FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28078

FusionGeneSummary for PPARA_ATXN10

check button Fusion gene summary
Fusion gene informationFusion gene name: PPARA_ATXN10
Fusion gene ID: 28078
HgeneTgene
Gene symbol

PPARA

ATXN10

Gene ID

5465

25814

Gene nameperoxisome proliferator activated receptor alphaataxin 10
SynonymsNR1C1|PPAR|PPARalpha|hPPARE46L|HUMEEP|SCA10
Cytomap

22q13.31

22q13.31

Type of geneprotein-codingprotein-coding
Descriptionperoxisome proliferator-activated receptor alphaPPAR-alphanuclear receptor subfamily 1 group C member 1peroxisome proliferative activated receptor, alphaperoxisome proliferator-activated nuclear receptor alpha variant 3ataxin-10brain protein E46 homologspinocerebellar ataxia type 10 protein
Modification date2018052720180522
UniProtAcc

Q07869

Q9UBB4

Ensembl transtripts involved in fusion geneENST00000396000, ENST00000262735, 
ENST00000407236, ENST00000481567, 
ENST00000402126, ENST00000434345, 
ENST00000381061, ENST00000252934, 
ENST00000498009, ENST00000402380, 
Fusion gene scores* DoF score10 X 6 X 9=5407 X 5 X 7=245
# samples 118
** MAII scorelog2(11/540*10)=-2.29545588352617
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/245*10)=-1.61470984411521
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PPARA [Title/Abstract] AND ATXN10 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePPARA

GO:0000122

negative regulation of transcription by RNA polymerase II

9748239|12700342

HgenePPARA

GO:0010745

negative regulation of macrophage derived foam cell differentiation

19114110

HgenePPARA

GO:0010871

negative regulation of receptor biosynthetic process

12700342

HgenePPARA

GO:0010887

negative regulation of cholesterol storage

19114110

HgenePPARA

GO:0010891

negative regulation of sequestering of triglyceride

12700342

HgenePPARA

GO:0045893

positive regulation of transcription, DNA-templated

12955147

HgenePPARA

GO:0045944

positive regulation of transcription by RNA polymerase II

9748239|19955185|20837115

HgenePPARA

GO:0050728

negative regulation of inflammatory response

21636785

HgenePPARA

GO:0072363

regulation of glycolytic process by positive regulation of transcription from RNA polymerase II promoter

19955185

HgenePPARA

GO:0072366

regulation of cellular ketone metabolic process by positive regulation of transcription from RNA polymerase II promoter

19955185

HgenePPARA

GO:0072369

regulation of lipid transport by positive regulation of transcription from RNA polymerase II promoter

19955185

HgenePPARA

GO:1902894

negative regulation of pri-miRNA transcription by RNA polymerase II

21636785

HgenePPARA

GO:1903038

negative regulation of leukocyte cell-cell adhesion

21636785

TgeneATXN10

GO:0031175

neuron projection development

16498633


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-N7-A4Y8-01APPARAchr22

46594488

+ATXN10chr22

46238871

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000396000ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000396000ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000396000ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000396000ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000262735ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000262735ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000262735ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000262735ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000407236ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000407236ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000407236ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000407236ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+
intron-3CDSENST00000481567ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
intron-3CDSENST00000481567ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
intron-intronENST00000481567ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
intron-intronENST00000481567ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000402126ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000402126ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000402126ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000402126ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000434345ENST00000381061PPARAchr22

46594488

+ATXN10chr22

46238871

+
In-frameENST00000434345ENST00000252934PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000434345ENST00000498009PPARAchr22

46594488

+ATXN10chr22

46238871

+
5CDS-intronENST00000434345ENST00000402380PPARAchr22

46594488

+ATXN10chr22

46238871

+

Top

FusionProtFeatures for PPARA_ATXN10


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPARA

Q07869

ATXN10

Q9UBB4

Ligand-activated transcription factor. Key regulator oflipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activatedby oleylethanolamide, a naturally occurring lipid that regulatessatiety. Receptor for peroxisome proliferators such ashypolipidemic drugs and fatty acids. Regulates the peroxisomalbeta-oxidation pathway of fatty acids. Functions as transcriptionactivator for the ACOX1 and P450 genes. Transactivation activityrequires heterodimerization with RXRA and is antagonized by NR2C2.May be required for the propagation of clock information tometabolic pathways regulated by PER2.{ECO:0000269|PubMed:10195690, ECO:0000269|PubMed:24043310,ECO:0000269|PubMed:7629123, ECO:0000269|PubMed:7684926,ECO:0000269|PubMed:9556573}. Necessary for the survival of cerebellar neurons.Induces neuritogenesis by activating the Ras-MAP kinase pathway.May play a role in the maintenance of a critical intracellularglycosylation level and homeostasis. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePPARAchr22:46594488chr22:46238871ENST00000262735+3899_17369469DNA bindingNuclear receptor
HgenePPARAchr22:46594488chr22:46238871ENST00000396000+3899_17369469DNA bindingNuclear receptor
HgenePPARAchr22:46594488chr22:46238871ENST00000402126+2799_17369469DNA bindingNuclear receptor
HgenePPARAchr22:46594488chr22:46238871ENST00000407236+3899_17369469DNA bindingNuclear receptor
HgenePPARAchr22:46594488chr22:46238871ENST00000434345+1599_17369188DNA bindingNuclear receptor
HgenePPARAchr22:46594488chr22:46238871ENST00000262735+38239_46669469DomainNR LBD
HgenePPARAchr22:46594488chr22:46238871ENST00000396000+38239_46669469DomainNR LBD
HgenePPARAchr22:46594488chr22:46238871ENST00000402126+27239_46669469DomainNR LBD
HgenePPARAchr22:46594488chr22:46238871ENST00000407236+38239_46669469DomainNR LBD
HgenePPARAchr22:46594488chr22:46238871ENST00000434345+15239_46669188DomainNR LBD
HgenePPARAchr22:46594488chr22:46238871ENST00000262735+38304_43369469RegionNote=Required for heterodimerization with RXRA
HgenePPARAchr22:46594488chr22:46238871ENST00000396000+38304_43369469RegionNote=Required for heterodimerization with RXRA
HgenePPARAchr22:46594488chr22:46238871ENST00000402126+27304_43369469RegionNote=Required for heterodimerization with RXRA
HgenePPARAchr22:46594488chr22:46238871ENST00000407236+38304_43369469RegionNote=Required for heterodimerization with RXRA
HgenePPARAchr22:46594488chr22:46238871ENST00000434345+15304_43369188RegionNote=Required for heterodimerization with RXRA
HgenePPARAchr22:46594488chr22:46238871ENST00000262735+38102_12269469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000262735+38139_16169469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000396000+38102_12269469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000396000+38139_16169469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000402126+27102_12269469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000402126+27139_16169469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000407236+38102_12269469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000407236+38139_16169469Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000434345+15102_12269188Zinc fingerNR C4-type
HgenePPARAchr22:46594488chr22:46238871ENST00000434345+15139_16169188Zinc fingerNR C4-type


Top

FusionGeneSequence for PPARA_ATXN10


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_133aa
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITVLTQWVIYAIRNLTEDNSQNQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_399nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_2297nt
GCGCCGCCTCCTTCGGCGTTCGCCCCACGGACCGGCAGGCGGCGGACCGCGGCCCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGAC
TCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGGTAAATAGAAGGTTTAATTTACTGTTTCCAGATGGAAATA
TTTAAGTGTTTTCAGTGTTTACTTCTGTTGCACTACAGACCAGTAGCTTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGT
GGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGG
AAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGG
CTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTT
GATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGAT
CCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCT
TCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGT
ATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACG
TGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGAT
GTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGG
CGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGT
TAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAG
GTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGA
ATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTA
CATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACT
TTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATT
AAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATAT
TATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCT
GTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATA
GCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGAT
TGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAG
TCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCC
TTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGTATGAG

>In-frame_PPARA_ENST00000396000_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_2300nt
GCGCCGCCTCCTTCGGCGTTCGCCCCACGGACCGGCAGGCGGCGGACCGCGGCCCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGAC
TCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGGTAAATAGAAGGTTTAATTTACTGTTTCCAGATGGAAATA
TTTAAGTGTTTTCAGTGTTTACTTCTGTTGCACTACAGACCAGTAGCTTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGT
GGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGG
AAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGG
CTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTT
GATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGAT
CCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCT
TCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGT
ATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACG
TGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGAT
GTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGG
CGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGT
TAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAG
GTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGA
ATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTA
CATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACT
TTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATT
AAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATAT
TATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCT
GTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATA
GCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGAT
TGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAG
TCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCC
TTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGTATGAG

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_2214nt
GCGCCGCCTCCTTCGGCGTTCGCCCCACGGACCGGCAGGCGGCGGACCGCGGCCCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGAC
TCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGTAGCTTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCG
CGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAG
AAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCT
GTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACC
AAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAA
AGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTT
TTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTT
AACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGA
TAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAA
CTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTC
TGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCAT
TTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGG
GAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTC
AAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATT
AAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAA
AAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGA
CTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAA
AACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATA
AAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGT
AAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTT
CTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACAC
AAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCC
TTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCG

>In-frame_PPARA_ENST00000262735_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_2217nt
GCGCCGCCTCCTTCGGCGTTCGCCCCACGGACCGGCAGGCGGCGGACCGCGGCCCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGAC
TCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGTAGCTTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCG
CGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAG
AAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCT
GTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACC
AAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAA
AGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTT
TTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTT
AACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGA
TAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAA
CTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTC
TGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCAT
TTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGG
GAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTC
AAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATT
AAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAA
AAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGA
CTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAA
AACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATA
AAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGT
AAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTT
CTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACAC
AAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCC
TTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCG

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_2245nt
CCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGACTCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGTTC
TGGAGGCTGGGAAGTTCAAGATCAAAGTGCCAGCAGATTCAGTGTCATGTGAGGACGTGCTTCCTGCTTCATAGATAAGAGTAGCTTGGA
GCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTA
GAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTT
GGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATC
CGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAA
GTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATA
CCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGG
GAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATG
TAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTC
TCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTA
TATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCC
TCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTC
ACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCA
GAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCT
TATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTC
AGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATC
TATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGC
TCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCAC
AATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAA
GCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGT
ACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGT
AAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGC
CTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTG

>In-frame_PPARA_ENST00000407236_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_2248nt
CCAGGCTGAAGCTCAGGGCCCTGTCTGCTCTGTGGACTCAACAGTTTGTGGCAAGACAAGCTCAGAACTGAGAAGCTGTCACCACAGTTC
TGGAGGCTGGGAAGTTCAAGATCAAAGTGCCAGCAGATTCAGTGTCATGTGAGGACGTGCTTCCTGCTTCATAGATAAGAGTAGCTTGGA
GCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTA
GAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTT
GGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATC
CGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAA
GTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATA
CCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGG
GAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATG
TAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTC
TCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTA
TATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCC
TCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTC
ACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCA
GAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCT
TATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTC
AGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATC
TATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGC
TCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCAC
AATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAA
GCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGT
ACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGT
AAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGC
CTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTG

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_2160nt
CACAGTTCTGGAGGCTGGGAAGTTCAAGATCAAAGTGCCAGCAGATTCAGTGTCATGTGAGGACGTGCTTCCTGCTTCATAGATAAGAGC
TTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCG
ATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAA
GCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATG
CCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTA
AAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCC
AAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAA
TTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCAT
TAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAAC
CAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATT
CTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTC
ACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTC
TTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCA
TCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAA
TAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGC
CACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGT
TCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACA
AAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTT
TGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCT
TCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCT
AATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCA
TCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATA
GAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGG
ATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGTATGAGCTATATAATAACAAACACAAATAAATAAAAGGGAGCCTTGTGAGAAT

>In-frame_PPARA_ENST00000402126_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_2163nt
CACAGTTCTGGAGGCTGGGAAGTTCAAGATCAAAGTGCCAGCAGATTCAGTGTCATGTGAGGACGTGCTTCCTGCTTCATAGATAAGAGC
TTGGAGCTCGGCGGCACAACCAGCACCATCTGGTCGCGATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCG
ATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAAATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAA
GCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGTCCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATG
CCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAAGATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTA
AAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAGCTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCC
AAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTTCATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAA
TTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAACGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCAT
TAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATAGAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAAC
CAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACTTGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATT
CTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTGGCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTC
ACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTTCCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTC
TTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGAGTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCA
TCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAAGGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAA
TAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAAAGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGC
CACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAAGTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGT
TCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACTGGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACA
AAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAACATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTT
TGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAAGACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCT
TCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAAAAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCT
AATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCTAGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCA
TCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAAAGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATA
GAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTTTTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGG
ATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGTATGAGCTATATAATAACAAACACAAATAAATAAAAGGGAGCCTTGTGAGAAT

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000381061_chr22_46238871_+_2032nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG
CTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTT
CATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAA
CGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATA
GAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACT
TGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTG
GCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTT
CCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGA
GTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAA
GGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAA
AGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAA
GTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACT
GGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAA
CATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAA
GACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAA
AAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCT
AGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAA
AGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTT
TTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGT

>In-frame_PPARA_ENST00000434345_chr22_46594488_+_ATXN10_ENST00000252934_chr22_46238871_+_2035nt
ATGGTGGACACGGAAAGCCCACTCTGCCCCCTCTCCCCACTCGAGGCCGGCGATCTAGAGAGCCCGTTATCTGAAGAGTTCCTGCAAGAA
ATGGGAAACATCCAAGAGATTTCGCAATCCATCGGCGAGGATAGTTCTGGAAGCTTTGGCTTTACGGAATACCAGTATTTAGGAAGCTGT
CCTGGCTCAGATGGCTCGGTCATCACGGTTCTGACCCAGTGGGTGATATATGCCATCCGAAACCTTACCGAAGACAACAGCCAAAACCAA
GATTTGATTGCAAAGATGGAGGAACAGGGGCTGGCAGATGCATCCCTACTTAAAAAAGTGGGTTTTGAAGTTGAAAAGAAAGGCGAAAAG
CTGATCCTGAAATCTACTAGAGACACCCCTAAGCCATGAATGAACTACATCCAAATACCTGAATTTTTGGAATCTGTTTCATGGATTTTT
CATCTTCTACCGTATGTGAAATTGCAAGTGTTTGAAGATTTATAAGTACAAATTTGGGAACATACAAATCTTTTAGGTAGTAGAGTTTAA
CGTGTATAAGCTAAAAGTGAAAGTAACTGAGTGTTCTCTTGTTTCTTTGCATTAATGTAACTGTGTGGTTTGCCTTTGTCCCCCTGGATA
GAACGTGCATTTAAAGAATATATTGTACTTACTGTGACAGCAGATAATAAACCAGTCTCTTGGAGGGCACAACCCTTATTTGACAAAACT
TGGATGTTGGCTTGACTGTGTTTGTCCCTTCAGATGGCAAGTCAGCATCATTCTTTATATTCCTCTTCTCATTGGGTTTTCTGAACTCTG
GCAGGCGGTTGAAGTAGTTTCTCACTGTGATTAATTCTAGCAATCTCTTTTCACCCCTCTGCCTTTCCAAAACATTGACAAGACTCATTT
CCAGTTAATTAATTCGAGAACCCTCCCTCTTCATTTTGGGTACTGGGCTGTCTTGTCACTGAGCCCTATCCCTTTGGAATGTGGCAGGGA
GTGAGGTTGGTGAGAGAACATGTGGGCACTTAACTCTTCATGTTCCAGTTCATCCCAGAAGTAGACATCCCAGGACCCATTCTGTGTCAA
GGTGAATGCCTGTGTCCTCCCCAGCTTCATGCCTCTGTCATGGGGGAAGGAATAGCTTATGTTCTGCTCTGGTGCAGTGCCGTAGATTAA
AGGTACATTTCTATCTTCTTTGATTTAAAAAGCACCAGTCTCATAAAGGTGCCACTCAGTTTTAGCCATGTCTTCACTGAAATTGCAAAA
GTACTTTTAGGGAGCAGGAGTTTATTTGACATCTAGTTATCTGTCTGTCTGTTCATCTATCTATCTGTCTGCTGTATGAGAGGTAGGACT
GGATTAAATGACCACTGAACTCACTGAATCCAGATCATTCATATCATCAACAAAAGCTCTAGGGGGAGGTCACGTTGTGAATGCTTAAAA
CATATTATTTTCTTCAACAACCATATCGCTAAACTAATATATCCAGAGATTTTGCACAATTCGTGTTGAACCTTCCAAAACAAAAATAAA
GACCTGTCCAAAAGTTTTGACAAAAATACTGATTGCTCCCAAATAAAGTGCTTCTAAGCTTTGTGTAGACATAGTTTAACTGATTTGTAA
AAATAGCTTAAGCATGTTGAGAATGAAGTAAAAGTTTTCCCATGTGCTGTCTAATGTACTCTGTGTAACTCTGAAGACACATCAGCTTCT
AGGATTGCAGCAATCTATGAATAACATTTTTTCTCTCATTTATGACTTTCCATCAGTAAAGAAGCCATTGCAGAATTTAAAATTACACAA
AGGAGTCATTCTCTCCTGGGACATAAAGAGTTAAAGCTCTGTCCTCTAAATAGAAGCCTGGCCAAAGGGAGAAAACAGTGGGAGTCCCTT
TTCCCTTTTAACAAGTTTGCAATAGACACTTCTTTTTTTCCTGTCTCAATGGATGTGTGCACACCAGTGGAATCGCACAAACTTGTCGGT


Top

FusionGenePPI for PPARA_ATXN10


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPARANRBF2, STAC3, GADD45G, NCOA1, EP300, RXRG, DAP3, FABP1, MECR, RELA, NRIP1, NCOR1, PPARGC1B, AKAP13, POU1F1, HELZ2, RXRA, NCOR2, NR1H3, PPARGC1A, MED24, HSP90AA1, AIP, TRA, LPIN1, UBE2I, TNP1, CHD9, CDK3, FOXA3, PRMT1, PRMT8, SIRT1, RXRB, NCOA2, NCOA3, CEP350, GRB2, PIK3R3, BCL2, CDC34, STAT1ATXN10BSG, STYXL1, MAGED1, GSTK1, CUL3, PPP1R12A, GNB1, GNB2, FN1, MRPS16, GLS, GOLGA1, ABCA1, CA9, VCP, EGFR, SERPINH1, HSPA1A, HSPA8, CCDC8, ABCE1, HTR6, HSPB1, CEP162, CEP152, CEP128, SCLT1, CENPJ, LAMB3, MYC, UBE2A, TUBA1C, MTMR14, DUSP22, PTPRN, STOM, DLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPARA_ATXN10


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePPARAQ07869DB00573FenoprofenPeroxisome proliferator-activated receptor alphasmall moleculeapproved
HgenePPARAQ07869DB01039FenofibratePeroxisome proliferator-activated receptor alphasmall moleculeapproved
HgenePPARAQ07869DB01050IbuprofenPeroxisome proliferator-activated receptor alphasmall moleculeapproved
HgenePPARAQ07869DB01241GemfibrozilPeroxisome proliferator-activated receptor alphasmall moleculeapproved
HgenePPARAQ07869DB13873Fenofibric acidPeroxisome proliferator-activated receptor alphasmall moleculeapproved
HgenePPARAQ07869DB00313Valproic AcidPeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB00328IndomethacinPeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB00412RosiglitazonePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB00636ClofibratePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB01132PioglitazonePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB01393BezafibratePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB09064CiprofibratePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational
HgenePPARAQ07869DB01708PrasteronePeroxisome proliferator-activated receptor alphasmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for PPARA_ATXN10


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePPARAC0011853Diabetes Mellitus, Experimental3CTD_human
HgenePPARAC0036341Schizophrenia3PSYGENET
HgenePPARAC0020538Hypertensive disease2CTD_human
HgenePPARAC0021655Insulin Resistance2CTD_human
HgenePPARAC0010346Crohn Disease1CTD_human
HgenePPARAC0011615Dermatitis, Atopic1CTD_human
HgenePPARAC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
HgenePPARAC0014072Experimental Autoimmune Encephalomyelitis1CTD_human
HgenePPARAC0015695Fatty Liver1CTD_human
HgenePPARAC0015696Fatty Liver, Alcoholic1CTD_human
HgenePPARAC0018800Cardiomegaly1CTD_human
HgenePPARAC0019209Hepatomegaly1CTD_human
HgenePPARAC0020473Hyperlipidemia1CTD_human
HgenePPARAC0020476Hyperlipoproteinemias1CTD_human
HgenePPARAC0020557Hypertriglyceridemia1CTD_human
HgenePPARAC0020615Hypoglycemia1CTD_human
HgenePPARAC0021368Inflammation1CTD_human
HgenePPARAC0022658Kidney Diseases1CTD_human
HgenePPARAC0022661Kidney Failure, Chronic1CTD_human
HgenePPARAC0022672Acute Kidney Tubular Necrosis1CTD_human
HgenePPARAC0023903Liver neoplasms1CTD_human
HgenePPARAC0024667Animal Mammary Neoplasms1CTD_human
HgenePPARAC0024668Mammary Neoplasms, Experimental1CTD_human
HgenePPARAC0026848Myopathy1CTD_human
HgenePPARAC0027055Myocardial Reperfusion Injury1CTD_human
HgenePPARAC0028754Obesity1CTD_human
HgenePPARAC0033578Prostatic Neoplasms1CTD_human
HgenePPARAC0033687Proteinuria1CTD_human
HgenePPARAC0035126Reperfusion Injury1CTD_human
HgenePPARAC0041755Adverse reaction to drug1CTD_human
HgenePPARAC0242339Dyslipidemias1CTD_human
HgenePPARAC0400966Non-alcoholic Fatty Liver Disease1CTD_human
HgenePPARAC2930930Abdominal obesity metabolic syndrome1CTD_human
HgenePPARAC4277682Chemical and Drug Induced Liver Injury1CTD_human