FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 28071

FusionGeneSummary for PPA2_SORCS2

check button Fusion gene summary
Fusion gene informationFusion gene name: PPA2_SORCS2
Fusion gene ID: 28071
HgeneTgene
Gene symbol

PPA2

SORCS2

Gene ID

27068

57537

Gene namepyrophosphatase (inorganic) 2sortilin related VPS10 domain containing receptor 2
SynonymsHSPC124|SCFAI|SCFI|SID6-306-
Cytomap

4q24

4p16.1

Type of geneprotein-codingprotein-coding
Descriptioninorganic pyrophosphatase 2, mitochondrialPPase 2pyrophosphatase SID6-306pyrophosphate phospho-hydrolase 2VPS10 domain-containing receptor SorCS2VPS10 domain receptor protein
Modification date2018052320180519
UniProtAcc

Q9H2U2

Q96PQ0

Ensembl transtripts involved in fusion geneENST00000341695, ENST00000348706, 
ENST00000432483, ENST00000354147, 
ENST00000380004, ENST00000357415, 
ENST00000509426, ENST00000310267, 
ENST00000507866, ENST00000511199, 
ENST00000329016, 
Fusion gene scores* DoF score3 X 3 X 3=273 X 2 X 3=18
# samples 33
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PPA2 [Title/Abstract] AND SORCS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-ZG-A9LZ-01APPA2chr4

106377838

-SORCS2chr4

7398015

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341695ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-3UTRENST00000341695ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-5UTRENST00000341695ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
In-frameENST00000348706ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-3UTRENST00000348706ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-5UTRENST00000348706ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
In-frameENST00000432483ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-3UTRENST00000432483ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-5UTRENST00000432483ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-3CDSENST00000354147ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-3UTRENST00000354147ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-5UTRENST00000354147ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
In-frameENST00000380004ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-3UTRENST00000380004ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-5UTRENST00000380004ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
In-frameENST00000357415ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-3UTRENST00000357415ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5CDS-5UTRENST00000357415ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
5UTR-3CDSENST00000509426ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
5UTR-3UTRENST00000509426ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
5UTR-5UTRENST00000509426ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-3CDSENST00000310267ENST00000507866PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-3UTRENST00000310267ENST00000511199PPA2chr4

106377838

-SORCS2chr4

7398015

+
intron-5UTRENST00000310267ENST00000329016PPA2chr4

106377838

-SORCS2chr4

7398015

+

Top

FusionProtFeatures for PPA2_SORCS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PPA2

Q9H2U2

SORCS2

Q96PQ0


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027786_8761601160DomainPKD
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027182_1931601160RepeatNote=BNR 1
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027232_2431601160RepeatNote=BNR 2
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027273_2841601160RepeatNote=BNR 3
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027468_4791601160RepeatNote=BNR 4
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027545_5561601160RepeatNote=BNR 5
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+027587_5981601160RepeatNote=BNR 6
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+0271100_11591601160Topological domainCytoplasmic
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+0271079_10991601160TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+02713_1041601160Compositional biasNote=Pro-rich
TgeneSORCS2chr4:106377838chr4:7398015ENST00000507866+02751_10781601160Topological domainLumenal


Top

FusionGeneSequence for PPA2_SORCS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PPA2_ENST00000341695_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_1074aa
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEVILILTKYYHADMGKV
LESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAY
TKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF
KATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDIL
EVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQ
LVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFG
HISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSS
SSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQ
EQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVL
LPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGL
VVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGG

>In-frame_PPA2_ENST00000348706_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_1074aa
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEVILILTKYYHADMGKV
LESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAY
TKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF
KATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDIL
EVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQ
LVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFG
HISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSS
SSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQ
EQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVL
LPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGL
VVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGG

>In-frame_PPA2_ENST00000432483_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_1074aa
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEVILILTKYYHADMGKV
LESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAY
TKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF
KATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDIL
EVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQ
LVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFG
HISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSS
SSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQ
EQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVL
LPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGL
VVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGG

>In-frame_PPA2_ENST00000380004_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_1074aa
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEVILILTKYYHADMGKV
LESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAY
TKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF
KATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDIL
EVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQ
LVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFG
HISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSS
SSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQ
EQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVL
LPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGL
VVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGG

>In-frame_PPA2_ENST00000357415_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_1074aa
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEVILILTKYYHADMGKV
LESSLWRSSDFGTSYTKLTLQPGVTTVIDNFYICPTNKRKVILVSSSLSDRDQSLFLSADEGATFQKQPIPFFVETLIFHPKEEDKVLAY
TKESKLYVSSDLGKKWTLLQERVTKDHVFWSVSGVDADPDLVHVEAQDLGGDFRYVTCAIHNCSEKMLTAPFAGPIDHGSLTVQDDYIFF
KATSANQTKYYVSYRRNEFVLMKLPKYALPKDLQIISTDESQVFVAVQEWYQMDTYNLYQSDPRGVRYALVLQDVRSSRQAEESVLIDIL
EVRGVKGVFLANQKIDGKVMTLITYNKGRDWDYLRPPSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQ
LVEYKEEMYITSDCGHTWRQVFEEEHHILYLDHGGVIVAIKDTSIPLKILKFSVDEGLTWSTHNFTSTSVFVDGLLSEPGDETLVMTVFG
HISFRSDWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYGFERSS
SSESSTNKCSANFWFNPLSPPDDCALGQTYTSSLGYRKVVSNVCEGGVDMQQSQVQLQCPLTPPRGLQVSIQGEAVAVRPGEDVLFVVRQ
EQGDVLTTKYQVDLGDGFKAMYVNLTLTGEPIRHRYESPGIYRVSVRAENTAGHDEAVLFVQVNSPLQALYLEVVPVIGLNQEVNLTAVL
LPLNPNLTVFYWWIGHSLQPLLSLDNSVTTRFSDTGDVRVTVQAACGNSVLQDSRVLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGL
VVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKISFLLRGGVRVLVALRDTGTGAEQLGG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PPA2_ENST00000341695_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_3222nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT

>In-frame_PPA2_ENST00000348706_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_3222nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT

>In-frame_PPA2_ENST00000432483_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_3222nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT

>In-frame_PPA2_ENST00000380004_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_3222nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT

>In-frame_PPA2_ENST00000357415_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_3222nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PPA2_ENST00000341695_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_5816nt
CCGCGCGCACAGCAGGACCGTCATTGACGCCATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTT
GGGGACCAGTGCAGGGACCGGGTCGCGCCGTGCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCT
CTTCTTTAAGAATGTAACTGGTCACTACATTTCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGAC
GAAGTACTACCACGCAGACATGGGGAAGGTTCTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCT
CCAGCCTGGTGTCACCACCGTCATCGACAATTTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGA
CCGGGACCAGAGCCTATTCCTCAGCGCAGACGAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCA
CCCTAAGGAGGAGGACAAGGTCCTCGCCTACACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCA
AGAGCGAGTGACCAAAGACCACGTGTTCTGGTCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGG
TGGAGATTTTCGGTACGTCACCTGCGCAATCCACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTC
TCTGACCGTGCAGGACGATTACATCTTCTTTAAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGT
CCTGATGAAGCTGCCGAAGTATGCATTGCCAAAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTG
GTACCAGATGGACACCTACAACCTGTACCAGTCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCA
GGCGGAGGAGAGCGTGCTCATCGACATCCTGGAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGAT
GACGCTTATAACCTACAACAAGGGCCGCGACTGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCC
TCCAGACTGCCACCTGCACCTGCACCTGCGCTGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCT
CATCATGGGTGCAGGTAACCTGGGCTCACAGCTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCA
GGTGTTTGAGGAAGAGCATCACATCCTGTACCTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCT
CAAGTTCAGTGTGGACGAGGGCCTCACCTGGAGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGG
GGACGAGACGCTGGTCATGACGGTCTTTGGCCACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTC
CAGGCAGTGCGGCGAGGAGGACTACAGCTCCTGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCG
GAAAAGAAAGTCCACGTCCTGGTGCATCAAGGGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTT
CCTGTGCGACTACGGATTTGAGCGCTCCTCCTCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCC
GCCTGACGACTGTGCCCTGGGCCAGACCTACACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACAT
GCAGCAGAGTCAGGTGCAGCTGCAGTGCCCCCTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCC
TGGAGAGGACGTCCTGTTTGTGGTGCGGCAGGAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGC
CATGTACGTGAACCTTACACTGACCGGGGAGCCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAA
CACGGCAGGCCACGATGAGGCGGTGCTCTTTGTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCT
CAACCAGGAGGTGAACCTCACAGCTGTGCTGCTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCC
CCTCCTTTCCCTGGATAATTCTGTGACAACGCGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGT
GCTGCAGGACTCCAGGGTCCTCCGTGTGCTGGATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAA
CACCCCTGAGTGGAGGGAAGACGTGGGCCTGGTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGT
GGTGAAGCCGGGGCTGCCCACTTTGGCCGATCTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAA
GAGGCTCGCCGCCATCCAGCAGGTGCTGAACGCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGA
CACAGGCACAGGTGCTGAGCAGCTGGGCGGCGGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGC
CTTCATCCTCTACAAGTTCAAAAGGAAACGGCCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCC
TGTGAGTCACAGTGAGGACGTCCAGGGCGCTGTCCAGGGCAACCACTCAGGCGTGGTCCTGAGCATCAACTCCCGAGAGATGCACAGCTA
CCTGGTGAGCTGATGCCACCCCAGCATCTGTCTTTTCACCCACGGAGGGCACAGAACCACCAGCAAAGCCGGCGGCTGGACTGGCGCCCC
TCAGAGACCTGCGGAAAGCCCCCTCCCTGAGTCGTCGCCACACCAGGCGACAGGCACCACCCCCTCTGATAAATCCAAGCCCGCCCAGGC
CCACGGGGGGCCCACGGGACCCCCCGGGACTCCCCGGACATGGCCCTGCCCCTATGGGACACCAGGCCTGACTCAGGCAGGTTCTGCCCC
CCAGACCCCACACACGGCCGCCCCACGTGCTGTCGCTCAGCCCGAGGCCTGACTTCTCTGGGCTGAGGCTGGTCGTCCTGGAGCCCTCCC
AGTACCTCGGGCTGCAAGAGCTGCAGACCCGTTCAGACACTGCGTTGCGGGCTCCTTCCCCGCAGAGGCCGGGGCCTCCCTGACTTTGCT
TCTTCACTCCCACCTGTGCGGCCACCCAGTCCCTCTGTGGGAGCCCGGGTGCCAGGCCCTCCCAACACCACACCACCCTCCAGGCCCCCC
TGCCCTCCGGCTGGAAACTGCAGCTCTGTAAATGCCTCTCTAGGTAGCTGCTGGCGGTGGTGGGGGTGTCTCACTCTCTGTCTTTATAGC
CGGCGGTAGCCACCGGGGTGGCTCTGTCAGAGTTCCGTACTCGGGAGCCCCTTTCCCTGAGTGCCCAGGGTGTCTCCTCTGCCCAGAGGG
GCAGCAGCTCTCCCTGGTTCTCCCCAGGGCAGACGGGGTAGGGCGGGCTCAGGACCCAGTGCCCATGGTTCCTCACTCCTACCAGCAAGC
AGCACCATCCCGCAGGCTTCTCCCACCTGATGGCTGTTCTCCCACCGGGTCTGGGCTCTGGAAGGAGCCAGATGCCCCCAGAAAGGTGGG
TGGTGGAGACGGCACCAGATGTACCAGTTTTCTGCAGTTCCTTATAGGCGAAGGGAACCGGGTGGAAACCAAGCTGGGAGAGGCTGAGGA
TGGCAGGGCTGGAAGGGCCATCAGCGTGACCCTCATTTTCAAGAAGGGGAAACTGAGGCCCAGGGAGGAGAGTAACTGAAGGTCACAGCA
CGGTCACAGCAGAGGTGGCCGAACCCAGCCCTCTGCGCGCCAGTGCTGTGCGGTCTCCACACCCTTACGGTTTCCTAGAATCAGGGATGT
TAGTGTAAGTCTATAGGAATATAGGGGGGTGGGGGGGTCACCTTTTGCCTTGAAATGGGAAGTCAGTAGCCCCTTCCTCCTCCTCCCTCC
TCCCCCTCCTCTCTGGCAGGGATCTCAGATGACCGTGGCCTCCCTCTCAGAGGGGGAGAACGCCAGAGCCCTGGCTGGTGATGTGCTGGC
TGGGGGTGAATCCCAATGAGGGTCCCTCTCAGAGCGGGAGAACGCCAGAGCCCTGGATGGTGATGCGCTGGCTGGGGGTGAATCCCAATG
AGGGTCCCTCTCAGAAAGGGAGAACGCCAGAGCCCTGGCTGGTGACATGCTGGCTGGGGGTGAATCCGAATGACAGTGCAGACGTTCTCC
CATCCACCATGTCTGAGCTTGGGGGAATTGCCTCATTTCCCCTGGAAAAGAAACATGGTCCATTAGAGGGGAAAGCCCAGGGGTGAATCT
TCACGCCCCAAACAGTGCCCGGTGGGGAGGAGGCACCCGCTCCTTGTTGAGTAAAACCACCCATGGAGACTGGAACCTCATCTCCCTGGG
TCGGGGGGTGTTCAAGGCCACAGGACAAGGGGAGCACCCTGGGCCACACAGGCGTGGAGGTGTCCCCACCCCTTCCACCTGTCCCCCAGA
CCCAAAGCTCTCTCCCCACCCTACCTGCCCACCTGGGGCTCCTGTGCCCCCTCCCCACTCCAGAGGCCACCCTACAAGTTGTCCTCAAGG
TCATCCTGGAGATGGGATCCAGGACGTGGGGCCATGACTCTCTGGGACCTTGCCACAGCCCCCATTCCCCTGCTTGCAGTCTGCAAGGAC
ACCTTTGCAGGGATTCTTGTCCTGCTGGCCACCCCACCCACACCTGTCCCTGGCCAGCAGGCCGCCTGCAAGCGTCAGGCACACAGGGAC
AGACATGGCGAGCACAGTGCAGGCCCGGGGCCCACGGGCAACATGGAACCCTGGGAACTGCCCTCCCCCTTAGCTCACAGTGCCTGCGGT
AGCCACTCTAGGTCGTTGGCCTTCCTTGACCACTCCATTTAATTCTCTCTGCTGTTTGGGTTGGGTTTTTCCCCTTAGTTATCTGTGGGT
TTCCTGTATTTTATGTTAATATTTCTATTAAGAACATGTTGGGCATGTGGACCCAAGCACCTGGGAAGGAGGTGGCATCTGAGACAGCCT
GATACGTTCCCGTCTGTGCACCCATGGAGATCCAGGCGTGGGCCCGTGTCTGTCCCTGGTTGTAAATTCGAGGGTCTGCATATCTGATGT
TCAGGTAGACCTGGGCGCCTGGGAACGAGGCCATCAGCTGCCATGCACATAACAAAGAGACAATGCATTCCTTCTTATTTTTCCTTTTTA

>In-frame_PPA2_ENST00000348706_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_5799nt
CCGTCATTGACGCCATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGA
CCGGGTCGCGCCGTGCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAA
CTGGTCACTACATTTCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAG
ACATGGGGAAGGTTCTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCA
CCGTCATCGACAATTTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTAT
TCCTCAGCGCAGACGAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACA
AGGTCCTCGCCTACACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAG
ACCACGTGTTCTGGTCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACG
TCACCTGCGCAATCCACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACG
ATTACATCTTCTTTAAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGA
AGTATGCATTGCCAAAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCT
ACAACCTGTACCAGTCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGC
TCATCGACATCCTGGAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACA
ACAAGGGCCGCGACTGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGC
ACCTGCACCTGCGCTGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTA
ACCTGGGCTCACAGCTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGC
ATCACATCCTGTACCTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACG
AGGGCCTCACCTGGAGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCA
TGACGGTCTTTGGCCACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGG
AGGACTACAGCTCCTGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGT
CCTGGTGCATCAAGGGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGAT
TTGAGCGCTCCTCCTCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCC
TGGGCCAGACCTACACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGC
AGCTGCAGTGCCCCCTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGT
TTGTGGTGCGGCAGGAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTA
CACTGACCGGGGAGCCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATG
AGGCGGTGCTCTTTGTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACC
TCACAGCTGTGCTGCTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATA
ATTCTGTGACAACGCGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGG
TCCTCCGTGTGCTGGATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGG
AAGACGTGGGCCTGGTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGC
CCACTTTGGCCGATCTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCC
AGCAGGTGCTGAACGCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTG
AGCAGCTGGGCGGCGGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGT
TCAAAAGGAAACGGCCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGG
ACGTCCAGGGCGCTGTCCAGGGCAACCACTCAGGCGTGGTCCTGAGCATCAACTCCCGAGAGATGCACAGCTACCTGGTGAGCTGATGCC
ACCCCAGCATCTGTCTTTTCACCCACGGAGGGCACAGAACCACCAGCAAAGCCGGCGGCTGGACTGGCGCCCCTCAGAGACCTGCGGAAA
GCCCCCTCCCTGAGTCGTCGCCACACCAGGCGACAGGCACCACCCCCTCTGATAAATCCAAGCCCGCCCAGGCCCACGGGGGGCCCACGG
GACCCCCCGGGACTCCCCGGACATGGCCCTGCCCCTATGGGACACCAGGCCTGACTCAGGCAGGTTCTGCCCCCCAGACCCCACACACGG
CCGCCCCACGTGCTGTCGCTCAGCCCGAGGCCTGACTTCTCTGGGCTGAGGCTGGTCGTCCTGGAGCCCTCCCAGTACCTCGGGCTGCAA
GAGCTGCAGACCCGTTCAGACACTGCGTTGCGGGCTCCTTCCCCGCAGAGGCCGGGGCCTCCCTGACTTTGCTTCTTCACTCCCACCTGT
GCGGCCACCCAGTCCCTCTGTGGGAGCCCGGGTGCCAGGCCCTCCCAACACCACACCACCCTCCAGGCCCCCCTGCCCTCCGGCTGGAAA
CTGCAGCTCTGTAAATGCCTCTCTAGGTAGCTGCTGGCGGTGGTGGGGGTGTCTCACTCTCTGTCTTTATAGCCGGCGGTAGCCACCGGG
GTGGCTCTGTCAGAGTTCCGTACTCGGGAGCCCCTTTCCCTGAGTGCCCAGGGTGTCTCCTCTGCCCAGAGGGGCAGCAGCTCTCCCTGG
TTCTCCCCAGGGCAGACGGGGTAGGGCGGGCTCAGGACCCAGTGCCCATGGTTCCTCACTCCTACCAGCAAGCAGCACCATCCCGCAGGC
TTCTCCCACCTGATGGCTGTTCTCCCACCGGGTCTGGGCTCTGGAAGGAGCCAGATGCCCCCAGAAAGGTGGGTGGTGGAGACGGCACCA
GATGTACCAGTTTTCTGCAGTTCCTTATAGGCGAAGGGAACCGGGTGGAAACCAAGCTGGGAGAGGCTGAGGATGGCAGGGCTGGAAGGG
CCATCAGCGTGACCCTCATTTTCAAGAAGGGGAAACTGAGGCCCAGGGAGGAGAGTAACTGAAGGTCACAGCACGGTCACAGCAGAGGTG
GCCGAACCCAGCCCTCTGCGCGCCAGTGCTGTGCGGTCTCCACACCCTTACGGTTTCCTAGAATCAGGGATGTTAGTGTAAGTCTATAGG
AATATAGGGGGGTGGGGGGGTCACCTTTTGCCTTGAAATGGGAAGTCAGTAGCCCCTTCCTCCTCCTCCCTCCTCCCCCTCCTCTCTGGC
AGGGATCTCAGATGACCGTGGCCTCCCTCTCAGAGGGGGAGAACGCCAGAGCCCTGGCTGGTGATGTGCTGGCTGGGGGTGAATCCCAAT
GAGGGTCCCTCTCAGAGCGGGAGAACGCCAGAGCCCTGGATGGTGATGCGCTGGCTGGGGGTGAATCCCAATGAGGGTCCCTCTCAGAAA
GGGAGAACGCCAGAGCCCTGGCTGGTGACATGCTGGCTGGGGGTGAATCCGAATGACAGTGCAGACGTTCTCCCATCCACCATGTCTGAG
CTTGGGGGAATTGCCTCATTTCCCCTGGAAAAGAAACATGGTCCATTAGAGGGGAAAGCCCAGGGGTGAATCTTCACGCCCCAAACAGTG
CCCGGTGGGGAGGAGGCACCCGCTCCTTGTTGAGTAAAACCACCCATGGAGACTGGAACCTCATCTCCCTGGGTCGGGGGGTGTTCAAGG
CCACAGGACAAGGGGAGCACCCTGGGCCACACAGGCGTGGAGGTGTCCCCACCCCTTCCACCTGTCCCCCAGACCCAAAGCTCTCTCCCC
ACCCTACCTGCCCACCTGGGGCTCCTGTGCCCCCTCCCCACTCCAGAGGCCACCCTACAAGTTGTCCTCAAGGTCATCCTGGAGATGGGA
TCCAGGACGTGGGGCCATGACTCTCTGGGACCTTGCCACAGCCCCCATTCCCCTGCTTGCAGTCTGCAAGGACACCTTTGCAGGGATTCT
TGTCCTGCTGGCCACCCCACCCACACCTGTCCCTGGCCAGCAGGCCGCCTGCAAGCGTCAGGCACACAGGGACAGACATGGCGAGCACAG
TGCAGGCCCGGGGCCCACGGGCAACATGGAACCCTGGGAACTGCCCTCCCCCTTAGCTCACAGTGCCTGCGGTAGCCACTCTAGGTCGTT
GGCCTTCCTTGACCACTCCATTTAATTCTCTCTGCTGTTTGGGTTGGGTTTTTCCCCTTAGTTATCTGTGGGTTTCCTGTATTTTATGTT
AATATTTCTATTAAGAACATGTTGGGCATGTGGACCCAAGCACCTGGGAAGGAGGTGGCATCTGAGACAGCCTGATACGTTCCCGTCTGT
GCACCCATGGAGATCCAGGCGTGGGCCCGTGTCTGTCCCTGGTTGTAAATTCGAGGGTCTGCATATCTGATGTTCAGGTAGACCTGGGCG
CCTGGGAACGAGGCCATCAGCTGCCATGCACATAACAAAGAGACAATGCATTCCTTCTTATTTTTCCTTTTTAAAAATCGATGAATCATT

>In-frame_PPA2_ENST00000432483_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_5785nt
ATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGACCGGGTCGCGCCGT
GCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAACTGGTCACTACATT
TCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAGACATGGGGAAGGTT
CTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCACCGTCATCGACAAT
TTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTATTCCTCAGCGCAGAC
GAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACAAGGTCCTCGCCTAC
ACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAGACCACGTGTTCTGG
TCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACGTCACCTGCGCAATC
CACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACGATTACATCTTCTTT
AAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGAAGTATGCATTGCCA
AAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCTACAACCTGTACCAG
TCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGCTCATCGACATCCTG
GAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACAACAAGGGCCGCGAC
TGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGCACCTGCACCTGCGC
TGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTAACCTGGGCTCACAG
CTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGCATCACATCCTGTAC
CTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACGAGGGCCTCACCTGG
AGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCATGACGGTCTTTGGC
CACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGGAGGACTACAGCTCC
TGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGTCCTGGTGCATCAAG
GGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGATTTGAGCGCTCCTCC
TCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCCTGGGCCAGACCTAC
ACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGCAGCTGCAGTGCCCC
CTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGTTTGTGGTGCGGCAG
GAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTACACTGACCGGGGAG
CCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATGAGGCGGTGCTCTTT
GTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACCTCACAGCTGTGCTG
CTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATAATTCTGTGACAACG
CGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGGTCCTCCGTGTGCTG
GATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGGAAGACGTGGGCCTG
GTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGCCCACTTTGGCCGAT
CTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCCAGCAGGTGCTGAAC
GCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTGAGCAGCTGGGCGGC
GGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGTTCAAAAGGAAACGG
CCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGGACGTCCAGGGCGCT
GTCCAGGGCAACCACTCAGGCGTGGTCCTGAGCATCAACTCCCGAGAGATGCACAGCTACCTGGTGAGCTGATGCCACCCCAGCATCTGT
CTTTTCACCCACGGAGGGCACAGAACCACCAGCAAAGCCGGCGGCTGGACTGGCGCCCCTCAGAGACCTGCGGAAAGCCCCCTCCCTGAG
TCGTCGCCACACCAGGCGACAGGCACCACCCCCTCTGATAAATCCAAGCCCGCCCAGGCCCACGGGGGGCCCACGGGACCCCCCGGGACT
CCCCGGACATGGCCCTGCCCCTATGGGACACCAGGCCTGACTCAGGCAGGTTCTGCCCCCCAGACCCCACACACGGCCGCCCCACGTGCT
GTCGCTCAGCCCGAGGCCTGACTTCTCTGGGCTGAGGCTGGTCGTCCTGGAGCCCTCCCAGTACCTCGGGCTGCAAGAGCTGCAGACCCG
TTCAGACACTGCGTTGCGGGCTCCTTCCCCGCAGAGGCCGGGGCCTCCCTGACTTTGCTTCTTCACTCCCACCTGTGCGGCCACCCAGTC
CCTCTGTGGGAGCCCGGGTGCCAGGCCCTCCCAACACCACACCACCCTCCAGGCCCCCCTGCCCTCCGGCTGGAAACTGCAGCTCTGTAA
ATGCCTCTCTAGGTAGCTGCTGGCGGTGGTGGGGGTGTCTCACTCTCTGTCTTTATAGCCGGCGGTAGCCACCGGGGTGGCTCTGTCAGA
GTTCCGTACTCGGGAGCCCCTTTCCCTGAGTGCCCAGGGTGTCTCCTCTGCCCAGAGGGGCAGCAGCTCTCCCTGGTTCTCCCCAGGGCA
GACGGGGTAGGGCGGGCTCAGGACCCAGTGCCCATGGTTCCTCACTCCTACCAGCAAGCAGCACCATCCCGCAGGCTTCTCCCACCTGAT
GGCTGTTCTCCCACCGGGTCTGGGCTCTGGAAGGAGCCAGATGCCCCCAGAAAGGTGGGTGGTGGAGACGGCACCAGATGTACCAGTTTT
CTGCAGTTCCTTATAGGCGAAGGGAACCGGGTGGAAACCAAGCTGGGAGAGGCTGAGGATGGCAGGGCTGGAAGGGCCATCAGCGTGACC
CTCATTTTCAAGAAGGGGAAACTGAGGCCCAGGGAGGAGAGTAACTGAAGGTCACAGCACGGTCACAGCAGAGGTGGCCGAACCCAGCCC
TCTGCGCGCCAGTGCTGTGCGGTCTCCACACCCTTACGGTTTCCTAGAATCAGGGATGTTAGTGTAAGTCTATAGGAATATAGGGGGGTG
GGGGGGTCACCTTTTGCCTTGAAATGGGAAGTCAGTAGCCCCTTCCTCCTCCTCCCTCCTCCCCCTCCTCTCTGGCAGGGATCTCAGATG
ACCGTGGCCTCCCTCTCAGAGGGGGAGAACGCCAGAGCCCTGGCTGGTGATGTGCTGGCTGGGGGTGAATCCCAATGAGGGTCCCTCTCA
GAGCGGGAGAACGCCAGAGCCCTGGATGGTGATGCGCTGGCTGGGGGTGAATCCCAATGAGGGTCCCTCTCAGAAAGGGAGAACGCCAGA
GCCCTGGCTGGTGACATGCTGGCTGGGGGTGAATCCGAATGACAGTGCAGACGTTCTCCCATCCACCATGTCTGAGCTTGGGGGAATTGC
CTCATTTCCCCTGGAAAAGAAACATGGTCCATTAGAGGGGAAAGCCCAGGGGTGAATCTTCACGCCCCAAACAGTGCCCGGTGGGGAGGA
GGCACCCGCTCCTTGTTGAGTAAAACCACCCATGGAGACTGGAACCTCATCTCCCTGGGTCGGGGGGTGTTCAAGGCCACAGGACAAGGG
GAGCACCCTGGGCCACACAGGCGTGGAGGTGTCCCCACCCCTTCCACCTGTCCCCCAGACCCAAAGCTCTCTCCCCACCCTACCTGCCCA
CCTGGGGCTCCTGTGCCCCCTCCCCACTCCAGAGGCCACCCTACAAGTTGTCCTCAAGGTCATCCTGGAGATGGGATCCAGGACGTGGGG
CCATGACTCTCTGGGACCTTGCCACAGCCCCCATTCCCCTGCTTGCAGTCTGCAAGGACACCTTTGCAGGGATTCTTGTCCTGCTGGCCA
CCCCACCCACACCTGTCCCTGGCCAGCAGGCCGCCTGCAAGCGTCAGGCACACAGGGACAGACATGGCGAGCACAGTGCAGGCCCGGGGC
CCACGGGCAACATGGAACCCTGGGAACTGCCCTCCCCCTTAGCTCACAGTGCCTGCGGTAGCCACTCTAGGTCGTTGGCCTTCCTTGACC
ACTCCATTTAATTCTCTCTGCTGTTTGGGTTGGGTTTTTCCCCTTAGTTATCTGTGGGTTTCCTGTATTTTATGTTAATATTTCTATTAA
GAACATGTTGGGCATGTGGACCCAAGCACCTGGGAAGGAGGTGGCATCTGAGACAGCCTGATACGTTCCCGTCTGTGCACCCATGGAGAT
CCAGGCGTGGGCCCGTGTCTGTCCCTGGTTGTAAATTCGAGGGTCTGCATATCTGATGTTCAGGTAGACCTGGGCGCCTGGGAACGAGGC
CATCAGCTGCCATGCACATAACAAAGAGACAATGCATTCCTTCTTATTTTTCCTTTTTAAAAATCGATGAATCATTTGTGATGCTTTTAA

>In-frame_PPA2_ENST00000380004_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_5799nt
CCGTCATTGACGCCATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGA
CCGGGTCGCGCCGTGCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAA
CTGGTCACTACATTTCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAG
ACATGGGGAAGGTTCTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCA
CCGTCATCGACAATTTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTAT
TCCTCAGCGCAGACGAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACA
AGGTCCTCGCCTACACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAG
ACCACGTGTTCTGGTCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACG
TCACCTGCGCAATCCACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACG
ATTACATCTTCTTTAAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGA
AGTATGCATTGCCAAAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCT
ACAACCTGTACCAGTCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGC
TCATCGACATCCTGGAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACA
ACAAGGGCCGCGACTGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGC
ACCTGCACCTGCGCTGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTA
ACCTGGGCTCACAGCTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGC
ATCACATCCTGTACCTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACG
AGGGCCTCACCTGGAGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCA
TGACGGTCTTTGGCCACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGG
AGGACTACAGCTCCTGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGT
CCTGGTGCATCAAGGGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGAT
TTGAGCGCTCCTCCTCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCC
TGGGCCAGACCTACACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGC
AGCTGCAGTGCCCCCTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGT
TTGTGGTGCGGCAGGAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTA
CACTGACCGGGGAGCCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATG
AGGCGGTGCTCTTTGTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACC
TCACAGCTGTGCTGCTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATA
ATTCTGTGACAACGCGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGG
TCCTCCGTGTGCTGGATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGG
AAGACGTGGGCCTGGTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGC
CCACTTTGGCCGATCTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCC
AGCAGGTGCTGAACGCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTG
AGCAGCTGGGCGGCGGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGT
TCAAAAGGAAACGGCCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGG
ACGTCCAGGGCGCTGTCCAGGGCAACCACTCAGGCGTGGTCCTGAGCATCAACTCCCGAGAGATGCACAGCTACCTGGTGAGCTGATGCC
ACCCCAGCATCTGTCTTTTCACCCACGGAGGGCACAGAACCACCAGCAAAGCCGGCGGCTGGACTGGCGCCCCTCAGAGACCTGCGGAAA
GCCCCCTCCCTGAGTCGTCGCCACACCAGGCGACAGGCACCACCCCCTCTGATAAATCCAAGCCCGCCCAGGCCCACGGGGGGCCCACGG
GACCCCCCGGGACTCCCCGGACATGGCCCTGCCCCTATGGGACACCAGGCCTGACTCAGGCAGGTTCTGCCCCCCAGACCCCACACACGG
CCGCCCCACGTGCTGTCGCTCAGCCCGAGGCCTGACTTCTCTGGGCTGAGGCTGGTCGTCCTGGAGCCCTCCCAGTACCTCGGGCTGCAA
GAGCTGCAGACCCGTTCAGACACTGCGTTGCGGGCTCCTTCCCCGCAGAGGCCGGGGCCTCCCTGACTTTGCTTCTTCACTCCCACCTGT
GCGGCCACCCAGTCCCTCTGTGGGAGCCCGGGTGCCAGGCCCTCCCAACACCACACCACCCTCCAGGCCCCCCTGCCCTCCGGCTGGAAA
CTGCAGCTCTGTAAATGCCTCTCTAGGTAGCTGCTGGCGGTGGTGGGGGTGTCTCACTCTCTGTCTTTATAGCCGGCGGTAGCCACCGGG
GTGGCTCTGTCAGAGTTCCGTACTCGGGAGCCCCTTTCCCTGAGTGCCCAGGGTGTCTCCTCTGCCCAGAGGGGCAGCAGCTCTCCCTGG
TTCTCCCCAGGGCAGACGGGGTAGGGCGGGCTCAGGACCCAGTGCCCATGGTTCCTCACTCCTACCAGCAAGCAGCACCATCCCGCAGGC
TTCTCCCACCTGATGGCTGTTCTCCCACCGGGTCTGGGCTCTGGAAGGAGCCAGATGCCCCCAGAAAGGTGGGTGGTGGAGACGGCACCA
GATGTACCAGTTTTCTGCAGTTCCTTATAGGCGAAGGGAACCGGGTGGAAACCAAGCTGGGAGAGGCTGAGGATGGCAGGGCTGGAAGGG
CCATCAGCGTGACCCTCATTTTCAAGAAGGGGAAACTGAGGCCCAGGGAGGAGAGTAACTGAAGGTCACAGCACGGTCACAGCAGAGGTG
GCCGAACCCAGCCCTCTGCGCGCCAGTGCTGTGCGGTCTCCACACCCTTACGGTTTCCTAGAATCAGGGATGTTAGTGTAAGTCTATAGG
AATATAGGGGGGTGGGGGGGTCACCTTTTGCCTTGAAATGGGAAGTCAGTAGCCCCTTCCTCCTCCTCCCTCCTCCCCCTCCTCTCTGGC
AGGGATCTCAGATGACCGTGGCCTCCCTCTCAGAGGGGGAGAACGCCAGAGCCCTGGCTGGTGATGTGCTGGCTGGGGGTGAATCCCAAT
GAGGGTCCCTCTCAGAGCGGGAGAACGCCAGAGCCCTGGATGGTGATGCGCTGGCTGGGGGTGAATCCCAATGAGGGTCCCTCTCAGAAA
GGGAGAACGCCAGAGCCCTGGCTGGTGACATGCTGGCTGGGGGTGAATCCGAATGACAGTGCAGACGTTCTCCCATCCACCATGTCTGAG
CTTGGGGGAATTGCCTCATTTCCCCTGGAAAAGAAACATGGTCCATTAGAGGGGAAAGCCCAGGGGTGAATCTTCACGCCCCAAACAGTG
CCCGGTGGGGAGGAGGCACCCGCTCCTTGTTGAGTAAAACCACCCATGGAGACTGGAACCTCATCTCCCTGGGTCGGGGGGTGTTCAAGG
CCACAGGACAAGGGGAGCACCCTGGGCCACACAGGCGTGGAGGTGTCCCCACCCCTTCCACCTGTCCCCCAGACCCAAAGCTCTCTCCCC
ACCCTACCTGCCCACCTGGGGCTCCTGTGCCCCCTCCCCACTCCAGAGGCCACCCTACAAGTTGTCCTCAAGGTCATCCTGGAGATGGGA
TCCAGGACGTGGGGCCATGACTCTCTGGGACCTTGCCACAGCCCCCATTCCCCTGCTTGCAGTCTGCAAGGACACCTTTGCAGGGATTCT
TGTCCTGCTGGCCACCCCACCCACACCTGTCCCTGGCCAGCAGGCCGCCTGCAAGCGTCAGGCACACAGGGACAGACATGGCGAGCACAG
TGCAGGCCCGGGGCCCACGGGCAACATGGAACCCTGGGAACTGCCCTCCCCCTTAGCTCACAGTGCCTGCGGTAGCCACTCTAGGTCGTT
GGCCTTCCTTGACCACTCCATTTAATTCTCTCTGCTGTTTGGGTTGGGTTTTTCCCCTTAGTTATCTGTGGGTTTCCTGTATTTTATGTT
AATATTTCTATTAAGAACATGTTGGGCATGTGGACCCAAGCACCTGGGAAGGAGGTGGCATCTGAGACAGCCTGATACGTTCCCGTCTGT
GCACCCATGGAGATCCAGGCGTGGGCCCGTGTCTGTCCCTGGTTGTAAATTCGAGGGTCTGCATATCTGATGTTCAGGTAGACCTGGGCG
CCTGGGAACGAGGCCATCAGCTGCCATGCACATAACAAAGAGACAATGCATTCCTTCTTATTTTTCCTTTTTAAAAATCGATGAATCATT

>In-frame_PPA2_ENST00000357415_chr4_106377838_-_SORCS2_ENST00000507866_chr4_7398015_+_5799nt
CCGTCATTGACGCCATGAGCGCGCTGCTGCGGCTGCTGCGCACGGGTGCCCCAGCCGCTGCGTGCCTGCGGTTGGGGACCAGTGCAGGGA
CCGGGTCGCGCCGTGCTATGGCCCTGTACCACACTGAGGAGCGCGGCCAGCCCTGCTCGCAGAATTACCGCCTCTTCTTTAAGAATGTAA
CTGGTCACTACATTTCCCCCTTTCATGATATTCCTCTGAAGGTGAACTCTAAAGAGGTGATCTTGATCCTGACGAAGTACTACCACGCAG
ACATGGGGAAGGTTCTGGAAAGTTCTCTGTGGCGGTCATCAGATTTCGGGACGTCCTACACCAAGCTCACCCTCCAGCCTGGTGTCACCA
CCGTCATCGACAATTTCTACATCTGCCCGACCAACAAGAGGAAGGTCATCCTTGTCAGCTCCTCACTCAGTGACCGGGACCAGAGCCTAT
TCCTCAGCGCAGACGAAGGCGCCACCTTTCAGAAGCAGCCCATTCCCTTCTTCGTGGAAACTCTGATTTTCCACCCTAAGGAGGAGGACA
AGGTCCTCGCCTACACAAAGGAGAGCAAGCTCTACGTGTCATCTGACTTGGGGAAAAAGTGGACACTTCTGCAAGAGCGAGTGACCAAAG
ACCACGTGTTCTGGTCTGTGTCTGGGGTGGACGCTGACCCTGACTTGGTCCACGTGGAAGCCCAAGACCTCGGTGGAGATTTTCGGTACG
TCACCTGCGCAATCCACAATTGCTCCGAGAAGATGCTGACAGCCCCATTCGCAGGCCCCATTGACCACGGGTCTCTGACCGTGCAGGACG
ATTACATCTTCTTTAAGGCAACATCAGCAAACCAGACAAAATACTACGTCTCTTATCGTCGAAATGAATTTGTCCTGATGAAGCTGCCGA
AGTATGCATTGCCAAAGGATCTGCAGATCATCAGCACGGACGAGAGTCAGGTGTTCGTGGCGGTGCAGGAGTGGTACCAGATGGACACCT
ACAACCTGTACCAGTCGGACCCACGGGGCGTGCGCTACGCGCTGGTGCTGCAGGACGTGCGCAGCTCACGGCAGGCGGAGGAGAGCGTGC
TCATCGACATCCTGGAGGTCAGAGGGGTGAAAGGAGTCTTCCTGGCAAACCAAAAAATTGATGGGAAAGTGATGACGCTTATAACCTACA
ACAAGGGCCGCGACTGGGATTACCTGAGGCCACCCAGCATGGACATGAATGGAAAACCAACCAACTGCAAGCCTCCAGACTGCCACCTGC
ACCTGCACCTGCGCTGGGCAGACAACCCCTACGTATCAGGCACCGTGCACACCAAGGACACCGCCCCAGGCCTCATCATGGGTGCAGGTA
ACCTGGGCTCACAGCTGGTGGAATATAAAGAAGAAATGTACATCACGTCAGACTGTGGTCACACCTGGCGGCAGGTGTTTGAGGAAGAGC
ATCACATCCTGTACCTGGACCACGGCGGCGTGATCGTGGCCATCAAAGACACCTCCATCCCTTTGAAGATCCTCAAGTTCAGTGTGGACG
AGGGCCTCACCTGGAGCACGCACAACTTCACCAGCACCTCGGTGTTTGTGGACGGGCTGCTGAGTGAGCCAGGGGACGAGACGCTGGTCA
TGACGGTCTTTGGCCACATCAGCTTCCGCTCCGATTGGGAGCTGGTCAAGGTGGACTTCCGGCCCTCATTCTCCAGGCAGTGCGGCGAGG
AGGACTACAGCTCCTGGGAGCTCTCCAACCTGCAGGGCGACCGCTGTATCATGGGCCAGCAGAGAAGTTTCCGGAAAAGAAAGTCCACGT
CCTGGTGCATCAAGGGGAGGAGCTTCACGTCGGCGCTCACGTCCCGCGTGTGCGAGTGCCGGGACTCGGACTTCCTGTGCGACTACGGAT
TTGAGCGCTCCTCCTCCTCAGAGTCCAGCACCAACAAGTGCTCTGCCAACTTCTGGTTTAACCCATTGTCCCCGCCTGACGACTGTGCCC
TGGGCCAGACCTACACCAGCAGCCTTGGGTACCGGAAAGTGGTGTCCAACGTGTGTGAGGGTGGGGTGGACATGCAGCAGAGTCAGGTGC
AGCTGCAGTGCCCCCTCACGCCGCCCCGGGGCCTGCAGGTCAGCATTCAAGGCGAGGCGGTGGCCGTGCGGCCTGGAGAGGACGTCCTGT
TTGTGGTGCGGCAGGAGCAGGGTGATGTCCTGACTACCAAGTACCAGGTAGACCTTGGGGACGGCTTCAAGGCCATGTACGTGAACCTTA
CACTGACCGGGGAGCCCATCCGGCACCGCTACGAGAGCCCCGGCATCTACCGCGTGTCCGTCAGGGCAGAGAACACGGCAGGCCACGATG
AGGCGGTGCTCTTTGTCCAGGTCAACTCCCCCCTGCAGGCCCTCTACCTGGAGGTGGTTCCTGTCATTGGCCTCAACCAGGAGGTGAACC
TCACAGCTGTGCTGCTTCCCTTGAACCCTAACCTCACCGTCTTCTACTGGTGGATCGGCCACAGCCTGCAGCCCCTCCTTTCCCTGGATA
ATTCTGTGACAACGCGGTTTTCGGACACGGGCGACGTGCGTGTGACGGTGCAGGCCGCCTGTGGGAACTCGGTGCTGCAGGACTCCAGGG
TCCTCCGTGTGCTGGATCAATTTCAAGTCATGCCTCTGCAGTTTTCCAAGGAGCTGGATGCCTACAACCCCAACACCCCTGAGTGGAGGG
AAGACGTGGGCCTGGTGGTCACCCGGCTGCTCTCCAAGGAGACCAGCGTCCCTCAGGAGCTTCTGGTGACTGTGGTGAAGCCGGGGCTGC
CCACTTTGGCCGATCTGTACGTGCTCCTGCCCCCTCCCAGGCCCACAAGGAAGAGGAGCCTCTCGAGTGATAAGAGGCTCGCCGCCATCC
AGCAGGTGCTGAACGCACAGAAGATCAGCTTCCTCCTGCGAGGCGGAGTCCGGGTCCTGGTGGCCCTGCGGGACACAGGCACAGGTGCTG
AGCAGCTGGGCGGCGGTGGCGGCTACTGGGCGGTAGTGGTGCTGTTTGTCATCGGGCTCTTCGCAGCGGGAGCCTTCATCCTCTACAAGT
TCAAAAGGAAACGGCCAGGCAGGACCGTGTACGCCCAAATGCACAACGAGAAGGAGCAGGAGATGACCAGCCCTGTGAGTCACAGTGAGG
ACGTCCAGGGCGCTGTCCAGGGCAACCACTCAGGCGTGGTCCTGAGCATCAACTCCCGAGAGATGCACAGCTACCTGGTGAGCTGATGCC
ACCCCAGCATCTGTCTTTTCACCCACGGAGGGCACAGAACCACCAGCAAAGCCGGCGGCTGGACTGGCGCCCCTCAGAGACCTGCGGAAA
GCCCCCTCCCTGAGTCGTCGCCACACCAGGCGACAGGCACCACCCCCTCTGATAAATCCAAGCCCGCCCAGGCCCACGGGGGGCCCACGG
GACCCCCCGGGACTCCCCGGACATGGCCCTGCCCCTATGGGACACCAGGCCTGACTCAGGCAGGTTCTGCCCCCCAGACCCCACACACGG
CCGCCCCACGTGCTGTCGCTCAGCCCGAGGCCTGACTTCTCTGGGCTGAGGCTGGTCGTCCTGGAGCCCTCCCAGTACCTCGGGCTGCAA
GAGCTGCAGACCCGTTCAGACACTGCGTTGCGGGCTCCTTCCCCGCAGAGGCCGGGGCCTCCCTGACTTTGCTTCTTCACTCCCACCTGT
GCGGCCACCCAGTCCCTCTGTGGGAGCCCGGGTGCCAGGCCCTCCCAACACCACACCACCCTCCAGGCCCCCCTGCCCTCCGGCTGGAAA
CTGCAGCTCTGTAAATGCCTCTCTAGGTAGCTGCTGGCGGTGGTGGGGGTGTCTCACTCTCTGTCTTTATAGCCGGCGGTAGCCACCGGG
GTGGCTCTGTCAGAGTTCCGTACTCGGGAGCCCCTTTCCCTGAGTGCCCAGGGTGTCTCCTCTGCCCAGAGGGGCAGCAGCTCTCCCTGG
TTCTCCCCAGGGCAGACGGGGTAGGGCGGGCTCAGGACCCAGTGCCCATGGTTCCTCACTCCTACCAGCAAGCAGCACCATCCCGCAGGC
TTCTCCCACCTGATGGCTGTTCTCCCACCGGGTCTGGGCTCTGGAAGGAGCCAGATGCCCCCAGAAAGGTGGGTGGTGGAGACGGCACCA
GATGTACCAGTTTTCTGCAGTTCCTTATAGGCGAAGGGAACCGGGTGGAAACCAAGCTGGGAGAGGCTGAGGATGGCAGGGCTGGAAGGG
CCATCAGCGTGACCCTCATTTTCAAGAAGGGGAAACTGAGGCCCAGGGAGGAGAGTAACTGAAGGTCACAGCACGGTCACAGCAGAGGTG
GCCGAACCCAGCCCTCTGCGCGCCAGTGCTGTGCGGTCTCCACACCCTTACGGTTTCCTAGAATCAGGGATGTTAGTGTAAGTCTATAGG
AATATAGGGGGGTGGGGGGGTCACCTTTTGCCTTGAAATGGGAAGTCAGTAGCCCCTTCCTCCTCCTCCCTCCTCCCCCTCCTCTCTGGC
AGGGATCTCAGATGACCGTGGCCTCCCTCTCAGAGGGGGAGAACGCCAGAGCCCTGGCTGGTGATGTGCTGGCTGGGGGTGAATCCCAAT
GAGGGTCCCTCTCAGAGCGGGAGAACGCCAGAGCCCTGGATGGTGATGCGCTGGCTGGGGGTGAATCCCAATGAGGGTCCCTCTCAGAAA
GGGAGAACGCCAGAGCCCTGGCTGGTGACATGCTGGCTGGGGGTGAATCCGAATGACAGTGCAGACGTTCTCCCATCCACCATGTCTGAG
CTTGGGGGAATTGCCTCATTTCCCCTGGAAAAGAAACATGGTCCATTAGAGGGGAAAGCCCAGGGGTGAATCTTCACGCCCCAAACAGTG
CCCGGTGGGGAGGAGGCACCCGCTCCTTGTTGAGTAAAACCACCCATGGAGACTGGAACCTCATCTCCCTGGGTCGGGGGGTGTTCAAGG
CCACAGGACAAGGGGAGCACCCTGGGCCACACAGGCGTGGAGGTGTCCCCACCCCTTCCACCTGTCCCCCAGACCCAAAGCTCTCTCCCC
ACCCTACCTGCCCACCTGGGGCTCCTGTGCCCCCTCCCCACTCCAGAGGCCACCCTACAAGTTGTCCTCAAGGTCATCCTGGAGATGGGA
TCCAGGACGTGGGGCCATGACTCTCTGGGACCTTGCCACAGCCCCCATTCCCCTGCTTGCAGTCTGCAAGGACACCTTTGCAGGGATTCT
TGTCCTGCTGGCCACCCCACCCACACCTGTCCCTGGCCAGCAGGCCGCCTGCAAGCGTCAGGCACACAGGGACAGACATGGCGAGCACAG
TGCAGGCCCGGGGCCCACGGGCAACATGGAACCCTGGGAACTGCCCTCCCCCTTAGCTCACAGTGCCTGCGGTAGCCACTCTAGGTCGTT
GGCCTTCCTTGACCACTCCATTTAATTCTCTCTGCTGTTTGGGTTGGGTTTTTCCCCTTAGTTATCTGTGGGTTTCCTGTATTTTATGTT
AATATTTCTATTAAGAACATGTTGGGCATGTGGACCCAAGCACCTGGGAAGGAGGTGGCATCTGAGACAGCCTGATACGTTCCCGTCTGT
GCACCCATGGAGATCCAGGCGTGGGCCCGTGTCTGTCCCTGGTTGTAAATTCGAGGGTCTGCATATCTGATGTTCAGGTAGACCTGGGCG
CCTGGGAACGAGGCCATCAGCTGCCATGCACATAACAAAGAGACAATGCATTCCTTCTTATTTTTCCTTTTTAAAAATCGATGAATCATT


Top

FusionGenePPI for PPA2_SORCS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PPA2VKORC1, BAG3, MTIF2, HIST1H1D, ACSF2, CLUH, ACADVL, ACSS1, GLS, PNPT1, CLPP, PCCB, NNT, ARPIN, LYRM7, NIPSNAP3A, MECR, PDPR, CAT, CD2AP, DUT, HIBCH, NEDD8, AIP, CHCHD2, EZR, FKBP14, METTL1, NAV1, PLIN3, UFM1, PPP1R11, SCPEP1, TANGO2, COMT, ZWINT, DUSP13, SYNC, NDUFAF5SORCS2TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PPA2_SORCS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PPA2_SORCS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSORCS2C0005586Bipolar Disorder1PSYGENET