGGTATATCTTGAATGTCACTC
GAGAGATAGATAACTTCTTCCCAGGAGTCTTTGAGTATCATAACATTCGGGTATATGATGAAGAGGCAACGGATCTCCTGGCGTACTGGA
ATGACACTTACAAATTCATCTCTAAAGCAAAGAAACATGGATCTAAATGCCTTGTGCACTGCAAAATGGGGGTGAGTCGCTCAGCCTCCA
CCGTGATTGCCTATGCAATGAAGGAATATGGCTGGAATCTGGACCGAGCCTATGACTATGTGAAAGAAAGACGAACGGTAACCAAGCCCA
ACCCAAGCTTCATGAGACAACTGGAAGAGTATCAGGGGATCTTGCTGGCAAGCAAACAGCGGCATAACAAACTATGGAGATCTCATTCAG
ATAGTGACCTCTCAGACCACCACGAACCCATCTGCAAACCTGGGCTAGAACTCAACAAGAAGGATATCACCACCTCAGCAGACCAGATTG
CTGAGGTGAAGACCATGGAGAGTCACCCACCCATACCTCCTGTCTTTGTGGAACATATGGTCCCACAAGATGCAAATCAGAAAGGCCTGT
GTACCAAAGAAAGAATGATCTGCTTGGAGTTTACTTCTAGGGAATTTCATGCTGGACAGATTGAGGATGAATTAAACTTAAATGACATCA
ATGGATGCTCATCAGGGTGTTGTCTGAATGAATCAAAATTTCCTCTTGACAATTGCCATGCATCCAAAGCCTTAATTCAGCCTGGACATG
TCCCAGAAATGGCCAACAAGTTTCCAGACTTAACAGTGGAAGATTTGGAGACAGATGCACTGAAAGCAGACATGAATGTCCACCTACTGC
CTATGGAAGAATTGACATCTCCACTGAAAGACCCCCCCATGTCCCCTGATCCTGAGTCACCAAGCCCCCAACCCAGTTGCCAGACTGAAA
TCTCAGATTTCAGTACAGATCGCATTGACTTTTTTAGTGCCCTAGAGAAGTTTGTGGAGCTCTCCCAAGAAACCCGGTCACGATCTTTTT
CCCATTCAAGGATGGAGGAACTGGGTGGAGGAAGGAATGAGAGCTGTCGACTGTCAGTGGTAGAAGTAGCCCCTTCCAAAGTGACAGCTG
ATGACCAGAGAAGCAGCTCTTTGAGTAATACTCCCCATGCATCAGAAGAATCTTCAATGGATGAGGAACAGTCAAAGGCAATTTCAGAAC
TGGTCAGCCCAGACATCTTCATGCAGTCTCACTCGGAAAATGCAATTTCAGTCAAAGAAATTGTCACTGAAATTGAGTCCATCAGTCAAG
GAGTTGGGCAGATTCAACTGAAAGGAGACATCTTACCCAACCCATGCCATACACCAAAGAAGAACAGCATCCATGAGCTGCTCCTTGAGA
GGGCCCAGACTCCAGAGAACAAACCTGGACATATGGAGCAAGATGAGGACTCCTGCACAGCCCAGCCTGAACTAGCCAAAGACTCAGGGA
TGTGCAACCCAGAAGGCTGCCTAACCACACACTCATCTATAGCAGACTTGGAAGAAGGGGAACCAGCTGAGGGGGAACAAGAGCTCCAGG
GCTCAGGGATGCACCCAGGTGCCAAGTGGTACCCTGGGTCTGTGAGGCGAGCCACCTTGGAGTTCGAAGAGCGCTTACGGCAGGAGCAAG
AGCATCATGGTGCTGCCCCAACATGTACCTCATTGTCCACTCGTAAGAATTCAAAGAATGATTCTTCTGTGGCAGACCTAGCACCAAAAG
GGAAAAGTGATGAAGCCCCCCCAGAACATTCATTTGTCCTCAAGGAACCAGAAATGAGCAAAGGCAAAGGGAAATACAGTGGGTCTGAGG
CTGGCTCACTGTCCCATTCTGAGCAGAATGCCACTGTTCCAGCTCCCAGGGTGCTGGAGTTTGACCACTTGCCAGATCCTCAGGAGGGCC
CAGGGTCAGATACTGGAACACAGCAGGAAGGAGTCCTGAAGGATCTGAGGACTGTGATTCCATACCAGGAGTCTGAAACACAAGCAGTCC
CTCTTCCCCTTCCCAAGAGGGTAGAAATCATTGAATATACCCACATAGTTACATCACCCAATCACACTGGGCCAGGGAGTGAAATAGCCA
CCAGTGAGAAGAGCGGAGAGCAAGGGCTGAGGAAAGTGAACATGGAAAAATCTGTCACTGTGCTCTGCACACTGGATGAAAATCTAAACA
GGACTCTGGACCCCAACCAGGTTTCTCTGCACCCCCAAGTGCTACCTCTGCCTCATTCTTCCTCCCCTGAGCACAACAGACCCACTGACC
ATCCAACCTCCATCCTGAGTAGCCCTGAAGACAGAGGCAGCAGCCTGTCCACAGCCCTGGAGACAGCAGCACCTTTTGTCAGTCATACAA
CCCATTTACTGTCTGCCAGTTTGGATTACCTGCATCCCCAGACTATGGTTCACCTGGAGGGCTTCACAGAGCAGAGCAGCACTACAGATG
AGCCCTCTGCAGAACAGGTTAGCTGGGAAGAAAGTCAGGAGAGCCCTCTCTCCAGTGGCAGTGAGGTGCCATATAAGGACTCCCAGCTAA
GTAGCGCAGACCTAAGTTTAATTAGCAAACTTGGTGACAACACTGGGGAGTTACAGGAGAAAATGGACCCATTGCCTGTAGCCTGTCGAC
TCCCACATAGCTCTAGTAGTGAAAACATAAAGAGTCTCAGCCACAGCCCCGGTGTGGTGAAGGAGCGTGCTAAAGAAATCGAGTCTCGAG
TGGTTTTCCAGGCAGGGCTCACCAAACCATCCCAAATGAGGCGCTCAGCTTCTCTCGCCAAATTAGGTTACTTGGACCTCTGTAAAGACT
GCTTACCAGAGAGGGAGCCTGCCTCCTGTGAATCCCCTCATCTCAAACTGCTTCAGCCTTTCCTCAGAACAGACTCAGGCATGCACGCGA
TGGAGGACCAAGAGTCCCTAGAAAACCCAGGTGCCCCCCACAACCCAGAGCCCACCAAGTCTTTTGTAGAACAACTCACAACAACAGAGT
GTATTGTGCAGAGCAAGCCAGTGGAGAGGCCCCTTGTGCAGTATGCCAAAGAATTTGGTTCTAGTCAGCAGTATTTGCTCCCCAGGGCAG
GACTTGAATTGACTAGTTCTGAAGGAGGCCTTCCCGTGCTACAGACCCAGGGACTGCAGTGTGCATGCCCAGCTCCAGGGCTGGCCGTGG
CACCCCGTCAGCAACACGGCAGAACTCACCCCCTTAGGAGACTGAAAAAGGCAAATGACAAAAAACGGACAACCAACCCCTTCTATAATA
CCATGTGATTCTGAGCCTACACATGTGACTTTCTAGAAGAAATGTTTGTAAAAGGGGCAGGTGTAATATGTAAGGAACATGCACTTTATT


Top

FusionGenePPI for PPP6R3_SSH2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPP6R3KDM6A, TNFAIP3, USP21, USP36, USP49, PPP6C, PRKDC, HDAC1, HDAC2, ELAVL1, SIRT7, TERF2IP, TINF2, TFAP4, GRK5, PFAS, BRCA1, ECT2, NOTCH1, LATS1, GPSM1, HDAC11, USP10, ANKRD28, MOB1A, MOB1B, ACAD11, ANKRD44, ANKRD52, AP1B1, AP2A1, AP2A2, AURKA, DNAJC11, ECH1, ERLIN2, PPP6R1, PPP6R2, CDC37, ENAH, ETFA, HSP90AA1, HSP90AB1, RUVBL2, SRRT, TPM1, USP7, CSNK1E, SNAI2, RNF2, GPHA2, RPS6KB2, UNK, DIEXF, NSUN5, EIF4A3, TIPRL, NTRK1, CEP44, CEP19, XPO1, ZNRF2, ZNF746, TRMT2A, TRIM25, TESSSH2ACTB, ELAVL1, BAG3, XPO1, CAPZA2, DBN1, FLNA, MYH9, PPP1CB, IQGAP1, KIF3A, SYNPO, LIMA1, ANLN, MYO19, MYO18A, GAN, FBXW7, MYO1D, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPP6R3_SSH2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPP6R3_SSH2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource