FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27813

FusionGeneSummary for PMS2_DNAH11

check button Fusion gene summary
Fusion gene informationFusion gene name: PMS2_DNAH11
Fusion gene ID: 27813
HgeneTgene
Gene symbol

PMS2

DNAH11

Gene ID

5395

8701

Gene namePMS1 homolog 2, mismatch repair system componentdynein axonemal heavy chain 11
SynonymsHNPCC4|MLH4|PMS2CL|PMSL2CILD7|DNAHBL|DNAHC11|DNHBL|DPL11
Cytomap

7p22.1

7p15.3

Type of geneprotein-codingprotein-coding
Descriptionmismatch repair endonuclease PMS2DNA mismatch repair protein PMS2PMS1 homolog 2, mismatch repair proteinPMS1 protein homolog 2PMS2 postmeiotic segregation increased 2postmeiotic segregation increased 2 nirs variant 6dynein heavy chain 11, axonemalaxonemal beta dynein heavy chain 11axonemal dynein heavy chain 11ciliary dynein heavy chain 11dynein, axonemal, heavy polypeptide 11dynein, ciliary, heavy chain 11
Modification date2018052320180523
UniProtAcc

P54278

Q96DT5

Ensembl transtripts involved in fusion geneENST00000265849, ENST00000441476, 
ENST00000382321, ENST00000406569, 
ENST00000469652, 
ENST00000409508, 
ENST00000328843, ENST00000465593, 
Fusion gene scores* DoF score3 X 1 X 3=94 X 4 X 4=64
# samples 34
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PMS2 [Title/Abstract] AND DNAH11 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePMS2

GO:0006298

mismatch repair

10871409|23709753


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-E1-A7Z2-01APMS2chr7

6048628

-DNAH11chr7

21813384

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000265849ENST00000409508PMS2chr7

6048628

-DNAH11chr7

21813384

+
In-frameENST00000265849ENST00000328843PMS2chr7

6048628

-DNAH11chr7

21813384

+
5CDS-intronENST00000265849ENST00000465593PMS2chr7

6048628

-DNAH11chr7

21813384

+
intron-3CDSENST00000441476ENST00000409508PMS2chr7

6048628

-DNAH11chr7

21813384

+
intron-3CDSENST00000441476ENST00000328843PMS2chr7

6048628

-DNAH11chr7

21813384

+
intron-intronENST00000441476ENST00000465593PMS2chr7

6048628

-DNAH11chr7

21813384

+
In-frameENST00000382321ENST00000409508PMS2chr7

6048628

-DNAH11chr7

21813384

+
In-frameENST00000382321ENST00000328843PMS2chr7

6048628

-DNAH11chr7

21813384

+
5CDS-intronENST00000382321ENST00000465593PMS2chr7

6048628

-DNAH11chr7

21813384

+
In-frameENST00000406569ENST00000409508PMS2chr7

6048628

-DNAH11chr7

21813384

+
In-frameENST00000406569ENST00000328843PMS2chr7

6048628

-DNAH11chr7

21813384

+
5CDS-intronENST00000406569ENST00000465593PMS2chr7

6048628

-DNAH11chr7

21813384

+
5UTR-3CDSENST00000469652ENST00000409508PMS2chr7

6048628

-DNAH11chr7

21813384

+
5UTR-3CDSENST00000469652ENST00000328843PMS2chr7

6048628

-DNAH11chr7

21813384

+
5UTR-intronENST00000469652ENST00000465593PMS2chr7

6048628

-DNAH11chr7

21813384

+

Top

FusionProtFeatures for PMS2_DNAH11


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PMS2

P54278

DNAH11

Q96DT5

Component of the post-replicative DNA mismatch repairsystem (MMR). Heterodimerizes with MLH1 to form MutL alpha. DNArepair is initiated by MutS alpha (MSH2-MSH6) or MutS beta (MSH2-MSH3) binding to a dsDNA mismatch, then MutL alpha is recruited tothe heteroduplex. Assembly of the MutL-MutS-heteroduplex ternarycomplex in presence of RFC and PCNA is sufficient to activateendonuclease activity of PMS2. It introduces single-strand breaksnear the mismatch and thus generates new entry points for theexonuclease EXO1 to degrade the strand containing the mismatch.DNA methylation would prevent cleavage and therefore assure thatonly the newly mutated DNA strand is going to be corrected. MutLalpha (MLH1-PMS2) interacts physically with the clamp loadersubunits of DNA polymerase III, suggesting that it may play a roleto recruit the DNA polymerase III to the site of the MMR. Alsoimplicated in DNA damage signaling, a process which induces cellcycle arrest and can lead to apoptosis in case of major DNAdamages. {ECO:0000269|PubMed:16873062,ECO:0000269|PubMed:18206974, ECO:0000269|PubMed:23709753}. Force generating protein of respiratory cilia. Producesforce towards the minus ends of microtubules. Dynein has ATPaseactivity; the force-producing power stroke is thought to occur onrelease of ADP.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833072_313630414524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833312_340330414524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833668_370330414524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833072_340330414524RegionStalk
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833459_368630414524RegionAAA 5
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55833896_412230414524RegionAAA 6

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55831274_132730414524Coiled coilOntology_term=ECO:0000255
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55831893_190030414524Nucleotide bindingATP
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832174_218130414524Nucleotide bindingATP
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832510_251730414524Nucleotide bindingATP
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832855_286230414524Nucleotide bindingATP
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55831855_207630414524RegionAAA 1
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55831_185430414524RegionStem
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832136_236630414524RegionAAA 2
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832472_271930414524RegionAAA 3
TgeneDNAH11chr7:6048628chr7:21813384ENST00000328843+55832817_306630414524RegionAAA 4


Top

FusionGeneSequence for PMS2_DNAH11


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP

>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_1490aa
MERAESSSQCTKTLLAFSWHMFTPL_MK_VPDITRMREDTTIPPQRVF_NKTHCLRTC_RRSKMRTPRKKNAW_TASKS_KPQPLRWEI_
KPDLPLKKPSCN_EIMMPKL_SQRSAFRRRK_AGKRPSLMLRSER_QPFRLKCSRNRENVKLTYSRLSLHWWLLQLHSIHSTGSTSVS_K
PFPTLPSQLPMLLQP_WSFWLLGEECPKTEVGKQLKSSWERLMIFCKH_LTMTKSTFQRTV_KW_MNTI_KTQSLIQT_FEPNLLQQLAC
VPGSSTSLNSMRSTVMWSQNAKH_PKQT_NWLQLLKN_RLSGKSLWIWIEI_ADSRLHLKKQQLRKSGVKKR_TKPTKPSN_LTDLSRNL
RQRRFAGVNPLSPLKLKRRHSVEMFFSRRHLCLTSDPSQGSIARSWCTASGFPFFNRRFPFH_PKAWT_TPC_RMMLQLPPGITKDCPVT
ECPPKMPLS_HTVSAGLW__IPSNRELSGSRISMEWT_KSHIWARKGF_MPLKLLWPLVMSS_LKISRKR_IQSWIHYLAGTQLKKESIS
GLEIKNVNLTRTFALSFTQNWQILTISRNYKLRQLSSISQSQKMV_KPSCWQRLSVLKGQIWRNLSWT_QSTKMILKLSSSIWKTISFCA
FLRQREAFWMTPNW_RDWRQQRPPWQR_STR_LKPKKMKEKSTRPENVTDQWQQEHLFFILLLMTSKKSTPSTNSL_RLLTCCSTERSSR
LTRWKTCRDASLS_WRASPMLSSSTPARRCLRRTSSPSCPRWLFRFC_ERKR_TLLNWISCFDSQLNTLI_VPLTS_LLSHGVLSRQLPS
WKNFEA_TEMWKDLPSSGGSG_NPSVQKKKNYLKNGRRKV_YRS_FF_EQCALTE_RMLSEIL_RKNWVRSMWRGPDWT_LKHSKKAAQP
PPTSSSCLRG_MPLKTWRFLAKDLALQLTLENSTMCL_DKVRRRWQKWPWRKLPKEDTGSSSKMFIW_PSG_EPWRSSLKDSAKEATEIT
GFS_VLSLHLHQMSISSLKDSWKIPLRSLMNPQQGCWPICMPPCTTLIRIHLKTAPRSRSLKASFFLSATSTPVLLGD_GLAPRAGAEAI
LLILETSPFVPVSSTTT_RQTLKSHGKISVISLVRSCMEATSQMTGIANCVGCI_KNS_IHL_LKMN_CWHQVLLPHPT_IMQATTST_R
RCFLQKARHCMASTQMLK_NS_Q_HPTLSSELCWRCSPGMHSVVMNWGSLQKKRLRMSWMTFWRNFQKSSTWQR_CKKIQIEAHMFLFAS
KNVRG_IFSFGKYVTHLNNWTLV_RGNWHTLLLWKPSSLH_VMTRYQTLGANWLILLLMA_PSGSMTSSCDAENSILGHKTLPFRLSCGS
PASSTLSPS_LQSCRRWLEKMSGPWIKRA_LLMLPKKQRKIMDTRQGKVHTSTDSSWRAPAGTPKQEPLLKPVSRSWHALCRSSLQKPPP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA

>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_4472nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_5163nt
GGAGCACAACGTCGAAAGCAGCCAATGGGAGTTCAGGAGGCGGAGCGCCTGTGGGAGCCCTGGAGGGAACTTTCCCAGTCCCCGAGGCGG
ATCGGGTGTTGCATCCATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACT
GTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTT
AAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCT
CAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATC
GGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAG
AAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAAC
CTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGA
GTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAG
CACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTT
GCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCC
CAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTC
ACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGA
CTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTT
CTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTT
CAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAA
GGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAG
GGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCT
TTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAA
AAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCAC
TATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTC
AGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGAC
GATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTG
GCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGA
GCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCAC
AGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTAC
ACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCT
CTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATC
AAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAG
TGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGA
ATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAA
GAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGC
TTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAA
GGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGA
AGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCC
ATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGC
TCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGC
TGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCA
TGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTA
GAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTAC
CACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACA
TCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTT
AAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATAT
GTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAG
GGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTAT
CCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCG
GCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTG
GATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTC
TTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTT
GCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATC
TGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGC
ATTCCTCTAGCCTCTGCTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACT
CACACGTGCATTCTTTTTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACA
CGACTGTAATCCCAGTTACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACT
CCCTCCTGGGCAACAGAACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCA
GCCGGAAAGAACGGAGATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCC
CAGGTGAGTCCTGAAGGAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAA

>In-frame_PMS2_ENST00000265849_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_5163nt
GGAGCACAACGTCGAAAGCAGCCAATGGGAGTTCAGGAGGCGGAGCGCCTGTGGGAGCCCTGGAGGGAACTTTCCCAGTCCCCGAGGCGG
ATCGGGTGTTGCATCCATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACT
GTAAATGAAATGAGTACCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTT
AAGAACCTGTTGAAGAAGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCT
CAGGTGGGAGATCTAAAAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATC
GGCCTTCAGACGGAGAAAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAG
AAACAGAGAGAATGTGAAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAAC
CTCAGTGAGCTGAAAGCCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGA
GTGCCCAAAGACCGAAGTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAG
CACATTCCAGAGAACTGTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTT
GCAGCAGCTGGCCTGTGTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCC
CAAGCAAACTTAGAACTGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTC
ACGGCTTCATTTGAAAAAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGA
CTTGTCAAGGAACTTGAGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTT
CTTCTCACGGCGGCATTTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTT
CAACAGAAGGTTTCCATTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAA
GGACTGCCCAGTGACAGAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAG
GGAATTAAGTGGATCAAGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCT
TTGGCCTTTGGTGATGTCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAA
AAAGGAAAGTATATCAGGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCAC
TATAAGCCGGAATTACAAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTC
AGTATTGAAAGGCCAGATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGAC
GATCTCCTTTTGCGCCTTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTG
GCAGAGATAGAGCACAAGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGA
GCATCTCTTCTTTATTTTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCAC
AGAGCGATCGAGCAGGCTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTAC
ACCAGCCAGGCGCTGTTTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCT
CTTGAATTGGATTTCCTGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATC
AAGGCAATTGCCGTCATGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAG
TGTCCAGAAAAAGAAAAATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGA
ATGACGTATGCTCTCAGAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAA
GAAAGCAGCCCAGCCACCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGC
TTTACAATTGACTCTGGAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAA
GGAGGACACTGGGTCATCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGA
AGCCACAGAGATTACAGGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCC
ATTAAGATCACTAATGAACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGC
TCCAAGGAGCAGGAGTTTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGC
TGGAGCCGAAGCTATCCTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCA
TGGGAAGATCTCCGTTATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTA
GAAGAATTCATGAATCCATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTAC
CACCAGTACATAGAGGAGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACA
TCCAACACTCTCTTCAGAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTT
AAGAATGTCTTGGATGACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATAT
GTTCTTGTTTGCTTCCAAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAG
GGGGAATTGGCATTATCTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTAT
CCTTCTACTTATGGCCTAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCG
GCTGTCGTGTGGCTCTCCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTG
GATAAAACGCGCTTGACTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTC
TTCATGGAGGGCGCCCGCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTT
GCAAAAGCCACCCCCGTGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATC
TGGACCTTCAGGCTGAAGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGC
ATTCCTCTAGCCTCTGCTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACT
CACACGTGCATTCTTTTTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACA
CGACTGTAATCCCAGTTACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACT
CCCTCCTGGGCAACAGAACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCA
GCCGGAAAGAACGGAGATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCC
CAGGTGAGTCCTGAAGGAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAA

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_5057nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA
AGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTG
CTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTT
TTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGT
TACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAG
AACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAG
ATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAG
GAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAA

>In-frame_PMS2_ENST00000382321_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_5057nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA
AGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTG
CTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTT
TTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGT
TACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAG
AACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAG
ATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAG
GAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAA

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000409508_chr7_21813384_+_5057nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA
AGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTG
CTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTT
TTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGT
TACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAG
AACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAG
ATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAG
GAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAA

>In-frame_PMS2_ENST00000406569_chr7_6048628_-_DNAH11_ENST00000328843_chr7_21813384_+_5057nt
ATGGAGCGAGCTGAGAGCTCGAGCCAGTGCACAAAGACTCTATTAGCCTTTTCATGGCACATGTTCACACCACTGTAAATGAAATGAGTA
CCAGATATTACCAGAATGAGAGAAGACACAACTATACCACCCCAAAGAGTTTTCTAGAACAAATATCACTGTTTAAGAACCTGTTGAAGA
AGAAGCAAAATGAGGTATCCGAGAAAAAAGAACGCCTGGTGAACGGCATCCAAAAGCTAAAAACCACAGCCTCTCAGGTGGGAGATCTAA
AAGCCAGACTTGCCTCTCAAGAAGCCGAGCTGCAACTGAGAAATCATGATGCCGAAGCTCTGATCACAAAGATCGGCCTTCAGACGGAGA
AAGTGAGCCGGGAAAAGACCATCGCTGATGCTGAGGAGCGAAAGGTGACAGCCATTCAGACTGAAGTGTTCCAGAAACAGAGAGAATGTG
AAGCTGACTTACTCAAGGCTGAGCCTGCACTGGTGGCTGCTACAGCTGCACTCAATACACTCAACAGGGTCAACCTCAGTGAGCTGAAAG
CCTTTCCCAACCCTCCCATCGCAGTTACCAATGTTACTGCAGCCGTGATGGTCCTTCTGGCTCCTCGGGGAAGAGTGCCCAAAGACCGAA
GTTGGAAAGCAGCTAAAGTCTTCATGGGAAAGGTTGATGATTTTTTGCAAGCATTAATTAACTATGACAAAGAGCACATTCCAGAGAACT
GTCTAAAAGTGGTGAATGAACACTATTTGAAAGACCCAGAGTTTAATCCAAACCTGATTCGAACCAAATCTTTTGCAGCAGCTGGCCTGT
GTGCCTGGGTCATCAACATCATTAAATTCTATGAGGTCTACTGTGATGTGGAGCCAAAACGCCAAGCATTAGCCCAAGCAAACTTAGAAC
TGGCTGCAGCTACTGAAAAACTAGAGGCTATCAGGAAAAAGCTTGTGGATCTGGATCGAAATCTGAGCAGACTCACGGCTTCATTTGAAA
AAGCAACAGCTGAGAAAGTCCGGTGTCAAGAAGAGGTGAACCAAACCAACAAAACCATCAAATTAGCTAACAGACTTGTCAAGGAACTTG
AGGCAAAGAAGATTCGCTGGGGTCAATCCATTAAGTCCTTTGAAGCTCAAGAGAAGACACTCTGTGGAGATGTTCTTCTCACGGCGGCAT
TTGTGTCTTACGTCGGACCCTTCACAAGGCAGTATCGCCAGGAGCTGGTGCACTGCAAGTGGGTTCCCTTTCTTCAACAGAAGGTTTCCA
TTCCACTAACCGAAGGCCTGGACTTGATATCCATGTTGACGGATGATGCTACAATTGCCGCCTGGAATAACGAAGGACTGCCCAGTGACA
GAATGTCCACCGAAAATGCCGCTATCCTAACACACTGTGAGCGCTGGCCTCTGGTGATAGATCCCCAGCAACAGGGAATTAAGTGGATCA
AGAATAAGTATGGAATGGACCTGAAAGTCACACATTTGGGCCAGAAAGGGTTTTTGAATGCCATTGAAACTGCTTTGGCCTTTGGTGATG
TCATCTTAATTGAAAATCTCGAGGAAACGATAGATCCAGTCCTGGATCCACTACTTGGCAGGAACACAATTAAAAAAGGAAAGTATATCA
GGATTGGAGATAAAGAATGTGAATTTAACAAGAACTTTCGCCTTATCCTTCACACAAAATTGGCAAATCCTCACTATAAGCCGGAATTAC
AAGCTCAGACAACTCTCCTCAATTTCACAGTCACAGAAGATGGTCTAGAAGCCCAGCTGCTGGCAGAGGTTGTCAGTATTGAAAGGCCAG
ATTTGGAGAAACTTAAGTTGGTATTGACAAAGCACCAAAATGATTTTAAAATTGAGCTCAAGTATCTGGAAGACGATCTCCTTTTGCGCC
TTTCTGCGGCAGAGGGAAGCTTTCTGGATGACACCAAACTGGTAGAGAGATTGGAGGCAACAAAGACCACCGTGGCAGAGATAGAGCACA
AGGTGATTGAAGCCAAAGAAAATGAAAGAAAAATCAACGAGGCCCGAGAATGTTACAGACCAGTGGCAGCAAGAGCATCTCTTCTTTATT
TTGTTATTAATGACCTCCAAAAAATCAACCCCCTCTACCAATTCTCTTTGAAGGCTTTTAACGTGCTGTTCCACAGAGCGATCGAGCAGG
CTGACAAGGTGGAAGACATGCAGGGACGCATCTCTATCCTGATGGAGAGCATCACCCATGCTGTCTTCCTCTACACCAGCCAGGCGCTGT
TTGAGAAGGACAAGCTCACCTTCCTGTCCCAGATGGCTTTTCAGATTTTGTTGAGAAAGAAAGAGATAGACCCTCTTGAATTGGATTTCC
TGCTTCGATTCACAGTTGAACACACTCATCTGAGTCCCGTTGACTTCCTAACTTCTCAGTCATGGAGTGCTATCAAGGCAATTGCCGTCA
TGGAAGAATTTCGAGGCATAGACCGAGATGTGGAAGGATCTGCCAAGCAGTGGAGGAAGTGGGTAGAATCCGAGTGTCCAGAAAAAGAAA
AATTACCTCAAGAATGGAAGAAGAAAAGTTTAATACAGAAGCTGATTCTTCTGAGAGCAATGCGCCCTGACAGAATGACGTATGCTCTCA
GAAATTTTGTAGAGGAAAAACTGGGTGCGAAGTATGTGGAGAGGACCAGATTGGACTTAGTTAAAGCATTCGAAGAAAGCAGCCCAGCCA
CCCCCATATTCTTCATCCTGTCTCCGGGGGTAGATGCCCTTAAAGACCTGGAGATTCTTGGCAAAAGACTTGGCTTTACAATTGACTCTG
GAAAATTCCACAATGTGTCTTTAGGACAAGGTCAGGAGACGGTGGCAGAAGTGGCCCTGGAGAAAGCTTCCAAAGGAGGACACTGGGTCA
TCCTCCAAAATGTTCATTTGGTAGCCAAGTGGCTAGGAACCTTGGAGAAGCTCCTTGAAAGATTCAGCCAAGGAAGCCACAGAGATTACA
GGGTTTTCATGAGTGCTGAGTCTGCACCTACACCAGATGAGCATATCATCCCTCAAGGACTCCTGGAAAATTCCATTAAGATCACTAATG
AACCCCCAACAGGGATGCTGGCCAATTTGCATGCCGCCCTGTACAACTTTGATCAGGATACACTTGAAATATGCTCCAAGGAGCAGGAGT
TTAAAAGCATCCTTTTTTCTCTCTGCTACTTCCACGCCTGTGTTGCTGGGAGACTGAGGTTTGGCCCCCAGGGCTGGAGCCGAAGCTATC
CTTTTAATCCTGGAGACCTCACCATTTGTGCCAGTGTCCTCTACAACTACTTAGAGGCAAACTCTAAAGTCCCATGGGAAGATCTCCGTT
ATCTCTTTGGTGAGATCATGTATGGAGGCCACATCACAGATGACTGGGATCGCAAACTGTGTCGGGTGTATTTAGAAGAATTCATGAATC
CATCTCTGACTGAAGATGAACTGATGCTGGCACCAGGTTTTGCTGCCCCACCCTACCTAGATTATGCAGGCTACCACCAGTACATAGAGG
AGATGCTTCCTCCAGAAAGCCCGGCACTGTATGGCCTCCACCCAAATGCTGAAATAGAATTCCTGACAGTGACATCCAACACTCTCTTCA
GAACTTTGCTGGAGATGCAGCCCAGGAATGCACTCAGTGGTGATGAACTGGGGCAGTCTACAGAAGAAAAGGTTAAGAATGTCTTGGATG
ACATTTTGGAGAAACTTCCAGAAGAGTTCAACATGGCAGAGATAATGCAAAAAAATTCAAATAGAAGCCCATATGTTCTTGTTTGCTTCC
AAGAATGTGAGAGGATGAATATTCTCATTCGGGAAATACGTATATCACTTGAACAACTGGACCTTAGTTTGAAGGGGGAATTGGCATTAT
CTCCTGCTGTGGAAGCCCAGCAGTTTGCATTGAGTTATGACACGGTACCAGACACTTGGAGCAAACTGGCTTATCCTTCTACTTATGGCC
TAGCCCAGTGGTTCAATGACCTCCTCCTGCGATGCCGAGAACTCGATACTTGGACACAAGACCTTACCCTTCCGGCTGTCGTGTGGCTCT
CCGGCTTCTTCAACCCTCAGTCCTTCTTAACTGCAATCATGCAGACGATGGCTCGAAAAAATGAGTGGCCCCTGGATAAAACGCGCTTGA
CTGCTGATGTTACCAAAAAAACAAAGGAAGATTATGGACACCCGCCAAGGGAAGGTGCATACCTCCACGGACTCTTCATGGAGGGCGCCC
GCTGGGACACCCAAGCAGGAACCATTGTTGAAGCCCGTCTCAAGGAGCTGGCATGCCCTATGCCGGTCATCTTTGCAAAAGCCACCCCCG
TGGACAGACAAGAAACCAAACAGACCTACGAGTGCCCTGTGTATAGAACCAAACTGAGAGGCCCCAGCTACATCTGGACCTTCAGGCTGA
AGAGCGAAGAGAAGACTGCAAAATGGGTTCTGGCTGGAGTGGCTCTGCTTCTAGAAGCGTAAGGTAACACTGGCATTCCTCTAGCCTCTG
CTGGAGTGCAGTGAGGATTTTCTAGCATGTTGCTGCACTGTTCCCATGCACATTATTCTAACTTTTTAGTAACTCACACGTGCATTCTTT
TTTCAACGCTATCCTTAGAGTGAAAGTCAGAAAAAAATACTAGAAACTAACTCAGGGCTGAGCGTGGTGGCACACGACTGTAATCCCAGT
TACTCAGGAGGTAGGAGAATCACTTGAACCTAGGAGGCAAAGGTTGCAGTGAGCCGAGGTTGCACCACTGCACTCCCTCCTGGGCAACAG
AACAAGACTCCATCTCAAAAAAAAAAAAGTACATCATAAAAGTACATCATATGTGAACATGCAAAAGCAATGCAGCCGGAAAGAACGGAG
ATTTTAATTTTTAACAAACAACAAATTAAATTATTAGCCCTTAAACTCTTTCAAAATATAAAAGCAGCAGGCCCCAGGTGAGTCCTGAAG
GAAGAGGCTAGCACTCTGTAAGGCCTCCAGTGTCCAGTGTCTACAATGTTGATGGTCCCCTTTTGTTCAGTCAAGTTTTAATAAAAATAA


Top

FusionGenePPI for PMS2_DNAH11


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PMS2MLH1, EXO1, MSH3, BRCA2, PSD2, UBC, PRKDC, KPNA2, KPNB1, RUVBL1, RUVBL2, FAN1, PPP2CA, AIFM1, PIK3C2A, ATAD3A, MSH2, MSH6, PCNA, RFC2, DDB1, MCM3, SMARCA4, XPO1, COPB1, COPG1, COPG2, PSMC1, PSMC6, PSMD5, PSD3, PSMC3, PSMC2, CYLD, UBR5, NSUN2, BRIP1, MMS19, TOPBP1, CLSPN, SPRTN, NSF, LMNA, PMS2P1, BRCA1, REXO2, HIST1H2BG, ABCA2, FYN, XRCC3, CTR9, PARD6A, ZNRD1DNAH11ZDHHC17


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PMS2_DNAH11


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PMS2_DNAH11


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePMS2C0265325Turcot syndrome (disorder)4CTD_human;ORPHANET;UNIPROT
HgenePMS2C0009405Hereditary Nonpolyposis Colorectal Neoplasms3CTD_human
HgenePMS2C0027627Neoplasm Metastasis1CTD_human
HgenePMS2C0035412Rhabdomyosarcoma1CTD_human;HPO
HgenePMS2C0038874Supratentorial Neoplasms1CTD_human
HgenePMS2C0206663Neuroectodermal Tumor, Primitive1CTD_human
HgenePMS2C0221263Cafe-au-Lait Spots1CTD_human;HPO
TgeneDNAH11C0010068Coronary heart disease1CTD_human
TgeneDNAH11C0043094Weight Gain1CTD_human
TgeneDNAH11C0242339Dyslipidemias1CTD_human
TgeneDNAH11C2678473CILIARY DYSKINESIA, PRIMARY, 7 (disorder)1CTD_human;UNIPROT