FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2843

FusionGeneSummary for ARRB1_TPCN2

check button Fusion gene summary
Fusion gene informationFusion gene name: ARRB1_TPCN2
Fusion gene ID: 2843
HgeneTgene
Gene symbol

ARRB1

TPCN2

Gene ID

408

219931

Gene namearrestin beta 1two pore segment channel 2
SynonymsARB1|ARR1SHEP10|TPC2
Cytomap

11q13.4

11q13.3

Type of geneprotein-codingprotein-coding
Descriptionbeta-arrestin-1arrestin 2non-visual arrestin-2two pore calcium channel protein 2voltage-dependent calcium channel protein TPC2
Modification date2018052220180522
UniProtAcc

P49407

Q8NHX9

Ensembl transtripts involved in fusion geneENST00000420843, ENST00000393505, 
ENST00000360025, 
ENST00000294309, 
ENST00000542467, ENST00000442692, 
Fusion gene scores* DoF score15 X 6 X 6=54010 X 7 X 6=420
# samples 2110
** MAII scorelog2(21/540*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/420*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARRB1 [Title/Abstract] AND TPCN2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARRB1

GO:0031397

negative regulation of protein ubiquitination

16378096

HgeneARRB1

GO:0032088

negative regulation of NF-kappaB transcription factor activity

16378096

HgeneARRB1

GO:0032715

negative regulation of interleukin-6 production

16378096

HgeneARRB1

GO:0032717

negative regulation of interleukin-8 production

16378096

HgeneARRB1

GO:0070374

positive regulation of ERK1 and ERK2 cascade

10644702

TgeneTPCN2

GO:0006874

cellular calcium ion homeostasis

19387438


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A109-01AARRB1chr11

74994331

-TPCN2chr11

68845950

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000420843ENST00000294309ARRB1chr11

74994331

-TPCN2chr11

68845950

+
In-frameENST00000420843ENST00000542467ARRB1chr11

74994331

-TPCN2chr11

68845950

+
5CDS-3UTRENST00000420843ENST00000442692ARRB1chr11

74994331

-TPCN2chr11

68845950

+
In-frameENST00000393505ENST00000294309ARRB1chr11

74994331

-TPCN2chr11

68845950

+
In-frameENST00000393505ENST00000542467ARRB1chr11

74994331

-TPCN2chr11

68845950

+
5CDS-3UTRENST00000393505ENST00000442692ARRB1chr11

74994331

-TPCN2chr11

68845950

+
In-frameENST00000360025ENST00000294309ARRB1chr11

74994331

-TPCN2chr11

68845950

+
In-frameENST00000360025ENST00000542467ARRB1chr11

74994331

-TPCN2chr11

68845950

+
5CDS-3UTRENST00000360025ENST00000442692ARRB1chr11

74994331

-TPCN2chr11

68845950

+

Top

FusionProtFeatures for ARRB1_TPCN2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARRB1

P49407

TPCN2

Q8NHX9

Functions in regulating agonist-mediated G-proteincoupled receptor (GPCR) signaling by mediating both receptordesensitization and resensitization processes. During homologousdesensitization, beta-arrestins bind to the GPRK-phosphorylatedreceptor and sterically preclude its coupling to the cognate G-protein; the binding appears to require additional receptordeterminants exposed only in the active receptor conformation. Thebeta-arrestins target many receptors for internalization by actingas endocytic adapters (CLASPs, clathrin-associated sortingproteins) and recruiting the GPRCs to the adapter protein 2complex 2 (AP-2) in clathrin-coated pits (CCPs). However, theextent of beta-arrestin involvement appears to vary significantlydepending on the receptor, agonist and cell type. Internalizedarrestin-receptor complexes traffic to intracellular endosomes,where they remain uncoupled from G-proteins. Two different modesof arrestin-mediated internalization occur. Class A receptors,like ADRB2, OPRM1, ENDRA, D1AR and ADRA1B dissociate from beta-arrestin at or near the plasma membrane and undergo rapidrecycling. Class B receptors, like AVPR2, AGTR1, NTSR1, TRHR andTACR1 internalize as a complex with arrestin and traffic with itto endosomal vesicles, presumably as desensitized receptors, forextended periods of time. Receptor resensitization then requiresthat receptor-bound arrestin is removed so that the receptor canbe dephosphorylated and returned to the plasma membrane. Involvedin internalization of P2RY4 and UTP-stimulated internalization ofP2RY2. Involved in phosphorylation-dependent internalization ofOPRD1 ands subsequent recycling. Involved in the degradation ofcAMP by recruiting cAMP phosphodiesterases to ligand-activatedreceptors. Beta-arrestins function as multivalent adapter proteinsthat can switch the GPCR from a G-protein signaling mode thattransmits short-lived signals from the plasma membrane via smallmolecule second messengers and ion channels to a beta-arrestinsignaling mode that transmits a distinct set of signals that areinitiated as the receptor internalizes and transits theintracellular compartment. Acts as signaling scaffold for MAPKpathways such as MAPK1/3 (ERK1/2). ERK1/2 activated by the beta-arrestin scaffold is largely excluded from the nucleus andconfined to cytoplasmic locations such as endocytic vesicles, alsocalled beta-arrestin signalosomes. Recruits c-Src/SRC to ADRB2resulting in ERK activation. GPCRs for which the beta-arrestin-mediated signaling relies on both ARRB1 and ARRB2 (codependentregulation) include ADRB2, F2RL1 and PTH1R. For some GPCRs thebeta-arrestin-mediated signaling relies on either ARRB1 or ARRB2and is inhibited by the other respective beta-arrestin form(reciprocal regulation). Inhibits ERK1/2 signaling in AGTR1- andAVPR2-mediated activation (reciprocal regulation). Is required forSP-stimulated endocytosis of NK1R and recruits c-Src/SRC tointernalized NK1R resulting in ERK1/2 activation, which isrequired for the antiapoptotic effects of SP. Is involved inproteinase-activated F2RL1-mediated ERK activity. Acts assignaling scaffold for the AKT1 pathway. Is involved in alpha-thrombin-stimulated AKT1 signaling. Is involved in IGF1-stimulatedAKT1 signaling leading to increased protection from apoptosis.Involved in activation of the p38 MAPK signaling pathway and inactin bundle formation. Involved in F2RL1-mediated cytoskeletalrearrangement and chemotaxis. Involved in AGTR1-mediated stressfiber formation by acting together with GNAQ to activate RHOA.Appears to function as signaling scaffold involved in regulationof MIP-1-beta-stimulated CCR5-dependent chemotaxis. Involved inattenuation of NF-kappa-B-dependent transcription in response toGPCR or cytokine stimulation by interacting with and stabilizingCHUK. May serve as nuclear messenger for GPCRs. Involved in OPRD1-stimulated transcriptional regulation by translocating to CDKN1Band FOS promoter regions and recruiting EP300 resulting inacetylation of histone H4. Involved in regulation of LEF1transcriptional activity via interaction with DVL1 and/or DVL2Also involved in regulation of receptors other than GPCRs.Involved in Toll-like receptor and IL-1 receptor signaling throughthe interaction with TRAF6 which prevents TRAF6 autoubiquitinationand oligomerization required for activation of NF-kappa-B and JUN.Binds phosphoinositides. Binds inositolhexakisphosphate (InsP6)(By similarity). Involved in IL8-mediated granule release inneutrophils. Required for atypical chemokine receptor ACKR2-induced RAC1-LIMK1-PAK1-dependent phosphorylation of cofilin(CFL1) and for the up-regulation of ACKR2 from endosomalcompartment to cell membrane, increasing its efficiency inchemokine uptake and degradation. Involved in the internalizationof the atypical chemokine receptor ACKR3. Negatively regulates theNOTCH signaling pathway by mediating the ubiquitination anddegradation of NOTCH1 by ITCH. Participates to the recruitment ofthe ubiquitin-protein ligase to the receptor (PubMed:23886940).{ECO:0000250, ECO:0000269|PubMed:12464600,ECO:0000269|PubMed:14711824, ECO:0000269|PubMed:15475570,ECO:0000269|PubMed:15611106, ECO:0000269|PubMed:15671180,ECO:0000269|PubMed:15878855, ECO:0000269|PubMed:16144840,ECO:0000269|PubMed:16280323, ECO:0000269|PubMed:16378096,ECO:0000269|PubMed:16492667, ECO:0000269|PubMed:16709866,ECO:0000269|PubMed:18337459, ECO:0000269|PubMed:18419762,ECO:0000269|PubMed:19620252, ECO:0000269|PubMed:19643177,ECO:0000269|PubMed:22457824, ECO:0000269|PubMed:23341447,ECO:0000269|PubMed:23633677, ECO:0000269|PubMed:23886940}. Nicotinic acid adenine dinucleotide phosphate (NAADP)receptor that may function as one of the major voltage-gatedCa(2+) channels (VDCC) across the lysosomal membrane. May beinvolved in smooth muscle contraction.{ECO:0000269|PubMed:19387438, ECO:0000269|PubMed:19620632}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225636_658410753IntramembraneHelical%3B Pore-forming
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225460_465410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225487_502410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225524_554410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225576_580410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225602_635410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225659_673410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225695_752410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225437_459410753TransmembraneHelical%3B Name%3DS1 of repeat II
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225466_486410753TransmembraneHelical%3B Name%3DS2 of repeat II
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225503_523410753TransmembraneHelical%3B Name%3DS3 of repeat II
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225555_575410753TransmembraneHelical%3B Name%3DS4 of repeat II
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225581_601410753TransmembraneHelical%3B Name%3DS5 of repeat II
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225674_694410753TransmembraneHelical%3B Name%3DS6 of repeat II

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARRB1chr11:74994331chr11:68845950ENST00000360025-515385_395118411MotifNote=[DE]-X(1%2C2)-F-X-X-[FL]-X-X-X-R motif
HgeneARRB1chr11:74994331chr11:68845950ENST00000420843-516385_395118419MotifNote=[DE]-X(1%2C2)-F-X-X-[FL]-X-X-X-R motif
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+122517_20410753Compositional biasNote=Poly-Gly
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225255_279410753IntramembraneHelical%3B Pore-forming
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225106_127410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225149_155410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225177_183410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+12251_84410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225205_218410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225240_254410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225280_289410753Topological domainExtracellular
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225311_436410753Topological domainCytoplasmic
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225128_148410753TransmembraneHelical%3B Name%3DS2 of repeat I
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225156_176410753TransmembraneHelical%3B Name%3DS3 of repeat I
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225184_204410753TransmembraneHelical%3B Name%3DS4 of repeat I
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225219_239410753TransmembraneHelical%3B Name%3DS5 of repeat I
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+1225290_310410753TransmembraneHelical%3B Name%3DS6 of repeat I
TgeneTPCN2chr11:74994331chr11:68845950ENST00000294309+122585_105410753TransmembraneHelical%3B Name%3DS1 of repeat I


Top

FusionGeneSequence for ARRB1_TPCN2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_461aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIPSM
KLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVV
NNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERL

>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_279aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLNFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQ

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_461aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIPSM
KLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVV
NNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERL

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_279aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLNFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQ

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_461aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSLWDMTRMLNMLIVFRFLRIIPSM
KLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINLFRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVV
NNWQVFLDAYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERL

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_279aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPA
PEDKKPLTRLQERLIKKLGEHAYPFTFEHPPRPEYQSPFLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGIL
NCVFIVYYLLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLNFLHKWDPRSHLQPLAGTPEATYQMTVELLFRDILEEPGEDELTERLSQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_1383nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTGGCTGTGTACCGATTGCCACACCCAGGCTGGAGGCCG
GAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCCCCAGCATG
AAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCTACTACGTA
TTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCTCGGCGCCC
TGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGATGGTGGTG
AACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGGTGTCGTCT
GTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGG
ACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTG

>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_837nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCA
GAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTGAGCCAG

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_1383nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTGGCTGTGTACCGATTGCCACACCCAGGCTGGAGGCCG
GAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCCCCAGCATG
AAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCTACTACGTA
TTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCTCGGCGCCC
TGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGATGGTGGTG
AACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGGTGTCGTCT
GTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGG
ACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTG

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_837nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCA
GAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTGAGCCAG

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_1383nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTGGCTGTGTACCGATTGCCACACCCAGGCTGGAGGCCG
GAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCCCCAGCATG
AAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCTACTACGTA
TTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCTCGGCGCCC
TGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGATGGTGGTG
AACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGGTGTCGTCT
GTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGG
ACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTG

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_837nt
ATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCAC
ATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCC
TTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCC
CCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCG
CCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCC
CTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTC
AACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAAC
GTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCA
GAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTGAGCCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_2052nt
GGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCCTGGGCGCTGACGCCGCGGACCTCCCTGCGACCGT
CGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTG
TGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGA
CCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCC
CACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTG
AGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACC
TCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGG
GGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACC
CCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTGGCTGTGTACCGATTGCCACACCCAGGCT
GGAGGCCGGAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCC
CCAGCATGAAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCT
ACTACGTATTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCT
CGGCGCCCTGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGA
TGGTGGTGAACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGG
TGTCGTCTGTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCC
TTGCTGGGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAG
AGAGGCTGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGTCCCAGCAGGGGCGGCAGGAGAGAGAGGCTGGCCT
ACACAGGTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGAGACCTTTCCTCTGACGGACCACTAAGCTGGGGAC
AGGAACCAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTGCTTCAGGGAGGCGCCGTGCCCTCCGCTTTCTTTT
ATAGCTGCTTCAGTGAGAATTCCCTCGTCGACTCCACAGGGACCTTTCAGACAAAAATGCAAGAAGCAGCGGCCTCCCCTGTCCCCTGCA
GCTTCCGTGGTGCCTTTGCTGCCGGCAGCCCTTGGGGACCACAGGCCTGACCAGGGCCTGCACAGGTTAACCGTCAGACTTCCGGGGCAT
TCAGGTGGGGATGCTGGTGGTTTGACATGGAGAGAACCTTGACTGTGTTTTATTATTTCATGGCTTGTATGAGTGTGACTGGGTGTGTTT

>In-frame_ARRB1_ENST00000420843_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_1185nt
GGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCCTGGGCGCTGACGCCGCGGACCTCCCTGCGACCGT
CGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTG
TGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGA
CCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCC
CACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTG
AGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACC
TCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGG
GGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACC
CCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTG
GGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGC
TGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGTCCCAGCAGGGGCGGCAGGAGAGAGAGGCTGGCCTACACAG
GTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGAGACCTTTCCTCTGACGGACCACTAAGCTGGGGACAGGAAC
CAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTGCTTCAGGGAGGCGCCGTGCCCTCCGCTTTCTTTTATAGCT

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_2176nt
ACCCCGCGCGGTTCCACGCCCCTGGCCGCGGCCCGGGCGCTGCGCTGCTCGACGCGGCGGGCGGCGGGCGGGGACCGGGGGCGGGGGCGG
CGGCGGCGGCCGGGAGAGCGGAGGAGGCGGAGCAGGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCC
TGGGCGCTGACGCCGCGGACCTCCCTGCGACCGTCGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGA
AAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAG
TATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGC
AAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAG
AAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTC
TTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGAT
GTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTC
TTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCA
ACTCTGGCTGTGTACCGATTGCCACACCCAGGCTGGAGGCCGGAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAAC
ATGCTCATCGTGTTCCGCTTCCTGCGTATCATCCCCAGCATGAAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAAC
ATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCTACTACGTATTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTT
CCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCTCGGCGCCCTGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGAC
TTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGATGGTGGTGAACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCG
TGGTCCAAGATCTATTTTGTATTGTGGTGGCTGGTGTCGTCTGTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTT
CACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGAT
ATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGT
CCCAGCAGGGGCGGCAGGAGAGAGAGGCTGGCCTACACAGGTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGA
GACCTTTCCTCTGACGGACCACTAAGCTGGGGACAGGAACCAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTG
CTTCAGGGAGGCGCCGTGCCCTCCGCTTTCTTTTATAGCTGCTTCAGTGAGAATTCCCTCGTCGACTCCACAGGGACCTTTCAGACAAAA
ATGCAAGAAGCAGCGGCCTCCCCTGTCCCCTGCAGCTTCCGTGGTGCCTTTGCTGCCGGCAGCCCTTGGGGACCACAGGCCTGACCAGGG
CCTGCACAGGTTAACCGTCAGACTTCCGGGGCATTCAGGTGGGGATGCTGGTGGTTTGACATGGAGAGAACCTTGACTGTGTTTTATTAT
TTCATGGCTTGTATGAGTGTGACTGGGTGTGTTTCTTTAGGGTTCTGATTGCCAGTTATTTTCATCAATAAGTCTTGCAAAGAATGGGAT

>In-frame_ARRB1_ENST00000393505_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_1309nt
ACCCCGCGCGGTTCCACGCCCCTGGCCGCGGCCCGGGCGCTGCGCTGCTCGACGCGGCGGGCGGCGGGCGGGGACCGGGGGCGGGGGCGG
CGGCGGCGGCCGGGAGAGCGGAGGAGGCGGAGCAGGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCC
TGGGCGCTGACGCCGCGGACCTCCCTGCGACCGTCGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGA
AAGCTCACCGTCTACCTGGGAAAGCGGGACTTTGTGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAG
TATCTCAAAGAGCGGAGAGTCTATGTGACGCTGACCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGC
AAGGACCTGTTTGTGGCCAACGTACAGTCGTTCCCACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAG
AAGCTGGGCGAGCACGCTTACCCTTTCACCTTTGAGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTC
TTCGGCCACTACTACTTTGACTACCTGGGGAACCTCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGAT
GTGCTGCCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTC
TTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAG
TGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTG
GAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGCTGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGTCCCAGC
AGGGGCGGCAGGAGAGAGAGGCTGGCCTACACAGGTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGAGACCTT
TCCTCTGACGGACCACTAAGCTGGGGACAGGAACCAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTGCTTCAG

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000294309_chr11_68845950_+_2052nt
GGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCCTGGGCGCTGACGCCGCGGACCTCCCTGCGACCGT
CGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTG
TGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGA
CCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCC
CACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTG
AGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACC
TCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGG
GGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACC
CCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTGGCTGTGTACCGATTGCCACACCCAGGCT
GGAGGCCGGAGATGGTGGGCCTGCTGTCGCTGTGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCC
CCAGCATGAAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGTGCGTTTGGCGGGATCCTGGTGGTGGTCT
ACTACGTATTTGCCATCATTGGGATCAACTTGTTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCT
CGGCGCCCTGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCGGCTGCCCTGGTCACTCTGTGGAACTTGA
TGGTGGTGAACAACTGGCAGGTGTTTCTGGATGCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGG
TGTCGTCTGTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCC
TTGCTGGGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAG
AGAGGCTGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGTCCCAGCAGGGGCGGCAGGAGAGAGAGGCTGGCCT
ACACAGGTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGAGACCTTTCCTCTGACGGACCACTAAGCTGGGGAC
AGGAACCAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTGCTTCAGGGAGGCGCCGTGCCCTCCGCTTTCTTTT
ATAGCTGCTTCAGTGAGAATTCCCTCGTCGACTCCACAGGGACCTTTCAGACAAAAATGCAAGAAGCAGCGGCCTCCCCTGTCCCCTGCA
GCTTCCGTGGTGCCTTTGCTGCCGGCAGCCCTTGGGGACCACAGGCCTGACCAGGGCCTGCACAGGTTAACCGTCAGACTTCCGGGGCAT
TCAGGTGGGGATGCTGGTGGTTTGACATGGAGAGAACCTTGACTGTGTTTTATTATTTCATGGCTTGTATGAGTGTGACTGGGTGTGTTT

>In-frame_ARRB1_ENST00000360025_chr11_74994331_-_TPCN2_ENST00000542467_chr11_68845950_+_1185nt
GGGAGCCGGGAGCGGGCTGGCCCGCGCTCCTCCTGCTGGCTGGGGATTTTCCAGCCTGGGCGCTGACGCCGCGGACCTCCCTGCGACCGT
CGCGGACCATGGGCGACAAAGGGACCCGAGTGTTCAAGAAGGCCAGTCCAAATGGAAAGCTCACCGTCTACCTGGGAAAGCGGGACTTTG
TGGACCACATCGACCTCGTGGACCCTGTGGATGGTGTGGTCCTGGTGGATCCTGAGTATCTCAAAGAGCGGAGAGTCTATGTGACGCTGA
CCTGCGCCTTCCGCTATGGCCGGGAGGACCTGGATGTCCTGGGCCTGACCTTTCGCAAGGACCTGTTTGTGGCCAACGTACAGTCGTTCC
CACCGGCCCCCGAGGACAAGAAGCCCCTGACGCGGCTGCAGGAACGCCTCATCAAGAAGCTGGGCGAGCACGCTTACCCTTTCACCTTTG
AGCACCCGCCGAGGCCCGAGTACCAGTCTCCGTTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACC
TCATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTGCCTGCTGAGCGTGATGACTTCATCCTGG
GGATTCTCAACTGCGTCTTCATTGTGTACTACCTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACC
CCAGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGAACTTCCTTCACAAGTGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTG
GGACCCCAGAGGCCACCTACCAGATGACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAGAGGC
TGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGACGTCCGGGCTGCCGTCCCAGCAGGGGCGGCAGGAGAGAGAGGCTGGCCTACACAG
GTGCCCGTCATGGAAGAGGCGGCCATGCTGTGGCCAGCCAGGCAGGAAGAGACCTTTCCTCTGACGGACCACTAAGCTGGGGACAGGAAC
CAAGTCCTTTGCGTGTGGCCCAACAACCATCTACAGAACAGCTGCTGGTGCTTCAGGGAGGCGCCGTGCCCTCCGCTTTCTTTTATAGCT


Top

FusionGenePPI for ARRB1_TPCN2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARRB1ZBTB43, GNMT, KHK, NOLC1, AP3B1, TCOF1, CHD1, BOP1, ARR3, ARRB2, PES1, DDX27, KPNA3, ZRANB2, RPL7L1, CCL14, JAK1, RTF1, HDGFRP2, CSNK2A1, CMBL, CCR5, MAPK10, DVL2, DVL1, RALGDS, ARF6, CYTH2, OPRD1, CXCR2, ADRB1, CSK, MDM2, NSF, PTHLH, NEDD4, ITCH, CDC42, JUN, SREBF2, USP33, PARK2, HGS, STAM, SLC9A1, MAP3K5, STUB1, PDE4D, MAPK3, MAPK1, GSK3B, IGF1R, SAG, YWHAB, YWHAG, YWHAQ, YWHAH, YWHAE, YWHAZ, RANBP9, STK38, SCYL2, DGKZ, DGKE, DGKG, ROCK1, YES1, ATR, PPM1A, PPM1B, CLTA, CLTC, AP3D1, RAB11FIP5, LRP4, LRP1B, DNM1, RGS3, RAB1A, ANXA2, PTCH2, SDC3, HIST1H1C, HIST1H2BO, HIST2H4A, HIST2H2AB, H3F3B, PRMT5, NPM1, POLR1A, POLR1C, POLR1E, CD3EAP, THRAP3, TMPO, YBX1, ALYREF, NOP10, RBM10, SF3B2, NCL, SNRPD1, SRRM2, HNRNPM, HNRNPK, DKC1, HNRNPA3, EIF4B, EEF1A2, RPL22, RPS3A, RPS17, IGF2BP2, ACTA1, TUBA4A, TUBA3C, TUBA1C, TUBB, VIM, TUBB2A, FLNA, GSN, LIMA1, MPRIP, CALD1, MAP1B, SPTAN1, TPM4, CKAP4, MYH9, MYL12B, KIF26A, MYH1, FASN, PKM, DHRS2, ATP5A1, ATP5B, PFKFB3, P4HB, HSPA8, HSP90AA1, CNGA3, HSPA5, APLP1, HSPA9, BCLAF1, RPS27A, UBB, UBC, UBA52, CPA1, CSN2, WDR77, DGKH, STK38L, MAP3K1, PIK3R2, PIK3C2A, STXBP5, CPNE8, ARHGAP32, G3BP1, S100A9, ZYX, HIST1H2AG, H2AFX, H1FX, XRCC5, POLR2E, BACH2, HNRNPU, HNRNPH1, HNRNPA1, RPL3, RPS2, RPS8, RPL6, RPL7A, EIF3I, TMOD3, CFL1, CTTN, ARPC5, KTN1, TTN, INA, DMD, MYO1C, MYL6, KIF2C, KIF3A, DNAH3, ACACA, HSPA1B, HSPA7, KCTD3, USP24, SPIN1, HDLBP, DPY30, CALM3, PRPF4, POT1, ADRBK1, TRAF6, HCRTR1, GNB1, GNG2, SNCA, SLC9A5, GPR50, C5AR1, ARRDC3, ARRDC4, NFKBIA, YY1, EDNRA, SRC, AXIN1, MAP2K4, AGTR1, AKT1, PDXP, LIMK1, PTAFR, AP2A1, MAP2K3, MAPK14, ARRDC1, NOTCH1, RPL15, BAG1, NEK6, BTK, ADH6, MAPK9, PTGER4, EGFR, CYTH1, DRD4, KLHL12, CUL3, KBTBD8, BRPF1, DOCK4, ALDH4A1, LYRM7, ACIN1, DCAF5, ELMO2TPCN2ANKRD27, AGBL5, USP32, DENND6A, TRAPPC8, WDR44, PTPRA, CLCN3, FBXO10, ARRB2, RRAGB, PI4K2A, RELT, AP3B1, WDR11, TSR3, PCDH9, DIP2A, RAB6B, ZRANB3, AP3D1, CD320, DDX11L8, VAMP3, CERK, OCRL, AP3S1, APPL1, HK3, MAP2K7, DAGLB, B4GALT5, TMEM56, RNF149, LRP10, VAMP2, ACP2, SNX17, PTPRD, BMPR1A, STX6, TRAPPC5, EHD4, CSNK1G3, NDFIP1, FGFR1, NOMO3, UXS1, EBP, ZDHHC18, NOMO1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneARRB1chr11:74994331chr11:68845950ENST00000360025-51545_86118411CHRM2
HgeneARRB1chr11:74994331chr11:68845950ENST00000420843-51645_86118419CHRM2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneARRB1chr11:74994331chr11:68845950ENST00000360025-5151_163118411SRC
HgeneARRB1chr11:74994331chr11:68845950ENST00000420843-5161_163118419SRC
HgeneARRB1chr11:74994331chr11:68845950ENST00000360025-515318_418118411TRAF6
HgeneARRB1chr11:74994331chr11:68845950ENST00000420843-516318_418118419TRAF6


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARRB1_TPCN2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARRB1_TPCN2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARRB1C0023890Liver Cirrhosis1CTD_human
HgeneARRB1C0041696Unipolar Depression1PSYGENET
HgeneARRB1C1269683Major Depressive Disorder1PSYGENET
HgeneARRB1C3178803Social Anhedonia1PSYGENET