FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2793

FusionGeneSummary for ARNTL_RIC8B

check button Fusion gene summary
Fusion gene informationFusion gene name: ARNTL_RIC8B
Fusion gene ID: 2793
HgeneTgene
Gene symbol

ARNTL

RIC8B

Gene ID

406

55188

Gene namearyl hydrocarbon receptor nuclear translocator likeRIC8 guanine nucleotide exchange factor B
SynonymsBMAL1|BMAL1c|JAP3|MOP3|PASD3|TIC|bHLHe5RIC8|hSyn
Cytomap

11p15.3

12q23.3

Type of geneprotein-codingprotein-coding
Descriptionaryl hydrocarbon receptor nuclear translocator-like protein 1ARNT-like protein 1, brain and musclePAS domain containing 3PAS domain-containing protein 3bHLH-PAS protein JAP3basic helix-loop-helix family member e5basic-helix-loop-helix-PAS orphan MOPsynembryn-Bbrain synembrinbrain synembrynresistance to inhibitors of cholinesterase 8 homolog B
Modification date2018051920180523
UniProtAcc

O00327

Q9NVN3

Ensembl transtripts involved in fusion geneENST00000396441, ENST00000389707, 
ENST00000401424, ENST00000389708, 
ENST00000361003, ENST00000403290, 
ENST00000403510, ENST00000403482, 
ENST00000497429, 
ENST00000392837, 
ENST00000392839, ENST00000355478, 
ENST00000549643, 
Fusion gene scores* DoF score4 X 6 X 5=1202 X 2 X 2=8
# samples 62
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: ARNTL [Title/Abstract] AND RIC8B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARNTL

GO:0032922

circadian regulation of gene expression

24005054

HgeneARNTL

GO:0045893

positive regulation of transcription, DNA-templated

11441146|12738229|23785138

HgeneARNTL

GO:0045944

positive regulation of transcription by RNA polymerase II

20093779

HgeneARNTL

GO:0051775

response to redox state

11441146

TgeneRIC8B

GO:0008277

regulation of G-protein coupled receptor protein signaling pathway

12652642


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A3LT-01AARNTLchr11

13381971

+RIC8Bchr12

107219504

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000396441ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000396441ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000396441ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000396441ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389707ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389707ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389707ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000389707ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000401424ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000401424ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000401424ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000401424ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389708ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389708ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000389708ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000389708ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000361003ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000361003ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000361003ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000361003ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403290ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403290ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403290ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000403290ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403510ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403510ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403510ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000403510ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403482ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403482ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
In-frameENST00000403482ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
5CDS-intronENST00000403482ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
3UTR-3CDSENST00000497429ENST00000392837ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
3UTR-3CDSENST00000497429ENST00000392839ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
3UTR-3CDSENST00000497429ENST00000355478ARNTLchr11

13381971

+RIC8Bchr12

107219504

+
3UTR-intronENST00000497429ENST00000549643ARNTLchr11

13381971

+RIC8Bchr12

107219504

+

Top

FusionProtFeatures for ARNTL_RIC8B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARNTL

O00327

RIC8B

Q9NVN3

Guanine nucleotide exchange factor (GEF), which canactivate some, but not all, G-alpha proteins by exchanging boundGDP for free GTP. Able to potentiate G(olf)-alpha-dependent cAMPaccumulation suggesting that it may be an important component forodorant signal transduction. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+91872_125153509DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+92072_125153626DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+81972_125153626DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+92072_125153627DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+31472_125151625DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918142_152153509MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+91836_41153509MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920142_152153626MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+92036_41153626MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819142_152153626MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+81936_41153626MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+92036_41110584MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920142_152153627MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+92036_41153627MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314142_152151625MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+31436_41151625MotifNuclear localization signal
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+92036_41110583MotifNuclear localization signal

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918143_215153509DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918326_396153509DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918401_444153509DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920143_215153626DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920326_396153626DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920401_444153626DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819143_215153626DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819326_396153626DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819401_444153626DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920143_215110584DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920326_396110584DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920401_444110584DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+92072_125110584DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920143_215153627DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920326_396153627DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920401_444153627DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314143_215151625DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314326_396151625DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314401_444151625DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920143_215110583DomainPAS 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920326_396110583DomainPAS 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920401_444110583DomainNote=PAC
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+92072_125110583DomainbHLH
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918361_369153509MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920361_369153626MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819361_369153626MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920142_152110584MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920361_369110584MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920361_369153627MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314361_369151625MotifNuclear export signal 2
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920142_152110583MotifNuclear export signal 1
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920361_369110583MotifNuclear export signal 2


Top

FusionGeneSequence for ARNTL_RIC8B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_467aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA
RGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEE

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_427aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_443aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_467aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA
RGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEE

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_427aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_443aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_424aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMP

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_384aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPKEELLKPMGLKPDG

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_400aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMP

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_467aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA
RGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEE

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_427aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_443aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_467aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA
RGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEE

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_427aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_443aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_467aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA
RGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEE

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_427aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_443aa
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNS
FIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKT
EELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLT
PVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAA

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_424aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMP

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_384aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPKEELLKPMGLKPDG

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_400aa
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYT
EANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEELHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPS
NKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRN
KLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARGLLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMP

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_465aa
MSKEAVSLWALTVSLQPPVPLCVCREMTGSGRRKQQCVTLPFISRELCFYLLLFPPPRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFI
DELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEE
LHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPV
LSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARG
LLAGGRGDNWYSEDEDTDTEEYKNAKPNINLITGHLEEPMPNPIDEMTEEQKEYEAMKLVNMLDKLSREELLKPMGLKPDGTITPLEEAL

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_425aa
MSKEAVSLWALTVSLQPPVPLCVCREMTGSGRRKQQCVTLPFISRELCFYLLLFPPPRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFI
DELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEE
LHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPV
LSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARG

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_441aa
MSKEAVSLWALTVSLQPPVPLCVCREMTGSGRRKQQCVTLPFISRELCFYLLLFPPPRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFI
DELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRSDSHQFRVMAAVLRHCLLIVGPTEDKTEE
LHSNAVNLLSNVPVSCLDVLICPLTHEETAQEATTLDELPSNKTAEKETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPV
LSLLTECSRAHRNIRKFLKDQVLPPLRDVTNRPEVGSTVRNKLVRLMTHVDLGVKQIAAEFLFVLCKERVDSLLKYTGYGNAAGLLAARG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1401nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1281nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1329nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1401nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1281nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1329nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1272nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCA
AACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTG
CTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCT

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1152nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGG

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1200nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCA
AACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGAT

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1401nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1281nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1329nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1401nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1281nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1329nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1401nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1281nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1329nt
ATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACC
AGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1272nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCA
AACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTG
CTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCT

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1152nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGG

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1200nt
ATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCA
AGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAAC
GCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACA
GAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCA
GCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAAT
GTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGT
AATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAAT
TTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCAT
CGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAAT
AAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGAT
AGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTAC
TCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCA
AACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGAT

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_1395nt
ATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGGATCA
GGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTTAGAA
TATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATA
GATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATG
AAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTC
AGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAG
CTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCC
CAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGT
ATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTT
CTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACA
AATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAA
TTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGC
CTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAAT
CTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTC
AACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTC

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_1275nt
ATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGGATCA
GGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTTAGAA
TATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATA
GATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATG
AAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTC
AGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAG
CTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCC
CAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGT
ATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTT
CTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACA
AATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAA
TTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGC
CTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGAG
TTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGC

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_1323nt
ATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGGATCA
GGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTTAGAA
TATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATA
GATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATG
AAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTC
AGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAG
CTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCC
CAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGT
ATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTT
CTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACA
AATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAA
TTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGC
CTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAAT
CTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5051nt
GGAAAGTAGGTTAGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCG
CCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCA
AGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATC
GCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAG
ACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTG
TGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAAT
ATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAG
ATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGA
AAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCA
GGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGC
TACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCC
AAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTA
TGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTC
TCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAA
ATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAAT
TCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCC
TCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATC
TTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCA
ACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCA
ACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTT
CTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCC
AGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCA
GAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGA
TCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAG
CAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTA
GCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTA
TGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTT
ATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCG
GGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGG
TGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAG
TTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAA
GGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTA
AAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTGCT
TAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATACATGG
GCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACAGGTAG
AGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAGGCCTT
TCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAACTGAAA
TTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGGCA
TACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGTCTACT
TACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGTTTTTT
TAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAGGGAGA
GGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTAAGTAT
TTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAAATGAA
GATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTGCT
TTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAGAG
TGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGTAACCT
CACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGGCCTGA
CTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGAGTGGT
GTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGACCT
GAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGACCAAGG
CTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGCTGCTG
CTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCCTTCTT
TATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACTAGGTG
TCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATTAATAA
TTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAATTTAT
TTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCAATAAATA

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2405nt
GGAAAGTAGGTTAGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCG
CCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCA
AGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATC
GCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAG
ACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTG
TGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAAT
ATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAG
ATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGA
AAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCA
GGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGC
TACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCC
AAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTA
TGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTC
TCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAA
ATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAAT
TCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCC
TCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGAGT
TGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCT
CTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTA
AAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTT
TGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAA
CTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTC
CCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGC
AAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAA
TATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATT
TCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCA

>In-frame_ARNTL_ENST00000396441_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3110nt
GGAAAGTAGGTTAGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCG
CCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCA
AGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATC
GCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAG
ACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTG
TGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAAT
ATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAG
ATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGA
AAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCA
GGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGC
TACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCC
AAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTA
TGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTC
TCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAA
ATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAAT
TCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCC
TCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATC
TTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCA
ACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCACTTAC
CAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACC
AGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTC
TGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGC
ATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAA
AAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCC
CTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAG
AAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCC
CCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGT
CAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATT
CCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGGGG
TGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGTGG
GGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGTTC
TACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAGGG
TGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAAAG
TTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTGCTTAA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5086nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTCCGATGTCATAGGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCT
GACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGG
TGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCAC
CGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGA
CACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGA
AAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAA
ACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTT
TCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACT
AATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGT
TCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAAC
AGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAA
GGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAA
AGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACA
TGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTA
TGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACAC
TGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGA
AGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACC
TGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCT
GCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCT
AGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGA
GCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCG
GCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTT
CTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCA
CCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTC
AGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGA
TGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCA
GCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTG
AGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTT
AAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAA
AAAGAAACACAATTAGTTACTGTTAAACTGATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCA
TGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACA
TACATTCATATATATACATATATACATAATGTGCTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATT
TGGCCATCTGTGTGTGTTTCTTTATAGATACATGGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATG
GTCCCACTTCTAATAGCCTTTTTAAGGACAGGTAGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAA
AGCAAAAAAATCAGGAATTACGTCTTAAAGGCCTTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGAT
CTTCAAGAATATCACTCTTAGACTCTGAACTGAAATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAAT
GGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGGCATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAA
AACTTCAAGACATAGCAAATCTGGGACTGTCTACTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGT
AGACTACTTCCTATAATGGTGACCCTGAGTTTTTTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATA
GATGTTAGAATTTCATCCAAAATGTTTGAGGGAGAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTT
AGATTAAGTGAAAAGTTTAGAAAAAATTTAAGTATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAA
TAGCTTTGGCATGCATGTCAGCTTACCTAAATGAAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTT
GAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTGCTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTT
TTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAGAGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACAT
GCTGGGCTTTTGATGTATGTTATCTCATGTAACCTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACG
TCACAGCAAGGAAGAGTCCAACTCTGGTGGCCTGACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCC
TCCTTAGGGCTCTGAAATGCTGGGAACAGAGTGGTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAAC
TAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGACCTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAG
ACCTGGAATCCGTTAGGATAGGCCAGGGACCAAGGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGA
GGCGTGTGTCCTAAAATAAAGCATTTGAGCTGCTGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTG
GGAGGCAGGCAGGGCAGGTGTTATTATCCCTTCTTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGT
GCCACATCAGTCTCGCCACCTCCCAGGACTAGGTGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTG
GAAAGTTTGGAAAATGCAGAAAATAAAATTAATAATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTT
CCTTCCTGTATTTTTTCTATGCATATATAATTTATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTT

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2440nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTCCGATGTCATAGGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCT
GACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGG
TGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCAC
CGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGA
CACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGA
AAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAA
ACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTT
TCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACT
AATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGT
TCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAAC
AGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAA
GGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAA
AGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACA
TGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTA
TGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACAC
TGAAGAATACAAAAATGCAAAACCAAAAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGC
ACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCAT
CTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAG
AATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAA
AAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGC
CAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTG
AGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAA
ACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGT
TTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCC
TATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTA

>In-frame_ARNTL_ENST00000389707_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3145nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTCCGATGTCATAGGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCT
GACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGG
TGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCAC
CGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGA
CACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGA
AAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAA
ACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTT
TCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACT
AATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGT
TCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAAC
AGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAA
GGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAA
AGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACA
TGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTA
TGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACAC
TGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGA
AGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGG
TGGTTAGCAACAGTGGCCCGTGCCAAAGCACTTACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGA
TGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCT
CAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGA
AACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCT
GCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCC
CTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTG
AATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCA
AATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGA
CTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGG
TTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCG
CATGGGGAGTGTGCATTCTGAGGTCTAACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGT
AATGGGAGTTCTTTCATGGCCTCTGCTTGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAA
TTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAA
GAAACACAATTAGTTACTGTTAAACTGATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGC
ACTAGACAGTGGGCCTAGCTCATCAGTGGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATAC

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5095nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCC
AGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCT
TCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGG
AAAGGCAGCTCCACTGACTACCAGTCGAATTTGGGGAGCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGA
AAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAG
TCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAA
ATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAA
ACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCA
TTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTG
TTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGA
GAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAG
AATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAA
ATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCT
CATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATA
CACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGA
CACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGA
AATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGG
ACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAA
GCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTT
GCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCAT
TCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTC
TATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAG
TGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGAT
CAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACA
CACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGT
TATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCA
TCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGG
GACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACA
TCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTT
ATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAA
AGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATAC
ACACGTACATACATTCATATATATACATATATACATAATGTGCTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTT
GATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATACATGGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTT
ACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACAGGTAGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCT
CTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAGGCCTTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTAT
GGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAACTGAAATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCA
CAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGGCATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGA
GAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGTCTACTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGT
ATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGTTTTTTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAG
AAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAGGGAGAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATT
CATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTAAGTATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCT
ATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAAATGAAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAG
TAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTGCTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTA
AGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAGAGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGC
TTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGTAACCTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGT
TACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGGCCTGACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCA
CACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGAGTGGTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTT
CAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGACCTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTT
CCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGACCAAGGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCA
GGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGCTGCTGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCA
GTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCCTTCTTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACAC
CCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACTAGGTGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATG
TTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATTAATAATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTT
AGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAATTTATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCT

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2449nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCC
AGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCT
TCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGG
AAAGGCAGCTCCACTGACTACCAGTCGAATTTGGGGAGCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGA
AAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAG
TCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAA
ATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAA
ACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCA
TTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTG
TTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGA
GAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAG
AATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAA
ATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCT
CATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATA
CACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGA
CACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTT
GGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTT
TATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTA
CTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTAC
GGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAAT
TCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAG
AGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCT
GCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATAC
TCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCT
ACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTC

>In-frame_ARNTL_ENST00000401424_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3154nt
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAG
TGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTG
GAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCC
AGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCT
TCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGG
AAAGGCAGCTCCACTGACTACCAGTCGAATTTGGGGAGCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGA
AAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAG
TCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAA
ATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAA
ACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCA
TTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTG
TTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGA
GAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAG
AATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAA
ATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCT
CATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATA
CACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGA
CACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGA
AATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCA
CCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCACTTACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACT
AAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCA
TCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCT
TTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCA
TACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTAT
AAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGG
CCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAG
AACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACAC
AGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTAT
AAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCT
GTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGAC
TCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCA
CATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATT
TAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGT
GAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACA
CGTACATACATTCATATATATACATATATACATAATGTGCTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGAT

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5053nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACT
CAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTT
TTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAAT
CCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAG
CAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAA
GATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGA
AGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACC
TAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTG
TATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTAT
TTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACC
CGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGG
GGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTG
AGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATA
AAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGC
TAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTG
CTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATACAT
GGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACAGGT
AGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAGGCC
TTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAACTGA
AATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGG
CATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGTCTA
CTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGTTTT
TTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAGGGA
GAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTAAGT
ATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAAATG
AAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTG
CTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAG
AGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGTAAC
CTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGGCCT
GACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGAGTG
GTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGAC
CTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGACCAA
GGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGCTGC
TGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCCTTC
TTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACTAGG
TGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATTAAT
AATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAATTT
ATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCAATAAA

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2407nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGA
GTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAG
CTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTC
TAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTT
TTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGG
AACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCT
TCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGG
GCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATA
AATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACA
TTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTAC

>In-frame_ARNTL_ENST00000389708_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3112nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCACTT
ACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAA
CCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTC
TCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCA
GCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAG
AAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGAT
CCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGC
AGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAG
CCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTAT
GTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTA
TTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGG
GGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGT
GGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGT
TCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAG
GGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAA
AGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTGCTT

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5053nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACT
CAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTT
TTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAAT
CCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAG
CAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAA
GATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGA
AGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACC
TAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTG
TATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTAT
TTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACC
CGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGG
GGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTG
AGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATA
AAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGC
TAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTG
CTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATACAT
GGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACAGGT
AGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAGGCC
TTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAACTGA
AATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGG
CATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGTCTA
CTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGTTTT
TTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAGGGA
GAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTAAGT
ATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAAATG
AAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTG
CTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAG
AGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGTAAC
CTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGGCCT
GACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGAGTG
GTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGAC
CTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGACCAA
GGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGCTGC
TGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCCTTC
TTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACTAGG
TGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATTAAT
AATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAATTT
ATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCAATAAA

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2407nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGA
GTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAG
CTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTC
TAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTT
TTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGG
AACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCT
TCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGG
GCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATA
AATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACA
TTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTAC

>In-frame_ARNTL_ENST00000361003_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3112nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCACTT
ACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAA
CCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTC
TCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCA
GCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAG
AAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGAT
CCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGC
AGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAG
CCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTAT
GTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTA
TTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGG
GGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGT
GGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGT
TCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAG
GGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAA
AGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTGCTT

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5053nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACT
CAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTT
TTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAAT
CCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAG
CAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAA
GATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGA
AGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACC
TAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTG
TATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTAT
TTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACC
CGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGG
GGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTG
AGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATA
AAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGC
TAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTG
CTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATACAT
GGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACAGGT
AGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAGGCC
TTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAACTGA
AATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGCAGG
CATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGTCTA
CTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGTTTT
TTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAGGGA
GAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTAAGT
ATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAAATG
AAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTTCTG
CTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGATGAG
AGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGTAAC
CTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGGCCT
GACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGAGTG
GTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGTGAC
CTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGACCAA
GGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGCTGC
TGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCCTTC
TTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACTAGG
TGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATTAAT
AATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAATTT
ATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCAATAAA

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2407nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGAGGA
GTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGACCAG
CTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTC
TAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTGTTT
TTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGATGG
AACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCT
TCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGG
GCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGTATA
AATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAATACA
TTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAGTAC

>In-frame_ARNTL_ENST00000403290_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3112nt
CGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCC
ACGGTGGTGCTGGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTCCGATGTCATA
GGAATCTACGCTAGAGGGCTTCCTGTGTGCCGGGCACTGTGGTTTTTGGAAGAAGCTGACCGCCTGAAAAGAAATTATAAAACATGAAAA
TCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAACTGTGACTTCAGATCATCCAATGGC
AGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCTTTCCAGCTCTCTTGGTACCAGTGG
TGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCAAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGGTTAGA
ATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTTTAT
AGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCACAT
GAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCATTCT
CAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGAAGA
GCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAACAGC
CCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAATGG
TATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCCAGT
TCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGTGAC
AAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGCTGA
ATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAGGGG
CCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACATTAA
TCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACTTGT
CAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCACTT
ACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAA
CCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTC
TCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCA
GCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAG
AAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGAT
CCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGC
AGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAG
CCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTAT
GTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTA
TTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACCCGG
GGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGGGGT
GGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTGAGT
TCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATAAAG
GGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGCTAA
AGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTGCTT

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_5058nt
GTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCT
GGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTG
AAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAAC
TGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCT
TTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCATTCACAGGTCGAATTTGGGGA
GCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAA
GCACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGC
ATCTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTG
AGAATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCT
AAAAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTT
GCCAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACG
TGAGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCAT
AAACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAA
GTTTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATG
CCTATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTC
TAACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTG
CTTGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGT
GTGTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAAC
TGATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCA
GTGGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATA
ATGTGCTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGA
TACATGGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGA
CAGGTAGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAA
AGGCCTTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGA
ACTGAAATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAG
GCAGGCATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACT
GTCTACTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGA
GTTTTTTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTG
AGGGAGAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATT
TAAGTATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCT
AAATGAAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTC
TTCTGCTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAG
ATGAGAGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCAT
GTAACCTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGT
GGCCTGACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACA
GAGTGGTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAA
GTGACCTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGG
ACCAAGGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGA
GCTGCTGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATC
CCTTCTTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGA
CTAGGTGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAA
TTAATAATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATAT
AATTTATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCA

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2412nt
GTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCT
GGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTG
AAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAAC
TGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCT
TTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCATTCACAGGTCGAATTTGGGGA
GCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAA
GAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAG
ACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTT
TTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTG
TGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGG
GATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCAT
GTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGC
CTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTT
GTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGA
ATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACT

>In-frame_ARNTL_ENST00000403510_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_3117nt
GTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGTGGTGCT
GGCTAGAGTGTATACGTTTGGACCCAAGCTTAACTTTTCCAATGTGGAATCCTGGGCCTTCATTGGTTTTTGGAAGAAGCTGACCGCCTG
AAAAGAAATTATAAAACATGAAAATCGCTTTGAGGTGACCAAGTCCAGAGGCCCCTAACTCCTCCCAAGCTGGATCTGGGGTGTAAGAAC
TGTGACTTCAGATCATCCAATGGCAGACCAGAGAATGGACATTTCTTCAACCATCAGTGATTTCATGTCCCCGGGCCCCACCGACCTGCT
TTCCAGCTCTCTTGGTACCAGTGGTGTGGATTGCAACCGCAAACGGAAAGGCAGCTCCACTGACTACCATTCACAGGTCGAATTTGGGGA
GCACAATGGCTGGAGGTCAGATGCCCACTAGGAGATGCTATGATTAATATAGAAAGCATGGACACAGACAAAGATGACCCTCATGGAAGG
TTAGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGT
TTTATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAG
CACATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTC
ATTCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACA
GAAGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAA
ACAGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATAC
AATGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACT
CCAGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGAT
GTGACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCT
GCTGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCC
AGGGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAC
ATTAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAA
CTTGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAG
CACTTACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCA
CTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATC
TTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGA
ATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAA
AGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCC
AAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGA
GAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAA
CCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTT
TGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCT
ATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAA
CCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTT
GGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTG
TGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGA
TAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTG
GCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATG

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392837_chr12_107219504_+_4696nt
GGAGATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGG
ATCAGGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTT
AGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTT
TATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCA
CATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCAT
TCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGA
AGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAAC
AGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAA
TGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCC
AGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGT
GACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGC
TGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAG
GGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACAT
TAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACT
TGTCAACATGCTTGATAAACTTTCCAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGC
ACTCAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCAT
CTTTTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAG
AATCCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAA
AAGCAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGC
CAAGATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTG
AGAAGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAA
ACCTAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGT
TTGTATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCC
TATTTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTA
ACCCGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCT
TGGGGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGT
GTGAGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTG
ATAAAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGT
GGCTAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAAT
GTGCTTAACCACTGCCTTTTAAAACTTTAAATTAAATAAAACATTGGGGTTGATTCAATTTGGCCATCTGTGTGTGTTTCTTTATAGATA
CATGGGCTAAACAATACTATTTCACAGTTTATGCTTTTTTAAAGTGCTTTTACATCCATGGTCCCACTTCTAATAGCCTTTTTAAGGACA
GGTAGAGTACATGGAGGGTTACTGAAAAGGTCATTTATCCAGAAGTTACCTCTCTGGCAAAGCAAAAAAATCAGGAATTACGTCTTAAAG
GCCTTTCAGCTGCCAGAGGAGATGTCACAAAGTTTCTTGCAACTTACTTATGGGAGAGATCTTCAAGAATATCACTCTTAGACTCTGAAC
TGAAATTTGCATACGCTTCCAACATGTTTTATTAGCTGGCTTTGAAGCTCACAAAAGAATGGCAAAGAAAGAGGCTGCTAGATTGAAGGC
AGGCATACTGAAAGAAGAAAAAGGCCAACTGAAAACTAGATAGTGAGATGAGAAGAATAAAACTTCAAGACATAGCAAATCTGGGACTGT
CTACTTACCAAAGGATACTCTAGTTGACCCAGAAAATGTGTGTACAACAGTATGGCCCGTAGACTACTTCCTATAATGGTGACCCTGAGT
TTTTTTAAAAGAAGAAATTAAATCCAGAACGCTTTATAAAAGGGTAGGAAGAAGACAATAGATGTTAGAATTTCATCCAAAATGTTTGAG
GGAGAGGTGAGTGACCCAGGTTTTAACCAACAGCAAAAGAAATGGGCAATTCATAATTTTAGATTAAGTGAAAAGTTTAGAAAAAATTTA
AGTATTTTTGTTATTCTACAAATGCATTTTTAAAGTATTTTTATAATTTCTATAATCAAATAGCTTTGGCATGCATGTCAGCTTACCTAA
ATGAAGATGTGTTTAATGAAATGCCATCTTACCAGCTTTCTTTATGCAGAGTAAGTGTTTGAACAGTCCTGTTTCAGTAGCTGTGCTCTT
CTGCTTTCAGTGAGTTCTGTTTCATTTTGCATTTCTCTGCACTGGGCACTAAGCTTTGTTTTTGAAAAGAGAGTTTGCGGGGAAGAAGAT
GAGAGTGTCTTCATCTGGCACACAGAAAGAGAACTAATATCTGTTAAGTGCTTACTACATGCTGGGCTTTTGATGTATGTTATCTCATGT
AACCTCACCTTATCGCATATGAAAGATCCTCTCCAGAAAGCTTATGAAAGTTACCCCACGTCACAGCAAGGAAGAGTCCAACTCTGGTGG
CCTGACTCCCAGCACCACTCCTTCCTTTTCCCCACAGCACACCTGGGCCCACACTGTGCCTCCTTAGGGCTCTGAAATGCTGGGAACAGA
GTGGTGTGAGGAGGGTGGTCATTCTCAGGCCATTTTAAGCAATAACTATTTCAACAGAACTAGTTTAAAGAGGTTTTTAAGCAGGGAAGT
GACCTGAAGTGGAAGTATGAGTGGGAAACTTGCATGGTCAGCACTGGATTTCCAATGAAGACCTGGAATCCGTTAGGATAGGCCAGGGAC
CAAGGCTGCAGGCTGGCCTCTCTGCCCACAACTCTCCTGACCTTGGAAGCAGGGTACGGAGGCGTGTGTCCTAAAATAAAGCATTTGAGC
TGCTGCTACAGAGGAACAATCACCAGATATTGTGACCCTTTCAGATGCCCAGTAGTCCTGGGAGGCAGGCAGGGCAGGTGTTATTATCCC
TTCTTTATAAATGAGGACACAGAATGAGGCAGTACAAGTGACTCTAAACACCCCCTTAGTGCCACATCAGTCTCGCCACCTCCCAGGACT
AGGTGTCACCTGTATTGACCTCTTCCCCTCTGATTATAAAAGTAATATATGTTCATTGTGGAAAGTTTGGAAAATGCAGAAAATAAAATT
AATAATTTACCCCAAATCCCACCATCCTGAGATCATCACTGTTAATGTTTTAGTGTATTTCCTTCCTGTATTTTTTCTATGCATATATAA
TTTATTTTACTACAAGATTGGGATCATGCTGTATTTACAGATTTGTATCCTGCTTTCTTTAACATATTGTGAGCATTTTCCCATGTCAAT

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000392839_chr12_107219504_+_2050nt
GGAGATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGG
ATCAGGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTT
AGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTT
TATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCA
CATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCAT
TCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGA
AGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAAC
AGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAA
TGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCC
AGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGT
GACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGC
TGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAG
GGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAAAGA
GGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACTCAACCAGTACTCTGTCATCGAAGAGAC
CAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTTTTCTCTGTAGCTCCAGGGGAATCTTTT
CTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAATCCAGCATATTTAAGAGGTGACCCTGTG
TTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAGCAGAAAAAAAATTCCATTTCATCGGGA
TGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAAGATCCCTAGCAGAAGATTTAGCCATGT
CCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGAAGCAGAAAGAGCTGGTAAATAAAGCCT
TGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACCTAGCCCCATTCTTCATATCAATTTTGT
ATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTGTATGTCAGTTAGCTAAAACTTCAGAAT
ACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTATTTATTCCCTAATGTACCTGAACACTAG

>In-frame_ARNTL_ENST00000403482_chr11_13381971_+_RIC8B_ENST00000355478_chr12_107219504_+_2755nt
GGAGATGAGCAAGGAGGCCGTGAGCCTGTGGGCGCTCACTGTGTCCCTCCAACCCCCAGTCCCCTTGTGTGTCTGCAGAGAGATGACAGG
ATCAGGCAGAAGAAAACAGCAATGTGTAACTTTGCCATTCATCTCCAGAGAATTATGTTTTTATCTTTTGCTTTTTCCTCCCCCCAGGTT
AGAATATACAGAACACCAAGGAAGGATAAAAAATGCAAGGGAAGCTCACAGTCAGATTGAAAAGCGGCGTCGGGATAAAATGAACAGTTT
TATAGATGAATTGGCTTCTTTGGTACCAACATGCAACGCAATGTCCAGGAAATTAGATAAACTTACTGTGCTAAGGATGGCTGTTCAGCA
CATGAAAACATTAAGAGGTGCCACCAATCCATACACAGAAGCAAACTACAAACCAACTTTTCTATCAGACGATGAATTGAAACACCTCAT
TCTCAGGAGTGATTCTCATCAGTTCCGTGTAATGGCAGCTGTCCTTCGTCATTGTTTACTAATCGTAGGTCCAACTGAAGACAAAACAGA
AGAGCTACACAGCAATGCAGTCAACCTTTTAAGCAATGTTCCAGTCTCTTGTTTGGATGTTCTCATTTGTCCGTTAACCCATGAAGAAAC
AGCCCAAGAGGCAACGACTCTAGATGAACTGCCCAGTAATAAAACAGCTGAGAAAGAAACAGTTTTGAAAAACAATACCATGGTATACAA
TGGTATGAATATGGAGGCCATTCATGTTTTACTGAATTTTATGGAGAAGAGAATAGACAAGGGAAGCAGCTATAGAGAGGGTCTAACTCC
AGTTCTCAGCTTATTAACCGAATGTTCCCGAGCCCATCGAAACATCCGAAAATTTCTCAAAGATCAGGTTTTACCACCGTTGAGGGATGT
GACAAATCGACCTGAAGTTGGCTCAACTGTGAGAAATAAGCTGGTGCGCCTCATGACACATGTTGACCTTGGAGTCAAGCAAATTGCTGC
TGAATTCCTTTTTGTCCTTTGCAAAGAGAGAGTGGATAGTCTGCTGAAATACACTGGCTATGGGAATGCTGCAGGACTGTTGGCGGCCAG
GGGCCTCTTGGCTGGAGGAAGAGGAGATAATTGGTACTCAGAGGATGAGGACACAGACACTGAAGAATACAAAAATGCAAAACCAAACAT
TAATCTTATCACTGGTCATTTAGAGGAACCAATGCCAAACCCCATAGATGAAATGACAGAAGAACAAAAAGAATATGAAGCCATGAAACT
TGTCAACATGCTTGATAAACTTTCCAGGAGAGCAGATGTGAAGGACCTGCACCAGGATGGTGGTTAGCAACAGTGGCCCGTGCCAAAGCA
CTTACCAAAGTGATGATGACTAAGAGAGGAGTTGCTTAAACCAATGGGACTAAAACCTGATGGGACAATAACGCCTTTGGAGGAAGCACT
CAACCAGTACTCTGTCATCGAAGAGACCAGCTCTGACACAGACTAAAAGCATCACCTGCTCAACTCTCAATATTGCTTTATCAGCATCTT
TTCTCTGTAGCTCCAGGGGAATCTTTTCTCTAAAACATTTATGCCCTTGCTTTGGCTAGAAACACATTAACTGGTTTACTCATTGAGAAT
CCAGCATATTTAAGAGGTGACCCTGTGTTTTTTGTGATATTGAGGCATTCATACAGAGCTGCAGTTAGACGGGGTTACGGGGGCTAAAAG
CAGAAAAAAAATTCCATTTCATCGGGATGGAACTGAAGGATTTTATTCTATAAAGCGGCCCTGGTTGAATCTGGCAATTCTTTTTGCCAA
GATCCCTAGCAGAAGATTTAGCCATGTCCTTCCCCTCACTTGTGTGAGTGGCCCCTTCTGAATCTCTCCAGCAGCCAGAGGCACGTGAGA
AGCAGAAAGAGCTGGTAAATAAAGCCTTGGGCAAGCGACTTCTTAGATCAGAACTCACCAAATGGAAGCCTAGCAGCTGCTCCATAAACC
TAGCCCCATTCTTCATATCAATTTTGTATAAATATATAGAAACACACACACAGCCTCAGACTTACAAACTGATTATACTCTAAAAGTTTG
TATGTCAGTTAGCTAAAACTTCAGAATACATTTCTCCCTATAAAGAGTTATAAATGATGGTTTAGTTCTCAGGCAGCTACAAATGCCTAT
TTATTCCCTAATGTACCTGAACACTAGTACCATAGAACTGAACCACCATCTGTATCAGCGCATGGGGAGTGTGCATTCTGAGGTCTAACC
CGGGGTGCCAGGAACACACACATCCTCCATCCCAGCATAGAGAATGGGGACTCCCTGAGTAATGGGAGTTCTTTCATGGCCTCTGCTTGG
GGTGGGGGAGTCAGCAGCACCCATTTGTACATATAGGTCATTCATACATCACATTTTAAATTGGGGACTGTGTGTGCTGGTGTGTGTGTG
AGTTCTACGTTTCTACCATATGTGATCAGTTTAATAGTAACTTTATTTATTTAAAAAAAAGAAACACAATTAGTTACTGTTAAACTGATA
AAGGGTGTTTATTTTTACTTTTAGAATTGGTCCTATGAAGAAGTAGAAAGTGAGTCATGCACTAGACAGTGGGCCTAGCTCATCAGTGGC
TAAAGTTGAAAAGGGGTTGGTTTCCTGTATATATATGTATGTATATACACACGTACATACATTCATATATATACATATATACATAATGTG


Top

FusionGenePPI for ARNTL_RIC8B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARNTLNPAS4, CRY1, CLOCK, EP300, KAT2B, CSNK1E, NPAS2, RXRA, RARA, AHR, HSP90AA1, EPAS1, HIF1A, SIRT1, DYRK1B, UBE3A, CRY2, CSNK2B, DEC1, WDR5, RORC, PPP1CA, RHOU, CREBBP, BCAM, ARNTL2, LRFN4, MAX, RPRD1A, HAUS6, PHLDB3, PTRF, PHF21A, OIP5, CCDC93, CCDC132, HMG20A, RCOR1, GRIPAP1, DZIP3, VPS53, PSMD9, RABGAP1L, GOLGA5, TUFT1, YEATS4, CCHCR1, TFPT, NCKAP5L, PKN3, GIT2, KDM1A, NUF2, THAP11, RABGEF1, JUN, VPS51RIC8BLRP1, GNAI2, PPARD, TFDP3, NAP1L1, RASL10A, CHIA, TUBAL3, CASQ2, ACTL6A, CAMKMT, THBS3, GNAS, GNAQ, XPO1, MAGED2, UBE2O, INTU, ENSA, TIGD5, AARSD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneARNTLchr11:13381971chr12:107219504ENST00000361003+918508_588153509CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000389707+920508_588153626CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000396441+819508_588153626CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000401424+920508_588110584CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000403290+920508_588153627CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000403482+314508_588151625CIART
HgeneARNTLchr11:13381971chr12:107219504ENST00000403510+920508_588110583CIART


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARNTL_RIC8B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARNTL_RIC8B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARNTLC0005586Bipolar Disorder5PSYGENET
HgeneARNTLC0011570Mental Depression3PSYGENET
HgeneARNTLC0011581Depressive disorder3PSYGENET
HgeneARNTLC0525045Mood Disorders2PSYGENET
HgeneARNTLC0021361Female infertility1CTD_human
HgeneARNTLC0023473Myeloid Leukemia, Chronic1CTD_human
HgeneARNTLC0085159Seasonal Affective Disorder1PSYGENET
HgeneARNTLC0151744Myocardial Ischemia1CTD_human