FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27948

FusionGeneSummary for POLR1A_CTNNA2

check button Fusion gene summary
Fusion gene informationFusion gene name: POLR1A_CTNNA2
Fusion gene ID: 27948
HgeneTgene
Gene symbol

POLR1A

CTNNA2

Gene ID

25885

1496

Gene nameRNA polymerase I subunit Acatenin alpha 2
SynonymsA190|AFDCIN|RPA1|RPA194|RPO1-4|RPO14CAP-R|CAPR|CT114|CTNR
Cytomap

2p11.2

2p12

Type of geneprotein-codingprotein-coding
DescriptionDNA-directed RNA polymerase I subunit RPA1DNA-directed RNA polymerase I largest subunitDNA-directed RNA polymerase I subunit ADNA-directed RNA polymerase I subunit A1RNA polymerase I 194 kDa subunitpolymerase (RNA) I polypeptide A, 194kDapolymerase catenin alpha-2alpha-N-cateninalpha-catenin-related proteincadherin-associated protein, relatedcancer/testis antigen 114catenin (cadherin-associated protein), alpha 2
Modification date2018052320180522
UniProtAcc

O95602

P26232

Ensembl transtripts involved in fusion geneENST00000263857, ENST00000409681, 
ENST00000483538, 
ENST00000466387, 
ENST00000496558, ENST00000361291, 
ENST00000402739, ENST00000540488, 
ENST00000541047, ENST00000343114, 
ENST00000496251, ENST00000409266, 
Fusion gene scores* DoF score5 X 4 X 8=16015 X 12 X 9=1620
# samples 915
** MAII scorelog2(9/160*10)=-0.830074998557688
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1620*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: POLR1A [Title/Abstract] AND CTNNA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVREADTCGA-EF-5831-01APOLR1Achr2

86265823

-CTNNA2chr2

80831199

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263857ENST00000466387POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000496558POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000361291POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000402739POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000540488POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000541047POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000263857ENST00000343114POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
5CDS-intronENST00000263857ENST00000496251POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
5CDS-intronENST00000263857ENST00000409266POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000466387POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000496558POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000361291POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000402739POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000540488POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000541047POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
In-frameENST00000409681ENST00000343114POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
5CDS-intronENST00000409681ENST00000496251POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
5CDS-intronENST00000409681ENST00000409266POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000466387POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000496558POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000361291POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000402739POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000540488POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000541047POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-3CDSENST00000483538ENST00000343114POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-intronENST00000483538ENST00000496251POLR1Achr2

86265823

-CTNNA2chr2

80831199

+
intron-intronENST00000483538ENST00000409266POLR1Achr2

86265823

-CTNNA2chr2

80831199

+

Top

FusionProtFeatures for POLR1A_CTNNA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
POLR1A

O95602

CTNNA2

P26232

DNA-dependent RNA polymerase catalyzes the transcriptionof DNA into RNA using the four ribonucleoside triphosphates assubstrates. Largest and catalytic core component of RNA polymeraseI which synthesizes ribosomal RNA precursors. Forms the polymeraseactive center together with the second largest subunit. A singlestranded DNA template strand of the promoter is positioned withinthe central active site cleft of Pol I. A bridging helix emanatesfrom RPA1 and crosses the cleft near the catalytic site and isthought to promote translocation of Pol I by acting as a ratchetthat moves the RNA-DNA hybrid through the active site by switchingfrom straight to bent conformations at each step of nucleotideaddition (By similarity). {ECO:0000250|UniProtKB:P10964}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePOLR1Achr2:86265823chr2:80831199ENST00000263857-2734961_97313441721RegionBridging helix

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for POLR1A_CTNNA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_1569aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDC
DVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKP

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_1476aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVK

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_1569aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFTEVDC
DVIDGGRASQLSTHLPTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKP

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_1476aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQLDSATSLIQAAKNLMNAVVLTVKASTVASTKYQKVTGTAAVNSPVVSWKMKAPEKKPLVK

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_1521aa
MLISKNMPWRRLQGISFGMTSAEELKKLSVKSITNPRYLDSLGNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVTNP
LLFDKLYLLLRGSCLNCHMLTCPRAVIHLLLCQLRVLEVGALQAVYELERILNRFLEENPDPSASEIREELEQYTTEIVQNNLLGSQGAH
VKNVCESKSKLIALFWKAHMNAKRCPHCKTGRSVVRKEHNSKLTITFPAMVHRTAGQKDSEPLGIEEAQIGKRGYLTPTSAREHLSALWK
NEGFFLNYLFSGMDDDGMESRFNPSVFFLDFLVVPPSRTRPVSRLGDQMFTNGQTVNLQAVMKDVVLIRKLLALMAQEQKLPEEVATPTT
DEEKDSLIAIDRSFLSTLPGQSLIDKLYNIWIRLQSHVNIVFDSEMDKLMMDKYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMY
INTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCR
HVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHTANCKATNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGL
IQDHMVSGASMTTRGCFFTREHTMELVYRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKET
PRSVPGFNPDSMCESQVIIREGELLCGVLDKAHTGSSAYGLVHCCTEITGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADV
KRQRIIEESTHCGPQAVRAALNLPEAASTDEVRGKWQDAHLGKDQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQS
GAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPTEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGTLQR
CIIKHLEGLVVQTDLTVRDSDGSVVQFLTGEDGLDIPKTQFLQPKQFPFLASNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHP
NTLLRRGAFLSTSQKIQEAVKALKLESENRNGRSPGTQEMLRMWTELDEESRRKYQKKAAACPDPSLSVWRPDIYFASVSETFETKVDDY
SQEWAAQTEKSTEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIK
TPMMSVPVLNTKKALKRVKSLKKQLTRVCLGEVLQKIDVQESFCMEEKQNKFQVYQLRFQFLPHATYQQEKCLRPEDILRFMETRGKGPL
KNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALTCHQLNICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_4707nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGT
GATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGAT
TCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTG
GCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCC
CTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGT

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_4428nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
CTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACC
AAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAG
AGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAA

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_4707nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTACCTTTTATGAGGTAGATTGT
GATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGATCGGGAGTGGAAGCAGTGAT
TCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTG
GCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCC
CTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_4428nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
CTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACC
AAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAG
AGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAA

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_4563nt
ATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGAGCTCAAGAAATTAAGTGTT
AAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGCTTTGGGCCCTGCAGATTCC
AAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCCACTCACAGTGTATAACCCT
CTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCGGGCCGTGATTCACCTCTTA
CTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAGGTTTCTGGAAGAAAATCCC
GATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCTGGGGTCCCAGGGCGCACAT
GTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCGCTGTCCCCACTGCAAGACC
GGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGACAGCTGGCCAGAAGGACTCT
GAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACACCTTTCTGCCCTGTGGAAG
AATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCCCAGTGTGTTCTTTCTAGAT
TTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCAGACGGTGAACTTGCAGGCT
GTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGAAGTGGCCACACCCACTACA
GATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCATAGACAAACTTTACAACATT
TGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTACCCAGGCATTAGGCAGATC
CTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGTCATCTGCCCAGACATGTAC
ATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCCATGGAATGTTCAGGAACTT
AGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCGCACAGCCCTGAGCGCTGTG
GACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGGGACAAAAATTGTGTGCCGG
CATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCACCGTGCCCGCATCCTGCCT
GAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGATGAATGCCCATTTCCCCCAG
AGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGGCCAACCATTGGCGGGACTG
ATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATATGGAGCTGGTGTACCGAGGA
CTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGGAAAACAGGTTGTGTCAACG
CTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAAAGCCTGGGTGAAGGAAACT
CCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCTGCTCTGCGGAGTGCTGGAC
AAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAGCGGCAAGGTTCTAACCTGC
CTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGTGAAGCCAAAGGCAGATGTC
AAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCCAGAAGCCGCATCATATGAT
GAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAAGTTCAAGGAGGAAGTGAAC
CATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCTGCAGATGATGGTGCAGTCG
GGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCGGAGACCCCCGCTGATGGCG
TCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAGGTTCCTCACCGGCATCAAA
CCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCGCTCAGGCTATCTCCAAAGG
TGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGTGGTGCAGTTCCTGTATGGG
GAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTACGAGGTGATAATGAAATCA
CAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAAATGGCAAAGCAAGCACCCC
AACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAAACTTGAGAGTGAAAACCGC
AATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAAATACCAGAAGAAGGCGGCC
GCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGAAACAAAGGTTGATGACTAC
AGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGACCTTGCTGCAGCTGAAGTGG
CAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCACCCAGATGACCCTCAACACC
TTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGTGGCCAGCGCCAACATCAAG
ACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCAACTCACCAGGGTGTGCTTG
GGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGTGTACCAGCTGCGGTTTCAG
TTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAACAAGAGGCAAAGGCCCATTG
AAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGCTCGTGCTGTGGCTGATCAG
TGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCTTAATATCTGCAGCAAGGTG
AAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATG
AATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTT
GTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_5849nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_5850nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG
AGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACACATTTAATCTTGA

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_4942nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_5903nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTAC
CTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGAT
CGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCAC
GGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAA
GGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTC
GCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCT
TTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTG
CATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTG
TCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAAC
TCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACA
TAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGA
AGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTT
CCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCT
TCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGA

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_4807nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGC
ATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGA
GAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACA

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_5849nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG

>In-frame_POLR1A_ENST00000263857_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_5850nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG
AGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACACATTTAATCTTGA

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000466387_chr2_80831199_+_5849nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000496558_chr2_80831199_+_5850nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG
AGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACACATTTAATCTTGA

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000361291_chr2_80831199_+_4942nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000402739_chr2_80831199_+_5903nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGACAGGAGTTCAGAGCACTTTCACTAC
CTTTTATGAGGTAGATTGTGATGTCATAGATGGGGGCAGGGCTAGTCAACTTTCTACCCACCTCCCAACCTGTGCTGAGGGAGCTCCGAT
CGGGAGTGGAAGCAGTGATTCCTCCATGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCAC
GGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAA
GGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTC
GCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCT
TTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTG
CATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTG
TCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAAC
TCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACA
TAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGA
AGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTT
CCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCT
TCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGA

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000540488_chr2_80831199_+_4807nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGC
ATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGA
GAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACA

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000541047_chr2_80831199_+_5849nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG

>In-frame_POLR1A_ENST00000409681_chr2_86265823_-_CTNNA2_ENST00000343114_chr2_80831199_+_5850nt
ATTGGCTGAAGCGGAAGAAGACGAAAGCAATCATAAAATGGGAGGTTGCAAGCTCATGGTTTGAAAGACTTCGTCACGGAAGCTAAAAGC
TCTATACACCCGATTTGCCTCGGAGGAATTTTCCTAAATGATTATTTTGATGTCTTATATATCTTTGATTGTTTTCAAAACAAAAGAGCG
AGCAGAGAGTCGTACAACTATTTGTTCCCCCCCCATGTAGAAGTGATCTCATCCACGTAAATGTCGTTCCTGCGACCGCTTCCGCGCGCA
AGCGCACGTTGAATCGCGTGGTGACTCCGGGCTTGAGGTTGAATTAAGAATAGTCAGGTGGTGAGTGGAACGTCTCTTGGGGTGTCGGAA
TTCAAAACGGACCTGGAGGATGTTGATCTCCAAGAACATGCCCTGGCGGCGGCTGCAGGGCATTTCCTTCGGGATGTATTCGGCTGAAGA
GCTCAAGAAATTAAGTGTTAAATCCATTACGAACCCTCGATACCTGGACAGCCTGGGGAACCCATCGGCAAACGGCCTGTACGATTTAGC
TTTGGGCCCTGCAGATTCCAAAGAGGTGTGCTCCACCTGCGTGCAGGACTTCAGCAACTGTTCTGGGCACCTGGGCCACATTGAGCTCCC
ACTCACAGTGTATAACCCTCTCCTCTTCGATAAGCTGTACCTGCTGCTTCGGGGCTCTTGTTTAAACTGCCACATGCTGACTTGTCCCCG
GGCCGTGATTCACCTCTTACTCTGCCAGCTGAGGGTTCTGGAAGTCGGGGCCCTACAAGCAGTCTACGAGCTTGAGAGAATTCTGAACAG
GTTTCTGGAAGAAAATCCCGATCCCTCTGCCTCTGAAATTCGGGAGGAATTAGAACAATACACAACTGAAATTGTGCAGAACAACCTCCT
GGGGTCCCAGGGCGCACATGTAAAGAACGTGTGTGAGAGCAAGAGCAAGCTCATTGCTCTCTTCTGGAAGGCACATATGAATGCTAAGCG
CTGTCCCCACTGCAAGACCGGGCGATCCGTTGTCCGAAAGGAACACAACAGCAAGTTGACTATCACGTTTCCAGCCATGGTGCACAGGAC
AGCTGGCCAGAAGGACTCTGAGCCCCTGGGAATTGAGGAAGCTCAGATAGGAAAACGAGGATACTTAACACCCACCAGTGCCCGCGAACA
CCTTTCTGCCCTGTGGAAGAATGAAGGATTCTTTCTGAACTACCTTTTTTCGGGAATGGATGATGATGGTATGGAATCCAGATTCAATCC
CAGTGTGTTCTTTCTAGATTTCTTGGTGGTGCCGCCCTCAAGGTATCGCCCAGTCAGTCGCCTAGGAGACCAGATGTTTACTAATGGCCA
GACGGTGAACTTGCAGGCTGTCATGAAGGATGTAGTTCTGATTCGAAAACTTCTGGCATTGATGGCCCAAGAACAGAAGTTGCCAGAGGA
AGTGGCCACACCCACTACAGATGAGGAAAAAGACTCTTTGATTGCTATTGACCGATCCTTTTTGAGTACACTTCCAGGCCAGTCCCTCAT
AGACAAACTTTACAACATTTGGATTCGCCTTCAGAGCCACGTCAATATTGTGTTTGATAGCGAGATGGACAAACTAATGATGGACAAGTA
CCCAGGCATTAGGCAGATCCTGGAGAAGAAAGAAGGCCTGTTCCGAAAACACATGATGGGAAAGCGAGTGGACTACGCTGCGCGCTCAGT
CATCTGCCCAGACATGTACATCAACACCAACGAAATTGGAATTCCCATGGTGTTTGCCACAAAACTGACCTACCCACAGCCAGTTACCCC
ATGGAATGTTCAGGAACTTAGGCAAGCGGTCATCAACGGCCCTAATGTGCACCCAGGAGCCTCCATGGTCATCAATGAGGACGGCAGCCG
CACAGCCCTGAGCGCTGTGGACATGACCCAGCGAGAGGCCGTGGCCAAGCAGCTTCTGACCCCAGCCACGGGGGCACCTAAGCCCCAGGG
GACAAAAATTGTGTGCCGGCATGTGAAGAATGGGGACATTCTGCTACTGAACCGACAGCCCACACTGCACAGACCCTCCATCCAGGCCCA
CCGTGCCCGCATCCTGCCTGAAGAGAAAGTGCTGCGGCTCCACTATGCCAACTGCAAGGCCTATAATGCCGACTTTGATGGAGACGAGAT
GAATGCCCATTTCCCCCAGAGTGAGCTGGGCCGGGCCGAGGCCTACGTCCTGGCCTGCACTGATCAGCAGTACCTTGTTCCCAAGGATGG
CCAACCATTGGCGGGACTGATCCAGGATCACATGGTTTCAGGGGCAAGCATGACTACTCGGGGTTGCTTTTTCACCCGGGAGCACTATAT
GGAGCTGGTGTACCGAGGACTCACGGACAAAGTGGGGCGCGTGAAGCTCCTTTCTCCTTCCATCCTGAAGCCCTTTCCGCTGTGGACAGG
AAAACAGGTTGTGTCAACGCTGCTCATAAATATAATCCCAGAGGACCACATCCCACTGAACTTATCTGGAAAGGCGAAAATCACTGGGAA
AGCCTGGGTGAAGGAAACTCCTCGATCCGTTCCTGGCTTTAACCCTGACTCGATGTGCGAGTCCCAGGTGATCATCAGGGAAGGGGAGCT
GCTCTGCGGAGTGCTGGACAAGGCGCACTATGGGAGCTCCGCCTACGGCCTGGTCCACTGCTGCTATGAGATCTATGGAGGCGAGACCAG
CGGCAAGGTTCTAACCTGCCTGGCCCGCCTCTTCACCGCCTACCTGCAGCTCTACAGAGGCTTCACCTTGGGCGTGGAAGACATTTTGGT
GAAGCCAAAGGCAGATGTCAAGAGGCAACGTATCATTGAAGAATCCACCCACTGCGGGCCCCAGGCTGTCAGGGCTGCATTAAACCTGCC
AGAAGCCGCATCATATGATGAGGTCCGAGGAAAATGGCAGGATGCCCATCTGGGCAAGGACCAGAGGGATTTTAACATGATTGATCTGAA
GTTCAAGGAGGAAGTGAACCATTACAGCAATGAGATTAACAAGGCATGCATGCCTTTTGGCCTACACAGACAGTTCCCAGAGAACAGCCT
GCAGATGATGGTGCAGTCGGGAGCCAAAGGTTCAACTGTGAACACGATGCAGATCTCGTGCCTGCTGGGCCAGATTGAACTGGAAGGTCG
GAGACCCCCGCTGATGGCGTCTGGCAAGTCACTGCCCTGCTTTGAGCCTTATGAGTTCACCCCCAGGGCTGGTGGCTTTGTCACTGGCAG
GTTCCTCACCGGCATCAAACCTCCTGAGTTCTTCTTCCACTGCATGGCAGGACGAGAGGGCCTGGTGGACACTGCTGTGAAAACCAGCCG
CTCAGGCTATCTCCAAAGGTGCATCATCAAGCACCTAGAGGGGCTGGTCGTGCAGTATGATCTCACGGTCCGTGACAGTGACGGCAGTGT
GGTGCAGTTCCTGTATGGGGAGGATGGCCTGGACATCCCCAAGACACAGTTCCTGCAGCCCAAGCAGTTCCCCTTCCTGGCCAGCAACTA
CGAGGTGATAATGAAATCACAGCATCTCCATGAAGTTTTATCCAGAGCAGATCCCAAAAAAGCTCTCCACCACTTCAGAGCTATCAAAAA
ATGGCAAAGCAAGCACCCCAACACCCTGCTGAGAAGAGGCGCCTTCTTGAGTTATTCCCAGAAAATTCAGGAAGCTGTGAAAGCCCTGAA
ACTTGAGAGTGAAAACCGCAATGGCCGCAGCCCTGGGACTCAGGAGATGCTGAGGATGTGGTATGAGTTGGATGAGGAAAGCCGAAGGAA
ATACCAGAAGAAGGCGGCCGCTTGTCCTGACCCCAGTCTGTCTGTCTGGCGTCCTGACATCTACTTTGCATCAGTGTCAGAAACATTTGA
AACAAAGGTTGATGACTACAGTCAAGAGTGGGCAGCTCAAACAGAGAAGAGTTATGAGAAATCAGAGCTTTCTCTCGACAGGTTGAGGAC
CTTGCTGCAGCTGAAGTGGCAGCGCTCACTGTGTGAGCCGGGCGAGGCTGTGGGCCTGCTGGCTGCCCAGAGCATCGGAGAGCCCTCCAC
CCAGATGACCCTCAACACCTTCCACTTTGCAGGCAGAGGCGAGATGAACGTCACCCTGGGCATTCCAAGGTTGCGGGAGATTCTCATGGT
GGCCAGCGCCAACATCAAGACACCCATGATGAGCGTGCCCGTGCTCAACACCAAGAAAGCCCTGAAGAGAGTGAAAAGCCTGAAGAAGCA
ACTCACCAGGGTGTGCTTGGGGGAGGTGTTGCAGAAAATTGACGTCCAGGAGTCCTTCTGTATGGAAGAAAAACAGAACAAATTCCAGGT
GTACCAGCTGCGGTTTCAGTTCCTGCCACATGCATATTACCAGCAGGAGAAGTGCCTGAGACCCGAGGACATCCTGCGCTTCATGGAAAC
AAGAGGCAAAGGCCCATTGAAAAATACATCTGATGTCATTAATGCTGCCAAGAAAATTGCCGAAGCAGGTTCTCGAATGGACAAATTAGC
TCGTGCTGTGGCTGATCAGTGTCCTGATTCAGCATGTAAGCAGGATTTATTAGCCTACCTTCAACGAATTGCCTTGTATTGCCATCAGCT
TAATATCTGCAGCAAGGTGAAGGCAGAAGTGCAGAATCTGGGAGGAGAGCTCATTGTGTCAGGGCTGGACAGTGCCACATCGCTTATCCA
GGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGC
AGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGAC
ACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAG
GTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCT
CTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGA
GACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATT
TATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATG
CATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTA
AGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTC
CAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGA
AAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTT
CTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAG
AGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACACATTTAATCTTGA


Top

FusionGenePPI for POLR1A_CTNNA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
POLR1APOLR1E, CD3EAP, NOLC1, RRN3, TAF1D, USP11, RPAP3, TAF13, POLR1B, SSRP1, POLR1C, POLR2E, POLR2H, POLR2L, SUPT16H, SIRT7, ERCC6, UBTF, MYBBP1A, SMARCA5, ARRB1, ARRB2, POLR1D, POLR3A, INO80, LGR4, REL, TCF4, ENO1, SHMT2, MOV10, NXF1, KAT2B, CCDC8, RNF2, GPN3, PIH1D1, TWISTNB, SCP2, SKAP1, LOC554223, GFOD1, FBXW11, EEF1A1, EEF1A2, POLR2B, POLR2F, POLR3B, RPS5, POLR3C, RPL10A, RPL9, TRIP10, SCARNA22, DIAPH2, PFDN2, POLR2K, SUPT6H, RUVBL1, URI1, TAF1C, TAF1B, PFDN6, RUVBL2, GPN1, L1TD1, ZNRD1, KIAA1522, NCKAP5L, PDRG1, WDR92, TCOF1, NOP58, KBTBD8, CSNK2A1, RECQL5, BRCA1, UXT, FAM46A, ASB7, LGALS13, SNX21, CDH5, SHPRH, ECDCTNNA2PAN2, PPP2R1A, FBXW11, CD27, UTP3, SAPCD1, CTNNB1, JUP, NTRK1, SDHAF2, GAN, MCM2, EGFR, CDH1, CDH8, CDH5, CTNNBIP1, DUSP22, FBXL5, CIR1, G3BP1, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for POLR1A_CTNNA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for POLR1A_CTNNA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePOLR1AC4225317ACROFACIAL DYSOSTOSIS, CINCINNATI TYPE1UNIPROT
TgeneCTNNA2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneCTNNA2C0036341Schizophrenia1PSYGENET
TgeneCTNNA2C0038356Stomach Neoplasms1CTD_human