FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27787

FusionGeneSummary for PMF1_RAB25

check button Fusion gene summary
Fusion gene informationFusion gene name: PMF1_RAB25
Fusion gene ID: 27787
HgeneTgene
Gene symbol

PMF1

RAB25

Gene ID

100527963

57111

Gene namePMF1-BGLAP readthroughRAB25, member RAS oncogene family
SynonymsPMF1CATX-8|RAB11C
Cytomap

1q22

1q22

Type of geneprotein-codingprotein-coding
DescriptionPMF1-BGLAP proteinpolyamine-modulated factor 1ras-related protein Rab-25
Modification date2018051920180523
UniProtAcc

Q6P1K2

P57735

Ensembl transtripts involved in fusion geneENST00000368279, ENST00000368273, 
ENST00000368277, ENST00000565805, 
ENST00000567140, 
ENST00000361084, 
ENST00000487325, 
Fusion gene scores* DoF score2 X 1 X 2=41 X 1 X 1=1
# samples 21
** MAII scorelog2(2/4*10)=2.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: PMF1 [Title/Abstract] AND RAB25 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRAB25

GO:0008284

positive regulation of cell proliferation

15502842

TgeneRAB25

GO:0031268

pseudopodium organization

17925226


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCESCTCGA-DS-A1OC-01APMF1chr1

156182967

+RAB25chr1

156038061

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000368279ENST00000361084PMF1chr1

156182967

+RAB25chr1

156038061

+
5CDS-3UTRENST00000368279ENST00000487325PMF1chr1

156182967

+RAB25chr1

156038061

+
In-frameENST00000368273ENST00000361084PMF1chr1

156182967

+RAB25chr1

156038061

+
5CDS-3UTRENST00000368273ENST00000487325PMF1chr1

156182967

+RAB25chr1

156038061

+
In-frameENST00000368277ENST00000361084PMF1chr1

156182967

+RAB25chr1

156038061

+
5CDS-3UTRENST00000368277ENST00000487325PMF1chr1

156182967

+RAB25chr1

156038061

+
In-frameENST00000565805ENST00000361084PMF1chr1

156182967

+RAB25chr1

156038061

+
5CDS-3UTRENST00000565805ENST00000487325PMF1chr1

156182967

+RAB25chr1

156038061

+
In-frameENST00000567140ENST00000361084PMF1chr1

156182967

+RAB25chr1

156038061

+
5CDS-3UTRENST00000567140ENST00000487325PMF1chr1

156182967

+RAB25chr1

156038061

+

Top

FusionProtFeatures for PMF1_RAB25


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PMF1

Q6P1K2

RAB25

P57735

Involved in the regulation of cell survival. Promotesinvasive migration of cells in which it functions to localize andmaintain integrin alpha-V/beta-1 at the tips of extendingpseudopodia (PubMed:17925226). Involved in the regulation ofepithelial morphogenesis through the control of CLDN4 expressionand localization at tight junctions (By similarity). Mayselectively regulate the apical recycling pathway. Together withMYO5B regulates transcytosis (By similarity).{ECO:0000250|UniProtKB:E2RQ15, ECO:0000250|UniProtKB:P46629,ECO:0000250|UniProtKB:Q9WTL2, ECO:0000269|PubMed:17925226}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRAB25chr1:156182967chr1:156038061ENST00000361084+15125_12879214Nucleotide bindingNote=GTP
TgeneRAB25chr1:156182967chr1:156038061ENST00000361084+15155_15779214Nucleotide bindingNote=GTP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePMF1chr1:156182967chr1:156038061ENST00000368273+15141_19353208Coiled coilOntology_term=ECO:0000255
HgenePMF1chr1:156182967chr1:156038061ENST00000368277+15141_19353206Coiled coilOntology_term=ECO:0000255
HgenePMF1chr1:156182967chr1:156038061ENST00000368279+15141_19353181Coiled coilOntology_term=ECO:0000255
HgenePMF1chr1:156182967chr1:156038061ENST00000565805+16141_19353176Coiled coilOntology_term=ECO:0000255
HgenePMF1chr1:156182967chr1:156038061ENST00000567140+17141_19353221Coiled coilOntology_term=ECO:0000255
TgeneRAB25chr1:156182967chr1:156038061ENST00000361084+1541_4979214MotifEffector region
TgeneRAB25chr1:156182967chr1:156038061ENST00000361084+1519_2779214Nucleotide bindingNote=GTP
TgeneRAB25chr1:156182967chr1:156038061ENST00000361084+1567_7179214Nucleotide bindingGTP


Top

FusionGeneSequence for PMF1_RAB25


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PMF1_ENST00000368279_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_188aa
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRYTRGAVGALLVFDLTKHQTTAVVERWLKELTDHAEA
TIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEK

>In-frame_PMF1_ENST00000368273_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_188aa
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRYTRGAVGALLVFDLTKHQTTAVVERWLKELTDHAEA
TIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEK

>In-frame_PMF1_ENST00000368277_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_188aa
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRYTRGAVGALLVFDLTKHQTTAVVERWLKELTDHAEA
TIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEK

>In-frame_PMF1_ENST00000565805_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_188aa
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRYTRGAVGALLVFDLTKHQTTAVVERWLKELTDHAEA
TIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEK

>In-frame_PMF1_ENST00000567140_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_188aa
MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGRYTRGAVGALLVFDLTKHQTTAVVERWLKELTDHAEA
TIVVMLVGNKSDLSQAREVPTEEARMFAENNGLLFLETSALDSTNVELAFETVLKEIFAKVSKQRQNSIRTNAITLGSAQAGQEPGPGEK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PMF1_ENST00000368279_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_564nt
ATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCACCCGGCACT
ACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGTGGTGCAGTG
GGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCC
ACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTCGCTGAAAAC
AATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAG
GTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAG

>In-frame_PMF1_ENST00000368273_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_564nt
ATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCACCCGGCACT
ACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGTGGTGCAGTG
GGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCC
ACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTCGCTGAAAAC
AATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAG
GTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAG

>In-frame_PMF1_ENST00000368277_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_564nt
ATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCACCCGGCACT
ACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGTGGTGCAGTG
GGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCC
ACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTCGCTGAAAAC
AATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAG
GTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAG

>In-frame_PMF1_ENST00000565805_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_564nt
ATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCACCCGGCACT
ACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGTGGTGCAGTG
GGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCC
ACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTCGCTGAAAAC
AATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAG
GTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAG

>In-frame_PMF1_ENST00000567140_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_564nt
ATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCACCCGGCACT
ACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGTGGTGCAGTG
GGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCATGCTGAAGCC
ACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTCGCTGAAAAC
AATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATCTTTGCGAAG
GTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCTGGGGAGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PMF1_ENST00000368279_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_804nt
AGATTTGGAGGTTCAACTTCAACATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTT
CGGAATCTGTGCCACCCGGCACTACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCG
GCAGGTACTATCGTGGTGCAGTGGGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGG
AGCTCTATGACCATGCTGAAGCCACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGG
AGGCCCGAATGTTCGCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTG
TCCTGAAAGAAATCTTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGAC
AGGAGCCTGGCCCTGGGGAGAAGAGGGCCTGTTGCATCAGCCTCTGACCTTGGCCAGCACCACCTGCCCCCACTGGCTTTTTGGTGCCCC
TTGTCCCCACTTCAGCCCCAGGACCTTTCCTTGCCCTTTGGTTCCAGATATCAGACTGTTCCCTGTTCACAGCACCCTCAGGGTCTTAAG

>In-frame_PMF1_ENST00000368273_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_791nt
CAACTTCAACATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCC
ACCCGGCACTACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCG
TGGTGCAGTGGGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCA
TGCTGAAGCCACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTT
CGCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAAT
CTTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCC
TGGGGAGAAGAGGGCCTGTTGCATCAGCCTCTGACCTTGGCCAGCACCACCTGCCCCCACTGGCTTTTTGGTGCCCCTTGTCCCCACTTC
AGCCCCAGGACCTTTCCTTGCCCTTTGGTTCCAGATATCAGACTGTTCCCTGTTCACAGCACCCTCAGGGTCTTAAGGTCTTCATGCCCT

>In-frame_PMF1_ENST00000368277_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_790nt
AACTTCAACATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCA
CCCGGCACTACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGT
GGTGCAGTGGGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCAT
GCTGAAGCCACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTC
GCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATC
TTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCT
GGGGAGAAGAGGGCCTGTTGCATCAGCCTCTGACCTTGGCCAGCACCACCTGCCCCCACTGGCTTTTTGGTGCCCCTTGTCCCCACTTCA
GCCCCAGGACCTTTCCTTGCCCTTTGGTTCCAGATATCAGACTGTTCCCTGTTCACAGCACCCTCAGGGTCTTAAGGTCTTCATGCCCTA

>In-frame_PMF1_ENST00000565805_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_790nt
AACTTCAACATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCA
CCCGGCACTACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGT
GGTGCAGTGGGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCAT
GCTGAAGCCACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTC
GCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATC
TTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCT
GGGGAGAAGAGGGCCTGTTGCATCAGCCTCTGACCTTGGCCAGCACCACCTGCCCCCACTGGCTTTTTGGTGCCCCTTGTCCCCACTTCA
GCCCCAGGACCTTTCCTTGCCCTTTGGTTCCAGATATCAGACTGTTCCCTGTTCACAGCACCCTCAGGGTCTTAAGGTCTTCATGCCCTA

>In-frame_PMF1_ENST00000567140_chr1_156182967_+_RAB25_ENST00000361084_chr1_156038061_+_790nt
AACTTCAACATGGCCGAAGCAAGTAGCGCCAATCTAGGCAGCGGCTGTGAGGAAAAAAGGCATGAGGGGTCGTCTTCGGAATCTGTGCCA
CCCGGCACTACCATTTCGAGGGTGAAGCTCCTCGACACCATGGTGGACACTTTTCTTCAGAAGCTGGTCGCCGCCGGCAGGTACTATCGT
GGTGCAGTGGGGGCCCTCCTGGTGTTTGACCTAACCAAGCACCAGACCTATGCTGTGGTGGAGCGATGGCTGAAGGAGCTCTATGACCAT
GCTGAAGCCACGATCGTCGTCATGCTCGTGGGTAACAAAAGTGACCTCAGCCAGGCCCGGGAAGTGCCCACTGAGGAGGCCCGAATGTTC
GCTGAAAACAATGGACTGCTCTTCCTGGAGACCTCAGCCCTGGACTCTACCAATGTTGAGCTAGCCTTTGAGACTGTCCTGAAAGAAATC
TTTGCGAAGGTGTCCAAGCAGAGACAGAACAGCATCCGGACCAATGCCATCACTCTGGGCAGTGCCCAGGCTGGACAGGAGCCTGGCCCT
GGGGAGAAGAGGGCCTGTTGCATCAGCCTCTGACCTTGGCCAGCACCACCTGCCCCCACTGGCTTTTTGGTGCCCCTTGTCCCCACTTCA
GCCCCAGGACCTTTCCTTGCCCTTTGGTTCCAGATATCAGACTGTTCCCTGTTCACAGCACCCTCAGGGTCTTAAGGTCTTCATGCCCTA


Top

FusionGenePPI for PMF1_RAB25


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PMF1NFE2L2, MIS12, DSN1, GDF9, KIAA1377, MED31, CRMP1, PTN, COPS6, GIT1, COPS7A, SUGT1, HSP90AA1, TCP10L, KDM1A, USHBP1, BUB1B, NSMCE1, NSL1, ZWINT, SGTB, SEC63, PGRMC2, ZRANB1, WDR45B, GNPAT, PPP1CC, ZMPSTE24, CMTM6, GFER, TALDO1, SPC24, SPC25, CASC5, NUF2, KIF21B, BICD2, RUFY2, GCC2, NDC80, ZC4H2, CEP89, FBXO28, RUFY1, TSNAX, ATG16L1, NRBF2, ALOX5, MLLT10, CENPC, RGPD8, STXBP4, MLF1, TRIM25, UBE2SRAB25PKIG, KPTN, AP2S1, RAB11FIP1, RAB11FIP2, RAB11FIP3, RAB11FIP5, ATP4A, MYO5B, OPTN, RAB11B, RAB11A, PDE4DIP, CDK15, FAM60A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PMF1_RAB25


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PMF1_RAB25


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource