FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27815

FusionGeneSummary for PMVK_FNBP1

check button Fusion gene summary
Fusion gene informationFusion gene name: PMVK_FNBP1
Fusion gene ID: 27815
HgeneTgene
Gene symbol

PMVK

FNBP1

Gene ID

10654

23048

Gene namephosphomevalonate kinaseformin binding protein 1
SynonymsHUMPMKI|PMK|PMKA|PMKASE|POROK1FBP17
Cytomap

1q21.3

9q34.11

Type of geneprotein-codingprotein-coding
Descriptionphosphomevalonate kinasetestis tissue sperm-binding protein Li 95mPformin-binding protein 1formin-binding protein 17
Modification date2018052320180529
UniProtAcc

Q15126

Q96RU3

Ensembl transtripts involved in fusion geneENST00000368467, ENST00000446176, 
ENST00000420781, ENST00000355681, 
ENST00000443566, ENST00000478129, 
Fusion gene scores* DoF score5 X 4 X 4=808 X 10 X 3=240
# samples 514
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/240*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PMVK [Title/Abstract] AND FNBP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePMVK

GO:0006695

cholesterol biosynthetic process

8663599

HgenePMVK

GO:0016126

sterol biosynthetic process

16519518


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-CC-5263-01APMVKchr1

154909067

-FNBP1chr9

132691974

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368467ENST00000446176PMVKchr1

154909067

-FNBP1chr9

132691974

-
In-frameENST00000368467ENST00000420781PMVKchr1

154909067

-FNBP1chr9

132691974

-
In-frameENST00000368467ENST00000355681PMVKchr1

154909067

-FNBP1chr9

132691974

-
5CDS-intronENST00000368467ENST00000443566PMVKchr1

154909067

-FNBP1chr9

132691974

-
5CDS-intronENST00000368467ENST00000478129PMVKchr1

154909067

-FNBP1chr9

132691974

-

Top

FusionProtFeatures for PMVK_FNBP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PMVK

Q15126

FNBP1

Q96RU3


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePMVKchr1:154909067chr9:132691974ENST00000368467-1517_2331193Nucleotide bindingATP
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516398_490171593Coiled coilOntology_term=ECO:0000250
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517398_490171618Coiled coilOntology_term=ECO:0000250
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516340_345171593Compositional biasNote=Poly-Pro
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517340_345171618Compositional biasNote=Poly-Pro
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516404_481171593DomainREM-1
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516550_611171593DomainSH3
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517404_481171618DomainREM-1
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517550_611171618DomainSH3
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516251_617171593RegionNote=Required for self-association and induction of membrane tubulation
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517251_617171618RegionNote=Required for self-association and induction of membrane tubulation

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-51667_259171593Coiled coilOntology_term=ECO:0000269
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-51767_259171618Coiled coilOntology_term=ECO:0000269
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-5161_264171593DomainF-BAR
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-5171_264171618DomainF-BAR
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-5161_79171593RegionNote=Required for self-association and induction of membrane tubulation
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-5171_79171618RegionNote=Required for self-association and induction of membrane tubulation


Top

FusionGeneSequence for PMVK_FNBP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000446176_chr9_132691974_-_478aa
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRPDNKLKYVTKWQRTAKQITHPFSRNSTMSSMNITILTSPTSSRKYKRWRKGGL_EWES
P_RHMQRLIGR_SQSLGSAWME__KQPNQLIRKMIHSW__KLINQGLSLLETLNLRITLSQ_SALCQITAFQIPEEKANQTSNLVANPKE
STGRSSKKISLCPF_HPPISLPLPLLPLPHPLLFPTAPSLPSSKRNPSPIASTSS_PPNPKSTASGA_SVGFLSSWVQHRRISATSHLNK
EGKSCSRKSMS_IKKFRRRWIKEMP_QK_KMST_RILRWETQPVWITN_QKSAKI_RNCE_RPRNLRPGWLRLKAGSQHAASRRAGRADC
TTARTHPQSTTAPRTVRAQMAVTQRSRVRRVR_RCWPRILTTSLMMRSPSLP_GRAKLSTHLKVRMKERFP_LKEKHCMS_RKTKAMAGP

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000420781_chr9_132691974_-_469aa
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRPDNKLKYVTKWQRTAKQITHPFSRNSTMSSMNITILTSPTSSRKYKRWRKGGL_EWES
P_RHMQRLIGR_SQSLGSAWME__KQPNQLIRKMIHSW__KLINQGLSLLETLNLRITLSQ_SALCQITAFQIPEEKANQTSNLVANPKE
STGRSSKKISLPLPLLPLPHPLLFPTAPSLPSSKRNPSPIASTSS_PPNPKSTASGA_SVGIASLCRVQHRRISATSHLNKEGKSCSRKS
MS_IKKFRRRWIKEMP_QK_KMST_RILRWETQPVWITN_QKSAKI_RNCE_RPRNLRPGWLRLKAGSQHAASRRAGRADCTTARTHPQS
TTAPRTVRAQMAVTQRSRVRRVR_RCWPRILTTSLMMRSPSLP_GRAKLSTHLKVRMKERFP_LKEKHCMS_RKTKAMAGPAFGEMKMKR

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000355681_chr9_132691974_-_453aa
MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRPDNKLKYVTKWQRTAKQITHPFSRNSTMSSMNITILTSPTSSRKYKRWRKGGL_EWES
P_RHMQRLIGR_SQSLGSAWME__KQPNQLIRKMIHSW__KLINQGLSLLETLNLRITLSQ_SALCQITAFQIPEEKANQTSNLVANPKE
STGRSSKKISLPSSKRNPSPIASTSS_PPNPKSTASGA_SVGFLSSWVQHRRISATSHLNKEGKSCSRKSMS_IKKFRRRWIKEMP_QK_
KMST_RILRWETQPVWITN_QKSAKI_RNCE_RPRNLRPGWLRLKAGSQHAASRRAGRADCTTARTHPQSTTAPRTVRAQMAVTQRSRVR
RVR_RCWPRILTTSLMMRSPSLP_GRAKLSTHLKVRMKERFP_LKEKHCMS_RKTKAMAGPAFGEMKMKRVMSPLHMSKSVWTKMPKVLR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000446176_chr9_132691974_-_1436nt
ATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGGAAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAG
AGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGCTTATGTCCCTTTTAACATCCCCCCATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCAC
CCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCA
AAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAA
GAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAG
ATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAG
TAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGT
ACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGA
GTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACA
CATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCC

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000420781_chr9_132691974_-_1409nt
ATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGGAAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAG
AGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTC
CCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTG
GGCATAGCCTCACTCTGCAGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCG
ATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGG
GAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGC
TGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCA
ACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATT
TTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGA
TTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGG

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000355681_chr9_132691974_-_1361nt
ATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGGAAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAG
AGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAGCAGATTACTCATCCATTCTCCAGAAATTCAACCATG
AGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAGAGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGT
CCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGTGCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTG
ATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGCCTCCTGGAGACATTGAATTTGAGGATTACACTCAGC
CAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCAAACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAA
AGTTATGGCCGTTCATCAAAAAAAATAAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCAAAC
CCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAACACCGGAGGATTTCAGCAACCTCCCACCTGAAC
AAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAAAAATGA
AAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGC
GAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGAC
TGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGG
AGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCT
ACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGA
CCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGGTGCTAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000446176_chr9_132691974_-_5094nt
GAAGGTTCTGGGCGGGGCTGGACTGTTCTAAGTGAGTTCGGGTGGGGGAGCTTCACGAGGGGAGGCTGCTCTGTGAAGGAACCGCCTTTC
TCTCCGCGTGTCTCACCCTTTTCTCCCCATATCTGTTTGGACATGAGCTGAGGGCACGGTCGCGGGCGGTCAGCCCTGTTCGCAGCTACG
GCGAGGAGGGGCGCGATTGTTCCTTGTTGCCGCTCCGCTTAGTGGCCGCGTCCATTCCGCGCGGTGTCCCGATTTTAGGGGTAGGGAGAA
GTGTCAGCTTCAGGCATCGCGAGGCGTGGCGGCCCCATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGG
AAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAGAGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAG
CAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAG
AGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGT
GCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGC
CTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCA
AACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCTTATGTCCCTTTTAACATCCCCCC
ATCAGCCTCCCCCTCCCCCTCCTGCCTCTGCCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCT
CCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTGCAA
CACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGG
AGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAAT
TAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAG
CACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCC
CAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGC
CCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGT
ATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAG
TCTGTTTGGACAAAAATGCCAAAGATTCCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTT
CCCACAGGCCTCCAGCGCCCTGCCCTGTGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGC
TCCCTGCGGCCCTGCCCTCCCGCCCAGCCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCT
CATCGCTCCCCCTCCCCACCCCGCGCAGGCCACTGAGACGGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGG
GCTCGTCCTGGCAGCCCTTCCGCGCTTCACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCG
CACATCAGGCGGACTGAGCACTCGATGTCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCT
CCTGAGTCTGTGAAGTCCTCAGTGGTCCTTTTTGGATTCTAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCT
GGGAGCATCTGGCAGGCAGGGGGGCAGGTACACACACACCCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTT
TGACGCCCTGTTTTCAGTGGCCTGGGGAGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATG
AGGAGCCCACGCCTGTCCTCCCCATCACTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAG
CTCATTGCAAAGCGAACATCCTCTCCTTTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTT
TTTTTTTTTTGAGACGGGAGTCTCGCTCTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGT
TCCAGCGATTCTCCTGCCTCAGCCTCCCAAATAGCTGTGATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAG
ACAGGGTTTCACCGTGTTGGTCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACA
GGTGTGAGCTACCGCACCCCGCCGAGGTTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCAC
CACCCTTGTATTTTATCACGTGCTCTTCAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTT
TGAGGAAAACCTGAGGTCCCCTAATCTGTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTG
CAGAAACAGTCAAGAGGAACCATTGGCCTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCT
TTGCTTGGCTTTGGTAACTAGGTGGTCCCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAG
CCAAAGGGACAGGGACGGAAAGGACAGGTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCA
AGGTTGACCACACACCACCCTTCCGGAGCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGG
TGAAGAGGAAGTGGCTTTGGGTTTTTAAAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGG
GTTGCGGCAGAGCCATGGACTTCCGGTCCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAG
ACGAAAGACAAGCCCGGATGACACAGGGTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCA
GTCCCCACAGCTCCACAATGGGCTCCCCCGCCAACGGGGACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACT
CTCCACTCCACGAGGATGTGAAACGGTTCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGT
CAGGATAGATTCATTTCTTGCAACATAGTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATA
TGCTTGTATCCCCCCGTCACTCCTCCGCCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAA
TGTTGAACCTGGGTGTTGCTTCCGGGCCAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAG
TTGTCCTATGTATCATCATTTACTCTGGGAATCCTACTGTGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGG
AATTTCCCGTGAACGTCTCCTTCCTCCCCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTA
ATTTTAAAAGAACCTGCCCTGAAAAGTTCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGG
AAAGTATAAAAAGGCACAGAAGGTTGTCATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTA
ACCAGCGCAGCGCAAAGGTCTCGATGCCTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGC
TAAGTGTTTTTCCAGAAATATTGGTTTCATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCA
GAATTCTATTTTAACCTGATGTTGAGCACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTG
AGGCCGATCGCCACTGTAAAGGTCCTAGAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTG

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000420781_chr9_132691974_-_5067nt
GAAGGTTCTGGGCGGGGCTGGACTGTTCTAAGTGAGTTCGGGTGGGGGAGCTTCACGAGGGGAGGCTGCTCTGTGAAGGAACCGCCTTTC
TCTCCGCGTGTCTCACCCTTTTCTCCCCATATCTGTTTGGACATGAGCTGAGGGCACGGTCGCGGGCGGTCAGCCCTGTTCGCAGCTACG
GCGAGGAGGGGCGCGATTGTTCCTTGTTGCCGCTCCGCTTAGTGGCCGCGTCCATTCCGCGCGGTGTCCCGATTTTAGGGGTAGGGAGAA
GTGTCAGCTTCAGGCATCGCGAGGCGTGGCGGCCCCATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGG
AAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAGAGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAG
CAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAG
AGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGT
GCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGC
CTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCA
AACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGCCTCCCCCTCCCCCTCCTGCCTCTG
CCTCACCCTCTGCTGTTCCCAACGGCCCCCAGTCTCCCAAGCAGCAAAAGGAACCCCTCTCCCATCGCTTCAACGAGTTCATGACCTCCA
AACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCATAGCCTCACTCTGCAGGGTGCAACACCGGAGGATTTCAGCAACCTCCCAC
CTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGAAGGAGATGGATCAAAGAGATGCCATAACAA
AAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACAAATTAGCAGAAGTCAGCCAAAATATAGAGA
AACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCCCAGCACGCAGCGAGCAGGCGCGCCGGCAGA
GCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGAGCCCAGATGGCAGTTACACAGAGGAGCAGA
GTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGGAGCCCCTCCCTGCCATAGGGACGTGCAAAG
CTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACATTGTATGTCATAGAGGAAGACAAAGGCGATG
GCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCGAAGTCTGTTTGGACAAAAATGCCAAAGATT
CCTAGAGGGGAGTGCCTGCGAGCCTCGGGTGAGCCTTCCTGGAGGAGCCTCCGTCTGCTTGTTCCCACAGGCCTCCAGCGCCCTGCCCTG
TGGACAGCCCACCCCTCCGCAGCCCCATCCCTGCGGGGCGGTCTCTCTCTCTCTCCAGCATGCTCCCTGCGGCCCTGCCCTCCCGCCCAG
CCCGGGCCACCTCGTGGGGGACAAGTCTCGCCAGCGCCCACCCCCATGGCTCGGGTCAGTCCTCATCGCTCCCCCTCCCCACCCCGCGCA
GGCCACTGAGACGGTGGGACACACGCCCCTACCTGCTCCTTCCTGGGCCCTCAGTCCACCCGGGCTCGTCCTGGCAGCCCTTCCGCGCTT
CACACAGTGCCTTTTGTGAAAGTGTCATCACGGGTCCCCTGAGGAGACAAGGCAGGTCCAGCGCACATCAGGCGGACTGAGCACTCGATG
TCATCCGTGTCGATGTCATCCGTGTGTCCCAGACTGTCTGCTGTAGAAAACACTTCCTCCTCTCCTGAGTCTGTGAAGTCCTCAGTGGTC
CTTTTTGGATTCTAGGCTTGCACCTCATACTAAACATTGACCCTTTCACTATGCCCTCAACCTGGGAGCATCTGGCAGGCAGGGGGGCAG
GTACACACACACCCACAGGCACACCCACCAGTACACACGCGTGCGCATACACACATTTTGGTTTGACGCCCTGTTTTCAGTGGCCTGGGG
AGGTCCACACTGGAAGTCGAATTCCAGCTCGCCTTGTTGACTCGCCTGTGTCCACCGGCCATGAGGAGCCCACGCCTGTCCTCCCCATCA
CTTTCCTGTCCCTGAGAACTGTAGATCATGCGCTTGTGAGCGAGGCCCTCCCCTCTGCACCAGCTCATTGCAAAGCGAACATCCTCTCCT
TTCCAGGAGCCCCAGGATTAGCATCTGAAAAGGGTAGCACTTCCTTTTTTGTTGTTGTTTTTTTTTTTTTTTTGAGACGGGAGTCTCGCT
CTATTGTTCAGACTGGAGTGCAGTGGCATGATCTCGGCTCACTACAACCTCCACCTCCTGGGTTCCAGCGATTCTCCTGCCTCAGCCTCC
CAAATAGCTGTGATTACAGGCGTGCACCACCACGCCCGGCTAATGTTTGTATTTTTAGTAGAGACAGGGTTTCACCGTGTTGGTCAGGCT
GGTCTCAAACTCCTGACCTCAGGTGATCCGCCCGCCTCAGCCTCCCAAAGTGCTGAGATTACAGGTGTGAGCTACCGCACCCCGCCGAGG
TTAGCACTTTCATCACCAAAGACCCCGTGCCTCTCGTGGTCCTTTGAGGGATCCCGCCGCCACCACCCTTGTATTTTATCACGTGCTCTT
CAGGGCATGTGGAATTCGTTGAGTTTGCTTTTAGAGCCAAGTTTCTTTCCCTGTGTGGGTTTTTGAGGAAAACCTGAGGTCCCCTAATCT
GTGGCCACCACCCCCCCCCCCCGCCACGCCTTAGAGCAGAGCAGCCCCTCCTCTCATTTGGTGCAGAAACAGTCAAGAGGAACCATTGGC
CTAGAGCTCCTGTGACCGAGAGCGCCACGGAAGCCTGGGGATGACGTCGGGCAGCTTTATTCTTTGCTTGGCTTTGGTAACTAGGTGGTC
CCCTCAAGCATCCTCAGTTCCTCTTGCTGTTTATGAATCTAAGACAAGGAAGTCCTATAGAAGCCAAAGGGACAGGGACGGAAAGGACAG
GTCCCAAGGGATGGGGCTGTCTTTACTTGTGGAAACCAGGAAATTGCTCCTCTCAGCCAACCAAGGTTGACCACACACCACCCTTCCGGA
GCAGCTCAGTCAGCCCTCGGGGACGAGAAACCACAAGCGCAGAGACGCTGAGGCCCAGGCAGGTGAAGAGGAAGTGGCTTTGGGTTTTTA
AAGTAGGTGAGCGTGAGCCTCTCTGACTGCTTCTTCCCCGGGGGGGACTGCAAACCGCTCAGGGTTGCGGCAGAGCCATGGACTTCCGGT
CCCTGCAACGGGTGACCTAAGCGTGGTGCACCCATCAGTCACGCAGGAGGACTGACTTGACAGACGAAAGACAAGCCCGGATGACACAGG
GTGAGAAGAGTCAGGGCCGCACCTCTGTCCCTGCAAACCAACAGGTGCATGGTGAGTGTGGCAGTCCCCACAGCTCCACAATGGGCTCCC
CCGCCAACGGGGACGACAGGGATCTTCAGGAACTTCTGACCTCACCAAGTCAAGTGGACCACTCTCCACTCCACGAGGATGTGAAACGGT
TCTTTAAAATGGGATTTTAGAGCCTCGGGAATGCATGTGCGTCACATCTTTCATATTATGGGTCAGGATAGATTCATTTCTTGCAACATA
GTGGAAAAGATATAAGCTGCAGTAATTTGCTCTTTGAATGACCGTCACCCCCAGTATAGGATATGCTTGTATCCCCCCGTCACTCCTCCG
CCTGTTTTTTAAACTTTTCCACCACCTGCGTCCAAAAAGAATGTTATAGCGAGTGCTCTTAAATGTTGAACCTGGGTGTTGCTTCCGGGC
CAGTCTGCGTGGCTCCATGAAAAGCTCACTGCTGCCCCAGCCGGGCTTCTTAGAGGAGGTCAGTTGTCCTATGTATCATCATTTACTCTG
GGAATCCTACTGTGAAATCATGTCTGTATTTTTCTGGAGCAGTTCACATAGAGTAGAATGTGGAATTTCCCGTGAACGTCTCCTTCCTCC
CCCGTATCTGCCGCCTGTCACTTCGCCACCGTGCTAGAATACTGTTGTGTTGTAAGATGACTAATTTTAAAAGAACCTGCCCTGAAAAGT
TCTTAGAAACGCAGTGAAAGGGAGGAACTTGTCCTTTACCCAGTTTTTCCTTTGTAGGATGGGAAAGTATAAAAAGGCACAGAAGGTTGT
CATGGGCTGTTCCTTGGGGGTTTTTATCCTGCTCACCGTGGAGATAAGCCTGCGGCTTGTCTAACCAGCGCAGCGCAAAGGTCTCGATGC
CTTTTGGTAACATCCGTCATTGCAGAAGAAAGTTTACACGACGTCAAAAAGTGACGTTCATGCTAAGTGTTTTTCCAGAAATATTGGTTT
CATGTTTCTTATTGGCTCTGCCTCCTGTGCTTATATCATCCAAAAACTTTTTAAAAAGGTCCAGAATTCTATTTTAACCTGATGTTGAGC
ACCTTTAAAATGTTCGTATGTGTGTTGCACTAATTCTAAACTTTGGAGGCATTTTGCTGTGTGAGGCCGATCGCCACTGTAAAGGTCCTA
GAGTTGCCTGTTTGTCTCTGGAGATGGAATTAAACCAAATAAAGAGCTTCCACTGGAGGCTTGTATTGACCTTGTAACTATATGTTAATC

>In-frame_PMVK_ENST00000368467_chr1_154909067_-_FNBP1_ENST00000355681_chr9_132691974_-_1673nt
GAAGGTTCTGGGCGGGGCTGGACTGTTCTAAGTGAGTTCGGGTGGGGGAGCTTCACGAGGGGAGGCTGCTCTGTGAAGGAACCGCCTTTC
TCTCCGCGTGTCTCACCCTTTTCTCCCCATATCTGTTTGGACATGAGCTGAGGGCACGGTCGCGGGCGGTCAGCCCTGTTCGCAGCTACG
GCGAGGAGGGGCGCGATTGTTCCTTGTTGCCGCTCCGCTTAGTGGCCGCGTCCATTCCGCGCGGTGTCCCGATTTTAGGGGTAGGGAGAA
GTGTCAGCTTCAGGCATCGCGAGGCGTGGCGGCCCCATGGCCCCGCTGGGAGGCGCCCCGCGGCTGGTACTGCTGTTCAGCGGCAAGAGG
AAATCCGGGAAGGACTTCGTGACCGAGGCGCTGCAGAGCAGGCCCGACAACAAGCTCAAATACGTCACCAAATGGCAGAGGACAGCAAAG
CAGATTACTCATCCATTCTCCAGAAATTCAACCATGAGCAGCATGAATATTACCATACTCACATCCCCAACATCTTCCAGAAAATACAAG
AGATGGAGGAAAGGAGGATTGTGAGAATGGGAGAGTCCATGAAGACATATGCAGAGGTTGATCGGCAGGTGATCCCAATCATTGGGAAGT
GCCTGGATGGAATAGTAAAAGCAGCCGAATCAATTGATCAGAAAAATGATTCACAGCTGGTAATAGAAGCTTATAAATCAGGGTTTGAGC
CTCCTGGAGACATTGAATTTGAGGATTACACTCAGCCAATGAAGCGCACTGTGTCAGATAACAGCCTTTCAAATTCCAGAGGAGAAGGCA
AACCAGACCTCAAATTTGGTGGCAAATCCAAAGGAAAGTTATGGCCGTTCATCAAAAAAAATAAGTCTCCCAAGCAGCAAAAGGAACCCC
TCTCCCATCGCTTCAACGAGTTCATGACCTCCAAACCCAAAATCCACTGCTTCAGGAGCCTAAAGCGTGGGCTTTCTCTCAAGCTGGGTG
CAACACCGGAGGATTTCAGCAACCTCCCACCTGAACAAAGAAGGAAAAAGCTGCAGCAGAAAGTCGATGAGTTAAATAAAGAAATTCAGA
AGGAGATGGATCAAAGAGATGCCATAACAAAAATGAAAGATGTCTACCTAAAGAATCCTCAGATGGGAGACCCAGCCAGTTTGGATCACA
AATTAGCAGAAGTCAGCCAAAATATAGAGAAACTGCGAGTAGAGACCCAGAAATTTGAGGCCTGGCTGGCTGAGGTTGAAGGCCGGCTCC
CAGCACGCAGCGAGCAGGCGCGCCGGCAGAGCGGACTGTACGACAGCCAGAACCCACCCACAGTCAACAACTGCGCCCAGGACCGTGAGA
GCCCAGATGGCAGTTACACAGAGGAGCAGAGTCAGGAGAGTGAGATGAAGGTGCTGGCCACGGATTTTGACGACGAGTTTGATGATGAGG
AGCCCCTCCCTGCCATAGGGACGTGCAAAGCTCTCTACACATTTGAAGGTCAGAATGAAGGAACGATTTCCGTAGTTGAAGGAGAAACAT
TGTATGTCATAGAGGAAGACAAAGGCGATGGCTGGACCCGCATTCGGAGAAATGAAGATGAAGAGGGTTATGTCCCCACTTCATATGTCG


Top

FusionGenePPI for PMVK_FNBP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PMVKCENPH, PITPNA, RGS20, TBPL1, MPDU1, SSB, MLF2, RASGRF2, WDR92, ARL6IP6, MBD5, SCNM1, SLC25A35, SLC25A32, SNRNP27, FGB, GTF2E2, C4orf26, SETD3, NPPA, FSD1, FYTTD1, NKD2, RDH12, SDHA, MCPH1FNBP1TNKS, AKAP9, FNBP1, DNM1, EGF, TF, SNX2, FASLG, ARHGAP17, TUBB, HSPA1A, WAS, GABARAP, ITSN1, ELAVL1, WASL, DNM2, SHMT2, NXF1, FCHO1, PPP2CA, MYO1E, SF3A1, TMEM17, RBPJ, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516550_617171593ARHGAP17%2C DAAM1%2C DIAPH1 and DIAPH2
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517550_617171618ARHGAP17%2C DAAM1%2C DIAPH1 and DIAPH2
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516535_617171593DNM1 and DNM3
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517535_617171618DNM1 and DNM3
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516553_609171593DNM2 and WASL
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517553_609171618DNM2 and WASL
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516553_610171593FASLG
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517553_610171618FASLG
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516495_617171593PDE6G
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517495_617171618PDE6G
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-516400_552171593RND2
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-517400_552171618RND2


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneFNBP1chr1:154909067chr9:132691974ENST00000355681-5161_335171593microtubules
TgeneFNBP1chr1:154909067chr9:132691974ENST00000446176-5171_335171618microtubules


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PMVK_FNBP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PMVK_FNBP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource