FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28233

FusionGeneSummary for PPM1D_NUP85

check button Fusion gene summary
Fusion gene informationFusion gene name: PPM1D_NUP85
Fusion gene ID: 28233
HgeneTgene
Gene symbol

PPM1D

NUP85

Gene ID

8493

79902

Gene nameprotein phosphatase, Mg2+/Mn2+ dependent 1Dnucleoporin 85
SynonymsIDDGIP|PP2C-DELTA|WIP1FROUNT|Nup75
Cytomap

17q23.2

17q25.1

Type of geneprotein-codingprotein-coding
Descriptionprotein phosphatase 1Dprotein phosphatase 1D magnesium-dependent, delta isoformprotein phosphatase 2C delta isoformprotein phosphatase Wip1wild-type p53-induced phosphatase 1nuclear pore complex protein Nup85nucleoporin 85kDanucleoporin Nup75nucleoporin Nup85
Modification date2018051920180523
UniProtAcc

O15297

Q9BW27

Ensembl transtripts involved in fusion geneENST00000305921, ENST00000245544, 
ENST00000541827, ENST00000579324, 
ENST00000449421, ENST00000579298, 
ENST00000447371, ENST00000540768, 
Fusion gene scores* DoF score6 X 4 X 3=728 X 7 X 5=280
# samples 510
** MAII scorelog2(5/72*10)=-0.526068811667588
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/280*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPM1D [Title/Abstract] AND NUP85 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPM1D

GO:0035970

peptidyl-threonine dephosphorylation

20801214


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-HT-7479-01APPM1Dchr17

58725443

+NUP85chr17

73221198

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000305921ENST00000245544PPM1Dchr17

58725443

+NUP85chr17

73221198

+
In-frameENST00000305921ENST00000541827PPM1Dchr17

58725443

+NUP85chr17

73221198

+
In-frameENST00000305921ENST00000579324PPM1Dchr17

58725443

+NUP85chr17

73221198

+
5CDS-3UTRENST00000305921ENST00000449421PPM1Dchr17

58725443

+NUP85chr17

73221198

+
5CDS-intronENST00000305921ENST00000579298PPM1Dchr17

58725443

+NUP85chr17

73221198

+
5CDS-intronENST00000305921ENST00000447371PPM1Dchr17

58725443

+NUP85chr17

73221198

+
5CDS-intronENST00000305921ENST00000540768PPM1Dchr17

58725443

+NUP85chr17

73221198

+

Top

FusionProtFeatures for PPM1D_NUP85


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPM1D

O15297

NUP85

Q9BW27

Involved in the negative regulation of p53 expression(PubMed:23242139). Required for the relief of p53-dependentcheckpoint mediated cell cycle arrest. Binds to anddephosphorylates 'Ser-15' of TP53 and 'Ser-345' of CHEK1 whichcontributes to the functional inactivation of these proteins(PubMed:15870257, PubMed:16311512). Mediates MAPK14dephosphorylation and inactivation (PubMed:21283629). Is also animportant regulator of global heterochromatin silencing andcritical in maintaining genome integrity (By similarity).{ECO:0000250|UniProtKB:Q9QZ67, ECO:0000269|PubMed:15870257,ECO:0000269|PubMed:16311512, ECO:0000269|PubMed:21283629,ECO:0000269|PubMed:23242139}. Essential component of the nuclear pore complex (NPC)that seems to be required for NPC assembly and maintenance(PubMed:12718872). As part of the NPC Nup107-160 subcomplex playsa role in RNA export and in tethering NUP96/Nup98 and NUP153 tothe nucleus (PubMed:12718872). The Nup107-160 complex seems to berequired for spindle assembly during mitosis (PubMed:16807356).NUP85 is required for membrane clustering of CCL2-activated CCR2(PubMed:15995708). Seems to be involved in CCR2-mediatedchemotaxis of monocytes and may link activated CCR2 to thephosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusioncascade (PubMed:15995708). {ECO:0000269|PubMed:12718872,ECO:0000269|PubMed:15995708, ECO:0000269|PubMed:16807356}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPM1Dchr17:58725443chr17:73221198ENST00000305921+468_375339606DomainPPM-type phosphatase


Top

FusionGeneSequence for PPM1D_NUP85


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000245544_chr17_73221198_+_797aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSR
CCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMTVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLA
VARALGDLWSTDFFSGEFVVSPEPDTSVHTLDPQKHKTIILGSDGLWNMIPPQDAISMCQDQEEKKYLMVTILVLQGRLDEARQMLSKEA
DASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKELLSNWTHFLVT
RLLYSNPTVKPIDLHYTAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLTFGSNMRE
FLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWS
IRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKTREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTD

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000541827_chr17_73221198_+_797aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSR
CCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMTVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLA
VARALGDLWSTDFFSGEFVVSPEPDTSVHTLDPQKHKTIILGSDGLWNMIPPQDAISMCQDQEEKKYLMVTILVLQGRLDEARQMLSKEA
DASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKELLSNWTHFLVT
RLLYSNPTVKPIDLHYTAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLTFGSNMRE
FLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWS
IRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKTREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTD

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000579324_chr17_73221198_+_797aa
MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLPPRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSR
CCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVII
RGMKMTVAHVGDSGVVLGIQDDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLA
VARALGDLWSTDFFSGEFVVSPEPDTSVHTLDPQKHKTIILGSDGLWNMIPPQDAISMCQDQEEKKYLMVTILVLQGRLDEARQMLSKEA
DASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQHWHEECERYLQDSTFATSPHLESLLKIMLGDEAALLEQKELLSNWTHFLVT
RLLYSNPTVKPIDLHYTAQSSLDLFLGGESSPEPLDNILLAAFEFDIHQVIKECSIALSNWWFVAHLTDLLDHCKLLQSHNLTFGSNMRE
FLLLEYASGLFAHPSLWQLGVDYFDYCPELGRVSLELHIERIPLNTEQKALKVLRICEQRQMTEQVRSICKILAMKAVRNNRLGSALSWS
IRAKDAAFATLVSDRFLRDYCERGCFSDLDLIDNLGPAMMLSDRLTFLGKTREFHRMYGEKRFADAASLLLSLMTSRIAPRSFWMTLLTD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000245544_chr17_73221198_+_2391nt
ATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAG
CCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCGGTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGC
GGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGC
TGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGTGTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTG
TGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCAC
CTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGACTATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATT
CGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCT
GTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAAGGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGG
GTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCA
GTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTTCTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACT
CTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAGTGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAG
GACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTTGGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCC
GATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCATGGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACA
CTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGAGGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTG
GAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGCCTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACT
CGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGATCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGC
AGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTTTGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAAC
TGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCACTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAG
TTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCATCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTG
GGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACCTCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGG
CAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTTAGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGC
ATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTCAGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGAT
CTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGACCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAG
AAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTTGATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGAC
GCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTCAGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGA
AGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCAGGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCA

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000541827_chr17_73221198_+_2391nt
ATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAG
CCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCGGTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGC
GGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGC
TGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGTGTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTG
TGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCAC
CTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGACTATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATT
CGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCT
GTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAAGGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGG
GTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCA
GTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTTCTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACT
CTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAGTGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAG
GACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTTGGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCC
GATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCATGGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACA
CTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGAGGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTG
GAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGCCTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACT
CGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGATCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGC
AGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTTTGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAAC
TGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCACTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAG
TTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCATCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTG
GGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACCTCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGG
CAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTTAGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGC
ATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTCAGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGAT
CTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGACCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAG
AAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTTGATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGAC
GCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTCAGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGA
AGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCAGGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCA

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000579324_chr17_73221198_+_2391nt
ATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTCCGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAG
CCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCGGTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGC
GGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCGAGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGC
TGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGTGTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTG
TGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTCCGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCAC
CTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGACTATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATT
CGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTCAGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCT
GTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAAGGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGG
GTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCACAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCA
GTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTTCTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACT
CTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAGTGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAG
GACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTTGGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCC
GATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCATGGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACA
CTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGAGGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTG
GAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGCCTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACT
CGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGATCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGC
AGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTTTGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAAC
TGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCACTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAG
TTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCATCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTG
GGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACCTCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGG
CAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTTAGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGC
ATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTCAGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGAT
CTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGACCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAG
AAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTTGATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGAC
GCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTCAGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGA
AGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCAGGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000245544_chr17_73221198_+_2702nt
GGGGAAGCGCAGTGCGCAGGCGCAACTGCCTGGCTCTGCTCGCTCCGGCGCTCCGGCCCAGCTCTCGCGGACAAGTCCAGACATCGCGCG
CCCCCCCTTCTCCGGGTCCGCCCCCTCCCCCTTCTCGGCGTCGTCGAAGATAAACAATAGTTGGCCGGCGAGCGCCTAGTGTGTCTCCCG
CCGCCGGATTCGGCGGGCTGCGTGGGACCGGCGGGATCCCGGCCAGCCGGCCATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTC
CGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCG
GTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCG
AGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGCTGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGT
GTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTGTGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTC
CGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGAC
TATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTC
AGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCTGTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAA
GGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGGGTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCA
CAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTT
CTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACTCTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAG
TGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAGGACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTT
GGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCCGATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCAT
GGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACACTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGA
GGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTGGAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGC
CTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACTCGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGA
TCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGCAGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTT
TGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAACTGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCA
CTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAGTTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCA
TCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTGGGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACC
TCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGGCAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTT
AGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGCATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTC
AGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGATCTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGA
CCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAGAAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTT
GATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGACGCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTC
AGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGAAGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCA
GGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCACGAAATCTTGCTCGGGCAATTATAAGAGAAGGCTCACT
GGAAGGTTCCTGAGAACTGCTTCAATGTGGTATCTTTGTATGGCAATGTATATAGATTTTTTTAAAAGAATAAATGTTGTTTTGCAAATG

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000541827_chr17_73221198_+_2701nt
GGGGAAGCGCAGTGCGCAGGCGCAACTGCCTGGCTCTGCTCGCTCCGGCGCTCCGGCCCAGCTCTCGCGGACAAGTCCAGACATCGCGCG
CCCCCCCTTCTCCGGGTCCGCCCCCTCCCCCTTCTCGGCGTCGTCGAAGATAAACAATAGTTGGCCGGCGAGCGCCTAGTGTGTCTCCCG
CCGCCGGATTCGGCGGGCTGCGTGGGACCGGCGGGATCCCGGCCAGCCGGCCATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTC
CGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCG
GTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCG
AGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGCTGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGT
GTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTGTGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTC
CGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGAC
TATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTC
AGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCTGTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAA
GGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGGGTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCA
CAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTT
CTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACTCTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAG
TGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAGGACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTT
GGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCCGATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCAT
GGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACACTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGA
GGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTGGAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGC
CTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACTCGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGA
TCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGCAGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTT
TGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAACTGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCA
CTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAGTTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCA
TCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTGGGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACC
TCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGGCAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTT
AGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGCATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTC
AGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGATCTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGA
CCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAGAAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTT
GATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGACGCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTC
AGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGAAGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCA
GGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCACGAAATCTTGCTCGGGCAATTATAAGAGAAGGCTCACT
GGAAGGTTCCTGAGAACTGCTTCAATGTGGTATCTTTGTATGGCAATGTATATAGATTTTTTTAAAAGAATAAATGTTGTTTTGCAAATG

>In-frame_PPM1D_ENST00000305921_chr17_58725443_+_NUP85_ENST00000579324_chr17_73221198_+_2701nt
GGGGAAGCGCAGTGCGCAGGCGCAACTGCCTGGCTCTGCTCGCTCCGGCGCTCCGGCCCAGCTCTCGCGGACAAGTCCAGACATCGCGCG
CCCCCCCTTCTCCGGGTCCGCCCCCTCCCCCTTCTCGGCGTCGTCGAAGATAAACAATAGTTGGCCGGCGAGCGCCTAGTGTGTCTCCCG
CCGCCGGATTCGGCGGGCTGCGTGGGACCGGCGGGATCCCGGCCAGCCGGCCATGGCGGGGCTGTACTCGCTGGGAGTGAGCGTCTTCTC
CGACCAGGGCGGGAGGAAGTACATGGAGGACGTTACTCAAATCGTTGTGGAGCCCGAACCGACGGCTGAAGAAAAGCCCTCGCCGCGGCG
GTCGCTGTCTCAGCCGTTGCCTCCGCGGCCGTCGCCGGCCGCCCTTCCCGGCGGCGAAGTCTCGGGGAAAGGCCCAGCGGTGGCAGCCCG
AGAGGCTCGCGACCCTCTCCCGGACGCCGGGGCCTCGCCGGCACCTAGCCGCTGCTGCCGCCGCCGTTCCTCCGTGGCCTTTTTCGCCGT
GTGCGACGGGCACGGCGGGCGGGAGGCGGCACAGTTTGCCCGGGAGCACTTGTGGGGTTTCATCAAGAAGCAGAAGGGTTTCACCTCGTC
CGAGCCGGCTAAGGTTTGCGCTGCCATCCGCAAAGGCTTTCTCGCTTGTCACCTTGCCATGTGGAAGAAACTGGCGGAATGGCCAAAGAC
TATGACGGGTCTTCCTAGCACATCAGGGACAACTGCCAGTGTGGTCATCATTCGGGGCATGAAGATGTATGTAGCTCACGTAGGTGACTC
AGGGGTGGTTCTTGGAATTCAGGATGACCCGAAGGATGACTTTGTCAGAGCTGTGGAGGTGACACAGGACCATAAGCCAGAACTTCCCAA
GGAAAGAGAACGAATCGAAGGACTTGGTGGGAGTGTAATGAACAAGTCTGGGGTGAATCGTGTAGTTTGGAAACGACCTCGACTCACTCA
CAATGGACCTGTTAGAAGGAGCACAGTTATTGACCAGATTCCTTTTCTGGCAGTAGCAAGAGCACTTGGTGATTTGTGGAGCTATGATTT
CTTCAGTGGTGAATTTGTGGTGTCACCTGAACCAGACACAAGTGTCCACACTCTTGACCCTCAGAAGCACAAGTATATTATATTGGGGAG
TGATGGACTTTGGAATATGATTCCACCACAAGATGCCATCTCAATGTGCCAGGACCAAGAGGAGAAAAAATACCTGATGGTGACCATCTT
GGTGCTGCAGGGCCGGCTGGATGAGGCCCGACAGATGCTCTCCAAGGAAGCCGATGCCAGCCCCGCCTCTGCAGGCATATGCCGAATCAT
GGGGGACCTGATGAGGACAATGCCCATTCTTAGTCCCGGGAACACCCAGACACTGACAGAGCTGGAGCTGAAGTGGCAGCACTGGCACGA
GGAATGTGAGCGGTACCTCCAGGACAGCACATTCGCCACCAGCCCTCACCTGGAGTCTCTCTTGAAGATTATGCTGGGAGACGAAGCTGC
CTTGTTAGAGCAGAAGGAACTTCTGAGTAATTGGTATCATTTCCTAGTGACTCGGCTCTTGTACTCCAATCCCACAGTAAAACCCATTGA
TCTGCACTACTATGCCCAGTCCAGCCTGGACCTGTTTCTGGGAGGTGAGAGCAGCCCAGAACCCCTGGACAACATCTTGTTGGCAGCCTT
TGAGTTTGACATCCATCAAGTAATCAAAGAGTGCAGCATCGCCCTGAGCAACTGGTGGTTTGTGGCCCACCTGACAGACCTGCTGGACCA
CTGCAAGCTCCTCCAGTCACACAACCTCTATTTCGGTTCCAACATGAGAGAGTTCCTCCTGCTGGAGTACGCCTCGGGACTGTTTGCTCA
TCCCAGCCTGTGGCAGCTGGGGGTCGATTACTTTGATTACTGCCCCGAGCTGGGCCGAGTCTCCCTGGAGCTGCACATTGAGCGGATACC
TCTGAACACCGAGCAGAAAGCCCTGAAGGTGCTGCGGATCTGTGAGCAGCGGCAGATGACTGAACAAGTTCGCAGCATTTGTAAGATCTT
AGCCATGAAAGCCGTCCGCAACAATCGCCTGGGTTCTGCCCTCTCTTGGAGCATCCGTGCTAAGGATGCCGCCTTTGCCACGCTCGTGTC
AGACAGGTTCCTCAGGGATTACTGTGAGCGAGGCTGCTTTTCTGATTTGGATCTCATTGACAACCTGGGGCCAGCCATGATGCTCAGTGA
CCGACTGACATTCCTGGGAAAGTATCGCGAGTTCCACCGTATGTACGGGGAGAAGCGTTTTGCCGACGCAGCTTCTCTCCTTCTGTCCTT
GATGACGTCTCGGATTGCCCCTCGGTCTTTCTGGATGACTCTGCTGACAGACGCCTTGCCCCTTTTGGAACAGAAACAGGTGATTTTCTC
AGCAGAACAGACTTATGAGTTGATGCGGTGTCTGGAGGACTTGACGTCAAGAAGACCTGTGCATGGAGAATCTGATACCGAGCAGCTCCA
GGATGATGACATAGAGACCACCAAGGTGGAAATGCTGAGACTTTCTCTGGCACGAAATCTTGCTCGGGCAATTATAAGAGAAGGCTCACT
GGAAGGTTCCTGAGAACTGCTTCAATGTGGTATCTTTGTATGGCAATGTATATAGATTTTTTTAAAAGAATAAATGTTGTTTTGCAAATG


Top

FusionGenePPI for PPM1D_NUP85


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPM1DCDC5L, MDM2, H2AFX, RAD21, UBC, KDM1A, BEX2, CASZ1, DIRAS3, DKK3, EPSTI1, ERRFI1, GLCE, ITIH5, LYPD3, MRC2, NAT2, OSGIN1, RHOBTB2, WHSC1L1, KPNA2, KPNA3, KPNB1, NUP153, PSMD4, RANBP2, SPAG9, CHEK2NUP85SEH1L, NUP107, NUP43, NUP37, SEC13, EEF1G, USP36, USP49, HDAC11, EGFR, FBXO6, DCTN3, GBF1, RABL6, OBSL1, EED, CCDC183, CD274, TNFSF13B, CA14, PNKD, ENPP6, TGOLN2, NUP160, NUP98, NTRK1, IFI16, PRKDC, UNC45A, FMN1, KPNB1, ZNF740, POM121, HSP90AB1, NUDC, NUP88, RANGAP1, NUP62, NUP214, RANBP2, NUP50, NUP153, B9D2, UBE2I, FOXQ1, FAF2, UXS1, VASN, CD70, SPAST, ZNF785


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgenePPM1Dchr17:58725443chr17:73221198ENST00000305921+461_101339606CHEK1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPM1D_NUP85


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPM1D_NUP85


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePPM1DC0017638Glioma1CTD_human
HgenePPM1DC0677866Brain Stem Neoplasms1CTD_human