FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27753

FusionGeneSummary for PLXNB2_MAST4

check button Fusion gene summary
Fusion gene informationFusion gene name: PLXNB2_MAST4
Fusion gene ID: 27753
HgeneTgene
Gene symbol

PLXNB2

MAST4

Gene ID

23654

375449

Gene nameplexin B2microtubule associated serine/threonine kinase family member 4
SynonymsMM1|Nbla00445|PLEXB2|dJ402G11.3-
Cytomap

22q13.33

5q12.3

Type of geneprotein-codingprotein-coding
Descriptionplexin-B2microtubule-associated serine/threonine-protein kinase 4
Modification date2018052320180523
UniProtAcc

O15031

O15021

Ensembl transtripts involved in fusion geneENST00000359337, ENST00000449103, 
ENST00000496720, 
ENST00000404260, 
ENST00000403625, ENST00000406374, 
ENST00000406039, ENST00000478569, 
ENST00000490016, ENST00000403666, 
ENST00000405643, ENST00000261569, 
ENST00000407621, 
Fusion gene scores* DoF score14 X 12 X 9=15124 X 4 X 3=48
# samples 144
** MAII scorelog2(14/1512*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PLXNB2 [Title/Abstract] AND MAST4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLXNB2

GO:0007156

homophilic cell adhesion via plasma membrane adhesion molecules

16122393

HgenePLXNB2

GO:0010976

positive regulation of neuron projection development

16122393


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-P4-A5EB-01APLXNB2chr22

50722031

-MAST4chr5

66195779

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000359337ENST00000404260PLXNB2chr22

50722031

-MAST4chr5

66195779

+
In-frameENST00000359337ENST00000403625PLXNB2chr22

50722031

-MAST4chr5

66195779

+
In-frameENST00000359337ENST00000406374PLXNB2chr22

50722031

-MAST4chr5

66195779

+
In-frameENST00000359337ENST00000406039PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000478569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000490016PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000403666PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000405643PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000261569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000359337ENST00000407621PLXNB2chr22

50722031

-MAST4chr5

66195779

+
Frame-shiftENST00000449103ENST00000404260PLXNB2chr22

50722031

-MAST4chr5

66195779

+
Frame-shiftENST00000449103ENST00000403625PLXNB2chr22

50722031

-MAST4chr5

66195779

+
Frame-shiftENST00000449103ENST00000406374PLXNB2chr22

50722031

-MAST4chr5

66195779

+
Frame-shiftENST00000449103ENST00000406039PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000478569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000490016PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000403666PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000405643PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000261569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5CDS-intronENST00000449103ENST00000407621PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-3CDSENST00000496720ENST00000404260PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-3CDSENST00000496720ENST00000403625PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-3CDSENST00000496720ENST00000406374PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-3CDSENST00000496720ENST00000406039PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000478569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000490016PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000403666PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000405643PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000261569PLXNB2chr22

50722031

-MAST4chr5

66195779

+
5UTR-intronENST00000496720ENST00000407621PLXNB2chr22

50722031

-MAST4chr5

66195779

+

Top

FusionProtFeatures for PLXNB2_MAST4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLXNB2

O15031

MAST4

O15021

Cell surface receptor for SEMA4C, SEMA4D and SEMA4G thatplays an important role in cell-cell signaling. Binding to class 4semaphorins promotes downstream activation of RHOA andphosphorylation of ERBB2 at 'Tyr-1248'. Required for normaldifferentiation and migration of neuronal cells during braincorticogenesis and for normal embryonic brain development.Regulates the migration of cerebellar granule cells in thedeveloping brain. Plays a role in RHOA activation and subsequentchanges of the actin cytoskeleton. Plays a role in axon guidance,invasive growth and cell migration. May modulate the activity ofRAC1 and CDC42. Down-regulates macrophage migration in wound-healing assays (in vitro) (By similarity). {ECO:0000250,ECO:0000269|PubMed:12183458, ECO:0000269|PubMed:12533544,ECO:0000269|PubMed:15184888}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-153720_4668561839DomainSema
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-153720_4668561839DomainSema
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+0262125_2208-1252430Compositional biasPro-rich
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+02663_108-1252430Compositional biasPro-rich
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+0282125_2208132435Compositional biasPro-rich
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+02863_108132435Compositional biasPro-rich
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+262125_2208214251Compositional biasPro-rich
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+0261141_1229-1252430DomainPDZ
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+026570_843-1252430DomainProtein kinase
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+026844_916-1252430DomainNote=AGC-kinase C-terminal
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+0281141_1229132435DomainPDZ
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+028570_843132435DomainProtein kinase
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+028844_916132435DomainNote=AGC-kinase C-terminal
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+261141_1229214251DomainPDZ
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+26570_843214251DomainProtein kinase
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+26844_916214251DomainNote=AGC-kinase C-terminal
TgeneMAST4chr22:50722031chr5:66195779ENST00000261569+026576_584-1252430Nucleotide bindingATP
TgeneMAST4chr22:50722031chr5:66195779ENST00000403666+028576_584132435Nucleotide bindingATP
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+26576_584214251Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-1537803_8938561839DomainNote=IPT/TIG 1
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-1537895_9808561839DomainNote=IPT/TIG 2
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-1537983_10928561839DomainNote=IPT/TIG 3
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-1537803_8938561839DomainNote=IPT/TIG 1
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-1537895_9808561839DomainNote=IPT/TIG 2
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-1537983_10928561839DomainNote=IPT/TIG 3
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-15371219_18388561839Topological domainCytoplasmic
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-153720_11978561839Topological domainExtracellular
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-15371219_18388561839Topological domainCytoplasmic
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-153720_11978561839Topological domainExtracellular
HgenePLXNB2chr22:50722031chr5:66195779ENST00000359337-15371198_12188561839TransmembraneHelical
HgenePLXNB2chr22:50722031chr5:66195779ENST00000449103-15371198_12188561839TransmembraneHelical
TgeneMAST4chr22:50722031chr5:66195779ENST00000406374+2663_108214251Compositional biasPro-rich


Top

FusionGeneSequence for PLXNB2_MAST4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000404260_chr5_66195779_+_3269aa
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATGPALDNKKCTPPIEASQCHEA
EMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPD
IHAAAFGTCLAASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDL
GSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQP
ETGPLGGGIRITILGSNLGVQAGDIQRISVAGRNCSFQPERYSVSTRRSXVSPEEEVFAEQATGKAXXAMGSHQHCLDHTHLSLLMQEIA
LKIVQEISPPVPQPIFHLHGVSIGLMDAAGRWLLSLPLAMGQTHPALRSLHPVPPRRSCISYHTNQHQTSYTSYQNISVPPKASPLRTDA
GTRRCAPVPEVXALDVLPPAVTMKXLXXTMSTKKGSQRLQLRWKNVXRKLSPATLLTTFYPXQMECLVSLTTRLLNWLEIAWINPTRASS
PHDTSLNYSTNXISCYRRLMIVQKVENWHLLNNXFERSXLLLPALLGYXSAWNLIRKNFTTYWKQQKAMPKKDRVLKPTFPGTSLANWDS
IRIPWKKWLIWETTIVGQQKHQKQMNQXVALMPPXNFEGNLGKVILKRLNXLAMEPMGQSTLFGIKNPGRGLPXRRLINRTSSFETRSSR
PLWSGISXLLQKTPLLSACIAPLKQGATCAWSWNMWKGETVLLXXKTWVLSLLIWPECTLLRRSWPWNIYIIMELYTGIXNQTTCWLPPW
GTXSXQILDYLRWDXXAXLPTFTRVILRRMLESSWINRSVAHLNTLHQKXFXGRVMESRWTGGPWGLSSMNFWLDACHSLGILQRSYLDK
SSVMRSTGLRRMRHPHLMPRIXLPYSSGRIPWRGWEQVVHMKSNSIDSSVLXTGTVCXDRRQNLFPNWNLRMTQVILILGLRSIIIWKRR
KKMTQMMKTLMWKXGSFLHVHTGFQKFSAVXIESLRIQQKRRKTLWTKPKAPPCHPQKHXAGVQNILKCNSYQHPTLQILKATDINSVLA
YFPNWLFQQRESKMKLPPALETPMRSQESQPFLLKSVPRRSLRSPPQPAPSAAPPCQLAVFQSTWIRXMDEASVWTVQIIPQSHPVNPLL
TWLGSDXKAQKKRKSRGKSQSPSLPVLFPSXSQEICLLFPLWEVQCLPIPCPRTLLLHEIPLPAEIPQQLLPVHISRLXSTVRGRTTALP
SEPSGCMWETVTSIQCTISSGMXKKEVRHARQDXRLEILSLTSMENQCMDLSTQKLXNSYXRVGIRCQSLLPHLKTHQSKLDQPGETAIR
AGWXGGARNPRRKKVSKGGDLFSKSXPSSLLLYSTPAEVSPAXTDPCHRVRASQVPPLIACLPGLQHQATAPPLTSHLVLIPPRAAPLVL
VPPIPQQGPGTSGPALSTVLHPNSAGSGTGPEGESPPATSHCPRWPGRPLQPRNPPPRSGHHPLFWDTHWAIPRSRKPFPARCTPRPPSS
DTSXGPRVRSPPGPRCSSACSPRRSCRPLTAVTRSTCAPASTAWRXPKRRCSGSSPSGRRRCRAWMRTCATCRRSAAPGQWSKAAXNAQS
PGRWAARSLWTTWTATSXRPRWWXRKQTASQRNRNPTRNPMDPGVIWKTLLCLSWKRERRKSIRRLWKGQVLLKTKRLCRRRHRWAACXR
MLFTSRPACAPARVRCRMAGCLRSTARVAGTSDGPPLLAPSRMVSATPSTGASLGRGKARRSPPRPRSFSDVKSXTASWPTSITSERKCH
LRTKRTTSALCXSPRXQLAPTNACQGTQSDPRVGSRSPRRLLRAELLSAAPMQLRXVPSLLFPSRPXQAGWTVERRSLAWLLLSPLLGRA
PPSISWKVGLSHAXSRSRALWTLLSCPDLRPPRQNCLPQSLHRAPAQVVTXGPLCHQFSPAAVGKRTIPPVQESFLLPAXRXINPTCWSL
GSCPPAEVSRIHQQFPCLTQSSRGTGKVPILLPGALEQSWKAIPNRERAAPLNTKTTPLTPSFXPAWGRTSTALTWPGHAARSHLKLPPQ
GRSQAXGNRLKEALPQPEASALLRGLTHAESPPWNCAFQKLRKPVTTPKISSLWEGPTQISIHRPRPWRKHGRRVGKRTTKMAQVRRGPR
PETTPLCTQLEFPVRRSWARXGVAWNPSPKRFLPGGLCSHLELRVRRVKSSPVSHLCRKMVPRNLKGRSSLYKGIPAASLRPLXRPKTCP
ARLPGSIAVPQATLLAESRGPSPALQSPARAPRTLPSLLLRTVKAAATSPGLALTRALQRLSTPTGPSPLRNQVSGPQRAKSLPLSPSVA
LAERGRATVRVGRMCFLLPQAPRTKPAMGLAREKVGPLSHCTLTGLLXTPSHNPPVVGGPWRCWRSLCICQGRDTQGLVSQRTRNCPLLV
KSKPCLQSTPNHPLXKIAPPCANRQTTDRQTKARVSRPPTPTEGRKGRNALKHFMLQQRATSSRPAFPLCIARTGXKARSGQPRGWGRAS
LRPEGKGPVPRSHRRRQTSPMAXNGPPQPLGRVLSDPRPSRKSLXAAPPASLKPGPELERPLQPAATPLLPRPPGACWSFQPPATGTIGR
LSLPGRAEPTXQRVTPCPPSGSPPCLWSHTTPTQTPWAGPATGTGLSRXLPPXGKPKGRTLPQPSLPQLGNRTWAETXPSHPQPQTLTAP

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000403625_chr5_66195779_+_3266aa
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATGPALDNKKCTPPIEASQCHEA
EMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPD
IHAAAFGTCLAASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDL
GSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQP
ETGPLGGGIRITILGSNLGVQAGDIQRISVAGRNCSFQPERYSVSTRRSXVSPEEEVFAEQATGKAXXAMGSHQHCLDHTHLSLLMQEIA
LKIVQEISPPVPQPIFHLHGGLMDAAGRWLLSLPLAMGQTHPALRSLHPVPPRRSCISYHTNQHQTSYTSYQNISVPPKASPLRTDAGTR
RCAPVPEVXALDVLPPAVTMKXLXXTMSTKKGSQRLQLRWKNVXRKLSPATLLTTFYPXQMECLVSLTTRLLNWLEIAWINPTRASSPHD
TSLNYSTNXISCYRRLMIVQKVENWHLLNNXFERSXLLLPALLGYXSAWNLIRKNFTTYWKQQKAMPKKDRVLKPTFPGTSLANWDSIRI
PWKKWLIWETTIVGQQKHQKQMNQXVALMPPXNFEGNLGKVILKRLNXLAMEPMGQSTLFGIKNPGRGLPXRRLINRTSSFETRSSRPLW
SGISXLLQKTPLLSACIAPLKQGATCAWSWNMWKGETVLLXXKTWVLSLLIWPECTLLRRSWPWNIYIIMELYTGIXNQTTCWLPPWGTX
SXQILDYLRWDXXAXLPTFTRVILRRMLESSWINRSVAHLNTLHQKXFXGRVMESRWTGGPWGLSSMNFWLDACHSLGILQRSYLDKSSV
MRSTGLRRMRHPHLMPRIXLPYSSGRIPWRGWEQVVHMKSNSIDSSVLXTGTVCXDRRQNLFPNWNLRMTQVILILGLRSIIIWKRRKKM
TQMMKTLMWKXGSFLHVHTGFQKFSAVXIESLRIQQKRRKTLWTKPKAPPCHPQKHXAGVQNILKCNSYQHPTLQILKATDINSVLAYFP
NWLFQQRESKMKLPPALETPMRSQESQPFLLKSVPRRSLRSPPQPAPSAAPPCQLAVFQSTWIRXMDEASVWTVQIIPQSHPVNPLLTWL
GSDXKAQKKRKSRGKSQSPSLPVLFPSXSQEICLLFPLWEVQCLPIPCPRTLLLHEIPLPAEIPQQLLPVHISRLXSTVRGRTTALPSEP
SGCMWETVTSIQCTISSGMXKKEVRHARQDXRLEILSLTSMENQCMDLSTQKLXNSYXRVGIRCQSLLPHLKTHQSKLDQPGETAIRAGW
XGGARNPRRKKVSKGGDLFSKSXPSSLLLYSTPAEVSPAXTDPCHRVRASQVPPLIACLPGLQHQATAPPLTSHLVLIPPRAAPLVLVPP
IPQQGPGTSGPALSTVLHPNSAGSGTGPEGESPPATSHCPRWPGRPLQPRNPPPRSGHHPLFWDTHWAIPRSRKPFPARCTPRPPSSDTS
XGPRVRSPPGPRCSSACSPRRSCRPLTAVTRSTCAPASTAWRXPKRRCSGSSPSGRRRCRAWMRTCATCRRSAAPGQWSKAAXNAQSPGR
WAARSLWTTWTATSXRPRWWXRKQTASQRNRNPTRNPMDPGVIWKTLLCLSWKRERRKSIRRLWKGQVLLKTKRLCRRRHRWAACXRMLF
TSRPACAPARVRCRMAGCLRSTARVAGTSDGPPLLAPSRMVSATPSTGASLGRGKARRSPPRPRSFSDVKSXTASWPTSITSERKCHLRT
KRTTSALCXSPRXQLAPTNACQGTQSDPRVGSRSPRRLLRAELLSAAPMQLRXVPSLLFPSRPXQAGWTVERRSLAWLLLSPLLGRAPPS
ISWKVGLSHAXSRSRALWTLLSCPDLRPPRQNCLPQSLHRAPAQVVTXGPLCHQFSPAAVGKRTIPPVQESFLLPAXRXINPTCWSLGSC
PPAEVSRIHQQFPCLTQSSRGTGKVPILLPGALEQSWKAIPNRERAAPLNTKTTPLTPSFXPAWGRTSTALTWPGHAARSHLKLPPQGRS
QAXGNRLKEALPQPEASALLRGLTHAESPPWNCAFQKLRKPVTTPKISSLWEGPTQISIHRPRPWRKHGRRVGKRTTKMAQVRRGPRPET
TPLCTQLEFPVRRSWARXGVAWNPSPKRFLPGGLCSHLELRVRRVKSSPVSHLCRKMVPRNLKGRSSLYKGIPAASLRPLXRPKTCPARL
PGSIAVPQATLLAESRGPSPALQSPARAPRTLPSLLLRTVKAAATSPGLALTRALQRLSTPTGPSPLRNQVSGPQRAKSLPLSPSVALAE
RGRATVRVGRMCFLLPQAPRTKPAMGLAREKVGPLSHCTLTGLLXTPSHNPPVVGGPWRCWRSLCICQGRDTQGLVSQRTRNCPLLVKSK
PCLQSTPNHPLXKIAPPCANRQTTDRQTKARVSRPPTPTEGRKGRNALKHFMLQQRATSSRPAFPLCIARTGXKARSGQPRGWGRASLRP
EGKGPVPRSHRRRQTSPMAXNGPPQPLGRVLSDPRPSRKSLXAAPPASLKPGPELERPLQPAATPLLPRPPGACWSFQPPATGTIGRLSL
PGRAEPTXQRVTPCPPSGSPPCLWSHTTPTQTPWAGPATGTGLSRXLPPXGKPKGRTLPQPSLPQLGNRTWAETXPSHPQPQTLTAPSLF

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406374_chr5_66195779_+_893aa
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATGPALDNKKCTPPIEASQCHEA
EMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPD
IHAAAFGTCLAASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDL
GSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQP

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406039_chr5_66195779_+_881aa
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAKLQLEQQVATGPALDNKKCTPPIEASQCHEA
EMTDNVNQLLLLDPPRKRLVECGSLFKGICALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPARNRTLLARMCREDPNYYSYLEMDLQCRDPD
IHAAAFGTCLAASVAAPGSGRVLYAVFSRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDL
GSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISC
VSNRWTCQWDLRYHECREASPNPEDGIVRAHMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTSECPPPVITRIQP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000404260_chr5_66195779_+_9809nt
ATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAAGCTGGACTTCTTCCGCAGC
GAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCTCTACCAGCTGGATGCGAAG
CTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGCCAGCCAGTGCCATGAGGCT
GAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAGCCTCTTCAAGGGCATCTGC
GCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGTGGCCAGCAATGATGAGGGC
GTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAATGGGCCACACGACAACGGC
ATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGCCACCTACAAGGCCGGCTAC
CTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCAGCAGGACAAGCACCCGGCC
CGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCTGCAGTGCCGGGACCCCGAC
ATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATATGCTGTCTTCAGCAGAGAC
AGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGAGGCCAACCGCAACGCCTGT
TACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCACGCGCCGGGCTCCAGCAAG
AGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGTGCTGCAGCGTGGAGGCCTG
AACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCGGATCCTCAAGGTGTACCTC
ACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCTGGTACTGTCTGGAGACCTG
GGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGACCTGCACCCAGTGCCGCGAC
TCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGCCGAGGAGGCCAGCCACTGG
CTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCAGGGGGAGGTGCAGCTGACC
GTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCCCGCCCGCGTGGAGGGCGAG
GCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCATCCAGCTCCTCCTTAGACGA
GGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAACCTGCCGTGCATCTCCTGC
GTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGAGGACGGCATCGTCCGTGCC
CACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGATGTGAACTTCCAGGGCAAG
AACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGACCATGCAGGAATCTGGGACC
TTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTCTTACGGCAAGAATATCGAC
AGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAACCCCGACTACAGGTGTGCG
TGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGTCATCACCAGGATCCAGCCT
GAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGACATCCAGAGGATCTCTGTG
GCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGAAGAGGAAGTTTTTGCCGAA
CAAGCAACCGGAAAAGCTTAATAGGCAATGGGCAGTCACCAGCATTGCCTCGACCACACTCACCTCTCTCTGCTCATGCAGGAAATAGCC
CTCAAGATAGTCCAAGAAATTTCTCCCCCAGTGCCTCAGCCCATTTTTCATTTGCACGGAGTCTCAATAGGACTGATGGACGCCGCTGGT
CGTTGGCTTCTCTCCCTTCCTCTGGCTATGGGACAAACACACCCAGCTCTACGGTCTCTTCATCCTGTTCCTCCCAGGAGAAGTTGCATC
AGTTACCATACCAACCAACACCAGACGAGTTACACTTCTTATCAAAACATTTCTGTACCACCGAAAGCATCGCCACTGAGAACAGATGCA
GGAACACGCCGATGCGCCCCCGTTCCCGAAGTCTGAGCCCTGGACGTTCTCCCGCCTGCTGTGACCATGAAATAATTATGATGAACCATG
TCTACAAAGAAAGGTTCCCAAAGGCTACAGCTCAGATGGAAGAACGTCTAAAGGAAATTATCACCAGCTACTCTCCTGACAACGTTCTAC
CCTTAGCAGATGGAGTGCTTAGTTTCACTCACCACCAGATTATTGAACTGGCTCGAGATTGCTTGGATAAATCCCACCAGGGCCTCATCA
CCTCACGATACTTCCTTGAATTACAGCACAAATTAGATAAGTTGCTACAGGAGGCTCATGATCGTTCAGAAAGTGGAGAATTGGCATTTA
TTAAACAACTAGTTCGAAAGATCCTAATTGTTATTGCCCGCCCTGCTCGGTTATTAGAGTGCCTGGAATTTGATCCGGAAGAATTTTACT
ACCTATTGGAAGCAGCAGAAGGCCATGCCAAAGAAGGACAGGGTATTAAAACCGACATTCCCAGGTACATCATTAGCCAACTGGGACTCA
ATAAGGATCCCTTGGAAGAAATGGCTCATTTGGGAAACTACGATAGTGGGACAGCAGAAACACCAGAAACAGATGAATCAGTGAGTAGCT
CTAATGCCTCCCTGAAACTTCGAAGGAAACCTCGGGAAAGTGATTTTGAAACGATTAAATTGATTAGCAATGGAGCCTATGGGGCAGTCT
ACTTTGTTCGGCATAAAGAATCCCGGCAGAGGTTTGCCATGAAGAAGATTAATAAACAGAACCTCATCCTTCGAAACCAGATCCAGCAGG
CCTTTGTGGAGCGGGATATCCTGACTTTTGCAGAAAACCCCTTTGTTGTCAGCATGTATTGCTCCTTTGAAACAAGGCGCCACTTGTGCA
TGGTCATGGAATATGTGGAAGGGGGAGACTGTGCTACTTTAATGAAAAACATGGGTCCTCTCCCTGTTGATATGGCCAGAATGTACTTTG
CTGAGACGGTCTTGGCCTTGGAATATTTACATAATTATGGAATTGTACACAGGGATTTGAAACCAGACAACTTGTTGGTTACCTCCATGG
GGCACATAAAGCTGACAGATTTTGGATTATCTAAGGTGGGACTAATGAGCATGACTACCAACCTTTACGAGGGTCATATTGAGAAGGATG
CTAGAGAGTTCCTGGATAAACAGGTCTGTGGCACACCTGAATACATTGCACCAGAAGTGATTCTGAGGCAGGGTTATGGAAAGCCGGTGG
ACTGGTGGGCCATGGGGATTATCCTCTATGAATTTCTGGTTGGATGCGTGCCATTCTTTGGGGATACTCCAGAGGAGCTATTTGGACAAG
TCATCAGTGATGAGATCAACTGGCCTGAGAAGGATGAGGCACCCCCACCTGATGCCCAGGATCTGATTACCTTACTCCTCAGGCAGAATC
CCCTGGAGAGGCTGGGAACAGGTGGTGCATATGAAGTCAAACAGCATCGATTCTTCCGTTCTTTAGACTGGAACAGTTTGCTGAGACAGA
AGGCAGAATTTATTCCCCAACTGGAATCTGAGGATGACACAAGTTATTTTGATACTCGGTCTGAGAAGTATCATCATATGGAAACGGAGG
AAGAAGATGACACAAATGATGAAGACTTTAATGTGGAAATAAGGCAGTTTTCTTCATGTTCACACAGGTTTTCAAAAGTTTTCAGCAGTA
TAGATCGAATCACTCAGAATTCAGCAGAAGAGAAGGAAGACTCTGTGGACAAAACCAAAAGCACCACCTTGCCATCCACAGAAACACTGA
GCTGGAGTTCAGAATATTCTGAAATGCAACAGCTATCAACATCCAACTCTTCAGATACTGAAAGCAACAGACATAAACTCAGTTCTGGCC
TACTTCCCAAACTGGCTATTTCAACAGAGGGAGAGCAAGATGAAGCTGCCTCCTGCCCTGGAGACCCCCATGAGGAGCCAGGAAAGCCAG
CCCTTCCTCCTGAAGAGTGTGCCCAGGAGGAGCCTGAGGTCACCACCCCAGCCAGCACCATCAGCAGCTCCACCCTGTCAGTTGGCAGTT
TTTCAGAGCACTTGGATCAGATAAATGGACGAAGCGAGTGTGTGGACAGTACAGATAATTCCTCAAAGCCATCCAGTGAACCCGCTTCTC
ACATGGCTCGGCAGCGATTAGAAAGCACAGAAAAAAAGAAAATCTCGGGGAAAGTCACAAAGTCCCTCTCTGCCAGTGCTCTTTCCCTCA
TGATCCCAGGAGATATGTTTGCTGTTTCCCCTCTGGGAAGTCCAATGTCTCCCCATTCCCTGTCCTCGGACCCTTCTTCTTCACGAGATT
CCTCTCCCAGCCGAGATTCCTCAGCAGCTTCTGCCAGTCCACATCAGCCGATTGTGATCCACAGTTCGGGGAAGAACTACGGCTTTACCA
TCCGAGCCATCCGGGTGTATGTGGGAGACAGTGACATCTATACAGTGCACCATATCGTCTGGAATGTAGAAGAAGGAAGTCCGGCATGCC
AGGCAGGACTGAAGGCTGGAGATCTTATCACTCACATCAATGGAGAACCAGTGCATGGACTTGTCCACACAGAAGTTATAGAACTCCTAC
TGAAGAGTGGGAATAAGGTGTCAATCACTACTACCCCATTTGAAAACACATCAATCAAAACTGGACCAGCCAGGAGAAACAGCTATAAGA
GCCGGATGGTGAGGCGGAGCAAGAAATCCAAGAAGAAAGAAAGTCTCGAAAGGAGGAGATCTCTTTTCAAAAAGCTAGCCAAGCAGCCTT
CTCCTTTACTCCACACCAGCCGAAGTTTCTCCTGCTTGAACAGATCCCTGTCATCGGGTGAGAGCCTCCCAGGTTCCCCCACTCATAGCT
TGTCTCCCCGGTCTCCAACACCAAGCTACCGCTCCACCCCTGACTTCCCATCTGGTACTAATTCCTCCCAGAGCAGCTCCCCTAGTTCTA
GTGCCCCCAATTCCCCAGCAGGGTCCGGGCACATCCGGCCCAGCACTCTCCACGGTCTTGCACCCAAACTCGGCGGGCAGCGGTACCGGT
CCGGAAGGCGAAAGTCCGCCGGCAACATCCCACTGTCCCCGCTGGCCCGGACGCCCTCTCCAACCCCGCAACCCACCTCCCCGCAGCGGT
CACCATCCCCTCTTCTGGGACACTCACTGGGCAATTCCAAGATCGCGCAAGCCTTTCCCAGCAAGATGCACTCCCCGCCCACCATCGTCA
GACACATCGTGAGGCCCAAGAGTGCGGAGCCCCCCAGGTCCCCGCTGCTCAAGCGCGTGCAGTCCGAGGAGAAGCTGTCGCCCTCTTACG
GCAGTGACAAGAAGCACCTGTGCTCCCGCAAGCACAGCCTGGAGGTGACCCAAGAGGAGGTGCAGCGGGAGCAGTCCCAGCGGGAGGCGC
CGCTGCAGAGCCTGGATGAGAACGTGTGCGACGTGCCGCCGCTCAGCCGCGCCCGGCCAGTGGAGCAAGGCTGCCTGAAACGCCCAGTCT
CCCGGAAGGTGGGCCGCCAGGAGTCTGTGGACGACCTGGACCGCGACAAGCTGAAGGCCAAGGTGGTGGTGAAGAAAGCAGACGGCTTCC
CAGAGAAACAGGAATCCCACCAGAAATCCCATGGACCCGGGAGTGATTTGGAAAACTTTGCTCTGTTTAAGCTGGAAGAGAGAGAGAAGA
AAGTCTATCCGAAGGCTGTGGAAAGGTCAAGTACTTTTGAAAACAAAGCGTCTATGCAGGAGGCGCCACCGCTGGGCAGCCTGCTGAAGG
ATGCTCTTCACAAGCAGGCCAGCGTGCGCGCCAGCGAGGGTGCGATGTCGGATGGCCGGGTGCCTGCGGAGCACCGCCAGGGTGGCGGGG
ACTTCAGACGGGCCCCCGCTCCTGGCACCCTCCAGGATGGTCTCTGCCACTCCCTCGACAGGGGCATCTCTGGGAAGGGGGAAGGCACGG
AGAAGTCCTCCCAGGCCAAGGAGCTTCTCCGATGTGAAAAGTTAGACAGCAAGCTGGCCAACATCGATTACCTCCGAAAGAAAATGTCAC
TTGAGGACAAAGAGGACAACCTCTGCCCTGTGCTGAAGCCCAAGATGACAGCTGGCTCCCACGAATGCCTGCCAGGGAACCCAGTCCGAC
CCACGGGTGGGCAGCAGGAGCCCCCGCCGGCTTCTGAGAGCCGAGCTTTTGTCAGCAGCACCCATGCAGCTCAGATGAGTGCCGTCTCTT
TTGTTCCCCTCAAGGCCTTAACAGGCCGGGTGGACAGTGGAACGGAGAAGCCTGGCTTGGTTGCTCCTGAGTCCCCTGTTAGGAAGAGCC
CCTCCGAGTATAAGCTGGAAGGTAGGTCTGTCTCATGCCTGAAGCCGATCGAGGGCACTCTGGACATTGCTCTCCTGTCCGGACCTCAGG
CCTCCAAGACAGAACTGCCTTCCCCAGAGTCTGCACAGAGCCCCAGCCCAAGTGGTGACGTGAGGGCCTCTGTGCCACCAGTTCTCCCCA
GCAGCAGTGGGAAAAAGAACGATACCACCAGTGCAAGAGAGCTTTCTCCTTCCAGCTTAAAGATGAATAAATCCTACCTGCTGGAGCCTT
GGTTCCTGCCCCCCAGCCGAGGTCTCCAGAATTCACCAGCAGTTTCCCTGCCTGACCCAGAGTTCAAGAGGGACAGGAAAGGTCCCCATC
CTACTGCCAGGAGCCCTGGAACAGTCATGGAAAGCAATCCCCAACAGAGAGAGGGCAGCTCCCCTAAACACCAAGACCACACCACTGACC
CCAAGCTTCTGACCTGCCTGGGGCAGAACCTCCACAGCCCTGACCTGGCCAGGCCACGCTGCCCGCTCCCACCTGAAGCTTCCCCCTCAA
GGGAGAAGCCAGGCCTGAGGGAATCGTCTGAAAGAGGCCCTCCCACAGCCAGAAGCGAGCGCTCTGCTGCGAGGGCTGACACATGCAGAG
AGCCCTCCATGGAACTGTGCTTTCCAGAAACTGCGAAAACCAGTGACAACTCCAAAAATCTCCTCTCTGTGGGAAGGACCCACCCAGATT
TCTATACACAGACCCAGGCCATGGAGAAAGCATGGGCGCCGGGTGGGAAAACGAACCACAAAGATGGCCCAGGTGAGGCGAGGCCCCCGC
CCAGAGACAACTCCTCTCTGCACTCAGCTGGAATTCCCTGTGAGAAGGAGCTGGGCAAGGTGAGGCGTGGCGTGGAACCCAAGCCCGAAG
CGCTTCTTGCCAGGCGGTCTCTGCAGCCACCTGGAATTGAGAGTGAGAAGAGTGAAAAGCTCTCCAGTTTCCCATCTTTGCAGAAAGATG
GTGCCAAGGAACCTGAAAGGAAGGAGCAGCCTCTACAAAGGCATCCCAGCAGCATCCCTCCGCCCCCTCTGACGGCCAAAGACCTGTCCA
GCCCGGCTGCCAGGCAGCATTGCAGTTCCCCAAGCCACGCTTCTGGCAGAGAGCCGGGGGCCAAGCCCAGCACTGCAGAGCCCAGCTCGA
GCCCCCAGGACCCTCCCAAGCCTGTTGCTGCGCACAGTGAAAGCAGCAGCCACAAGCCCCGGCCTGGCCCTGACCCGGGCCCTCCAAAGA
CTAAGCACCCCGACCGGTCCCTCTCCTCTCAGAAACCAAGTGTCGGGGCCACAAAGGGCAAAGAGCCTGCCACTCAGTCCCTCGGTGGCT
CTAGCAGAGAGGGGAAGGGCCACAGTAAGAGTGGGCCGGATGTGTTTCCTGCTACCCCAGGCTCCCAGAACAAAGCCAGCGATGGGATTG
GCCAGGGAGAAGGTGGGCCCTCTGTCCCACTGCACACTGACAGGGCTCCTCTAGACGCCAAGCCACAACCCACCAGTGGTGGGCGGCCCC
TGGAGGTGCTGGAGAAGCCTGTGCATTTGCCAAGGCCGGGACACCCAGGGCCTAGTGAGCCAGCGGACCAGAAACTGTCCGCTGTTGGTG
AAAAGCAAACCCTGTCTCCAAAGCACCCCAAACCATCCACTGTGAAAGATTGCCCCACCCTGTGCAAACAGACAGACAACAGACAGACAG
ACAAAAGCCCGAGTCAGCCGGCCGCCAACACCGACAGAAGGGCGGAAGGGAAGAAATGCACTGAAGCACTTTATGCTCCAGCAGAGGGCG
ACAAGCTCGAGGCCGGCCTTTCCTTTGTGCATAGCGAGAACCGGTTGAAAGGCGCGGAGCGGCCAGCCGCGGGGGTGGGGAAGGGCTTCC
CTGAGGCCAGAGGGAAAGGGCCCGGTCCCCAGAAGCCACCGACGGAGGCAGACAAGCCCAATGGCATGAAACGGTCCCCCTCAGCCACTG
GGCAGAGTTCTTTCCGATCCACGGCCCTCCCGGAAAAGTCTCTGAGCTGCTCCTCCAGCTTCCCTGAAACCAGGGCCGGAGTTAGAGAGG
CCTCTGCAGCCAGCAGCGACACCTCTTCTGCCAAGGCCGCCGGGGGCATGCTGGAGCTTCCAGCCCCCAGCAACAGGGACCATAGGAAGG
CTCAGCCTGCCGGGGAGGGCCGAACCCACATGACAAAGAGTGACTCCCTGCCCTCCTTCCGGGTCTCCACCCTGCCTCTGGAGTCACACC
ACCCCGACCCAAACACCATGGGCGGGGCCAGCCACCGGGACAGGGCTCTCTCGGTGACTGCCACCGTAGGGGAAACCAAAGGGAAGGACC
CTGCCCCAGCCCAGCCTCCCCCAGCTAGGAAACAGAACGTGGGCAGAGACGTGACCAAGCCATCCCCAGCCCCAAACACTGACCGCCCCA

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000403625_chr5_66195779_+_9800nt
ATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAAGCTGGACTTCTTCCGCAGC
GAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCTCTACCAGCTGGATGCGAAG
CTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGCCAGCCAGTGCCATGAGGCT
GAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAGCCTCTTCAAGGGCATCTGC
GCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGTGGCCAGCAATGATGAGGGC
GTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAATGGGCCACACGACAACGGC
ATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGCCACCTACAAGGCCGGCTAC
CTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCAGCAGGACAAGCACCCGGCC
CGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCTGCAGTGCCGGGACCCCGAC
ATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATATGCTGTCTTCAGCAGAGAC
AGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGAGGCCAACCGCAACGCCTGT
TACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCACGCGCCGGGCTCCAGCAAG
AGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGTGCTGCAGCGTGGAGGCCTG
AACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCGGATCCTCAAGGTGTACCTC
ACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCTGGTACTGTCTGGAGACCTG
GGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGACCTGCACCCAGTGCCGCGAC
TCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGCCGAGGAGGCCAGCCACTGG
CTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCAGGGGGAGGTGCAGCTGACC
GTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCCCGCCCGCGTGGAGGGCGAG
GCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCATCCAGCTCCTCCTTAGACGA
GGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAACCTGCCGTGCATCTCCTGC
GTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGAGGACGGCATCGTCCGTGCC
CACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGATGTGAACTTCCAGGGCAAG
AACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGACCATGCAGGAATCTGGGACC
TTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTCTTACGGCAAGAATATCGAC
AGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAACCCCGACTACAGGTGTGCG
TGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGTCATCACCAGGATCCAGCCT
GAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGACATCCAGAGGATCTCTGTG
GCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGAAGAGGAAGTTTTTGCCGAA
CAAGCAACCGGAAAAGCTTAATAGGCAATGGGCAGTCACCAGCATTGCCTCGACCACACTCACCTCTCTCTGCTCATGCAGGAAATAGCC
CTCAAGATAGTCCAAGAAATTTCTCCCCCAGTGCCTCAGCCCATTTTTCATTTGCACGGAGGACTGATGGACGCCGCTGGTCGTTGGCTT
CTCTCCCTTCCTCTGGCTATGGGACAAACACACCCAGCTCTACGGTCTCTTCATCCTGTTCCTCCCAGGAGAAGTTGCATCAGTTACCAT
ACCAACCAACACCAGACGAGTTACACTTCTTATCAAAACATTTCTGTACCACCGAAAGCATCGCCACTGAGAACAGATGCAGGAACACGC
CGATGCGCCCCCGTTCCCGAAGTCTGAGCCCTGGACGTTCTCCCGCCTGCTGTGACCATGAAATAATTATGATGAACCATGTCTACAAAG
AAAGGTTCCCAAAGGCTACAGCTCAGATGGAAGAACGTCTAAAGGAAATTATCACCAGCTACTCTCCTGACAACGTTCTACCCTTAGCAG
ATGGAGTGCTTAGTTTCACTCACCACCAGATTATTGAACTGGCTCGAGATTGCTTGGATAAATCCCACCAGGGCCTCATCACCTCACGAT
ACTTCCTTGAATTACAGCACAAATTAGATAAGTTGCTACAGGAGGCTCATGATCGTTCAGAAAGTGGAGAATTGGCATTTATTAAACAAC
TAGTTCGAAAGATCCTAATTGTTATTGCCCGCCCTGCTCGGTTATTAGAGTGCCTGGAATTTGATCCGGAAGAATTTTACTACCTATTGG
AAGCAGCAGAAGGCCATGCCAAAGAAGGACAGGGTATTAAAACCGACATTCCCAGGTACATCATTAGCCAACTGGGACTCAATAAGGATC
CCTTGGAAGAAATGGCTCATTTGGGAAACTACGATAGTGGGACAGCAGAAACACCAGAAACAGATGAATCAGTGAGTAGCTCTAATGCCT
CCCTGAAACTTCGAAGGAAACCTCGGGAAAGTGATTTTGAAACGATTAAATTGATTAGCAATGGAGCCTATGGGGCAGTCTACTTTGTTC
GGCATAAAGAATCCCGGCAGAGGTTTGCCATGAAGAAGATTAATAAACAGAACCTCATCCTTCGAAACCAGATCCAGCAGGCCTTTGTGG
AGCGGGATATCCTGACTTTTGCAGAAAACCCCTTTGTTGTCAGCATGTATTGCTCCTTTGAAACAAGGCGCCACTTGTGCATGGTCATGG
AATATGTGGAAGGGGGAGACTGTGCTACTTTAATGAAAAACATGGGTCCTCTCCCTGTTGATATGGCCAGAATGTACTTTGCTGAGACGG
TCTTGGCCTTGGAATATTTACATAATTATGGAATTGTACACAGGGATTTGAAACCAGACAACTTGTTGGTTACCTCCATGGGGCACATAA
AGCTGACAGATTTTGGATTATCTAAGGTGGGACTAATGAGCATGACTACCAACCTTTACGAGGGTCATATTGAGAAGGATGCTAGAGAGT
TCCTGGATAAACAGGTCTGTGGCACACCTGAATACATTGCACCAGAAGTGATTCTGAGGCAGGGTTATGGAAAGCCGGTGGACTGGTGGG
CCATGGGGATTATCCTCTATGAATTTCTGGTTGGATGCGTGCCATTCTTTGGGGATACTCCAGAGGAGCTATTTGGACAAGTCATCAGTG
ATGAGATCAACTGGCCTGAGAAGGATGAGGCACCCCCACCTGATGCCCAGGATCTGATTACCTTACTCCTCAGGCAGAATCCCCTGGAGA
GGCTGGGAACAGGTGGTGCATATGAAGTCAAACAGCATCGATTCTTCCGTTCTTTAGACTGGAACAGTTTGCTGAGACAGAAGGCAGAAT
TTATTCCCCAACTGGAATCTGAGGATGACACAAGTTATTTTGATACTCGGTCTGAGAAGTATCATCATATGGAAACGGAGGAAGAAGATG
ACACAAATGATGAAGACTTTAATGTGGAAATAAGGCAGTTTTCTTCATGTTCACACAGGTTTTCAAAAGTTTTCAGCAGTATAGATCGAA
TCACTCAGAATTCAGCAGAAGAGAAGGAAGACTCTGTGGACAAAACCAAAAGCACCACCTTGCCATCCACAGAAACACTGAGCTGGAGTT
CAGAATATTCTGAAATGCAACAGCTATCAACATCCAACTCTTCAGATACTGAAAGCAACAGACATAAACTCAGTTCTGGCCTACTTCCCA
AACTGGCTATTTCAACAGAGGGAGAGCAAGATGAAGCTGCCTCCTGCCCTGGAGACCCCCATGAGGAGCCAGGAAAGCCAGCCCTTCCTC
CTGAAGAGTGTGCCCAGGAGGAGCCTGAGGTCACCACCCCAGCCAGCACCATCAGCAGCTCCACCCTGTCAGTTGGCAGTTTTTCAGAGC
ACTTGGATCAGATAAATGGACGAAGCGAGTGTGTGGACAGTACAGATAATTCCTCAAAGCCATCCAGTGAACCCGCTTCTCACATGGCTC
GGCAGCGATTAGAAAGCACAGAAAAAAAGAAAATCTCGGGGAAAGTCACAAAGTCCCTCTCTGCCAGTGCTCTTTCCCTCATGATCCCAG
GAGATATGTTTGCTGTTTCCCCTCTGGGAAGTCCAATGTCTCCCCATTCCCTGTCCTCGGACCCTTCTTCTTCACGAGATTCCTCTCCCA
GCCGAGATTCCTCAGCAGCTTCTGCCAGTCCACATCAGCCGATTGTGATCCACAGTTCGGGGAAGAACTACGGCTTTACCATCCGAGCCA
TCCGGGTGTATGTGGGAGACAGTGACATCTATACAGTGCACCATATCGTCTGGAATGTAGAAGAAGGAAGTCCGGCATGCCAGGCAGGAC
TGAAGGCTGGAGATCTTATCACTCACATCAATGGAGAACCAGTGCATGGACTTGTCCACACAGAAGTTATAGAACTCCTACTGAAGAGTG
GGAATAAGGTGTCAATCACTACTACCCCATTTGAAAACACATCAATCAAAACTGGACCAGCCAGGAGAAACAGCTATAAGAGCCGGATGG
TGAGGCGGAGCAAGAAATCCAAGAAGAAAGAAAGTCTCGAAAGGAGGAGATCTCTTTTCAAAAAGCTAGCCAAGCAGCCTTCTCCTTTAC
TCCACACCAGCCGAAGTTTCTCCTGCTTGAACAGATCCCTGTCATCGGGTGAGAGCCTCCCAGGTTCCCCCACTCATAGCTTGTCTCCCC
GGTCTCCAACACCAAGCTACCGCTCCACCCCTGACTTCCCATCTGGTACTAATTCCTCCCAGAGCAGCTCCCCTAGTTCTAGTGCCCCCA
ATTCCCCAGCAGGGTCCGGGCACATCCGGCCCAGCACTCTCCACGGTCTTGCACCCAAACTCGGCGGGCAGCGGTACCGGTCCGGAAGGC
GAAAGTCCGCCGGCAACATCCCACTGTCCCCGCTGGCCCGGACGCCCTCTCCAACCCCGCAACCCACCTCCCCGCAGCGGTCACCATCCC
CTCTTCTGGGACACTCACTGGGCAATTCCAAGATCGCGCAAGCCTTTCCCAGCAAGATGCACTCCCCGCCCACCATCGTCAGACACATCG
TGAGGCCCAAGAGTGCGGAGCCCCCCAGGTCCCCGCTGCTCAAGCGCGTGCAGTCCGAGGAGAAGCTGTCGCCCTCTTACGGCAGTGACA
AGAAGCACCTGTGCTCCCGCAAGCACAGCCTGGAGGTGACCCAAGAGGAGGTGCAGCGGGAGCAGTCCCAGCGGGAGGCGCCGCTGCAGA
GCCTGGATGAGAACGTGTGCGACGTGCCGCCGCTCAGCCGCGCCCGGCCAGTGGAGCAAGGCTGCCTGAAACGCCCAGTCTCCCGGAAGG
TGGGCCGCCAGGAGTCTGTGGACGACCTGGACCGCGACAAGCTGAAGGCCAAGGTGGTGGTGAAGAAAGCAGACGGCTTCCCAGAGAAAC
AGGAATCCCACCAGAAATCCCATGGACCCGGGAGTGATTTGGAAAACTTTGCTCTGTTTAAGCTGGAAGAGAGAGAGAAGAAAGTCTATC
CGAAGGCTGTGGAAAGGTCAAGTACTTTTGAAAACAAAGCGTCTATGCAGGAGGCGCCACCGCTGGGCAGCCTGCTGAAGGATGCTCTTC
ACAAGCAGGCCAGCGTGCGCGCCAGCGAGGGTGCGATGTCGGATGGCCGGGTGCCTGCGGAGCACCGCCAGGGTGGCGGGGACTTCAGAC
GGGCCCCCGCTCCTGGCACCCTCCAGGATGGTCTCTGCCACTCCCTCGACAGGGGCATCTCTGGGAAGGGGGAAGGCACGGAGAAGTCCT
CCCAGGCCAAGGAGCTTCTCCGATGTGAAAAGTTAGACAGCAAGCTGGCCAACATCGATTACCTCCGAAAGAAAATGTCACTTGAGGACA
AAGAGGACAACCTCTGCCCTGTGCTGAAGCCCAAGATGACAGCTGGCTCCCACGAATGCCTGCCAGGGAACCCAGTCCGACCCACGGGTG
GGCAGCAGGAGCCCCCGCCGGCTTCTGAGAGCCGAGCTTTTGTCAGCAGCACCCATGCAGCTCAGATGAGTGCCGTCTCTTTTGTTCCCC
TCAAGGCCTTAACAGGCCGGGTGGACAGTGGAACGGAGAAGCCTGGCTTGGTTGCTCCTGAGTCCCCTGTTAGGAAGAGCCCCTCCGAGT
ATAAGCTGGAAGGTAGGTCTGTCTCATGCCTGAAGCCGATCGAGGGCACTCTGGACATTGCTCTCCTGTCCGGACCTCAGGCCTCCAAGA
CAGAACTGCCTTCCCCAGAGTCTGCACAGAGCCCCAGCCCAAGTGGTGACGTGAGGGCCTCTGTGCCACCAGTTCTCCCCAGCAGCAGTG
GGAAAAAGAACGATACCACCAGTGCAAGAGAGCTTTCTCCTTCCAGCTTAAAGATGAATAAATCCTACCTGCTGGAGCCTTGGTTCCTGC
CCCCCAGCCGAGGTCTCCAGAATTCACCAGCAGTTTCCCTGCCTGACCCAGAGTTCAAGAGGGACAGGAAAGGTCCCCATCCTACTGCCA
GGAGCCCTGGAACAGTCATGGAAAGCAATCCCCAACAGAGAGAGGGCAGCTCCCCTAAACACCAAGACCACACCACTGACCCCAAGCTTC
TGACCTGCCTGGGGCAGAACCTCCACAGCCCTGACCTGGCCAGGCCACGCTGCCCGCTCCCACCTGAAGCTTCCCCCTCAAGGGAGAAGC
CAGGCCTGAGGGAATCGTCTGAAAGAGGCCCTCCCACAGCCAGAAGCGAGCGCTCTGCTGCGAGGGCTGACACATGCAGAGAGCCCTCCA
TGGAACTGTGCTTTCCAGAAACTGCGAAAACCAGTGACAACTCCAAAAATCTCCTCTCTGTGGGAAGGACCCACCCAGATTTCTATACAC
AGACCCAGGCCATGGAGAAAGCATGGGCGCCGGGTGGGAAAACGAACCACAAAGATGGCCCAGGTGAGGCGAGGCCCCCGCCCAGAGACA
ACTCCTCTCTGCACTCAGCTGGAATTCCCTGTGAGAAGGAGCTGGGCAAGGTGAGGCGTGGCGTGGAACCCAAGCCCGAAGCGCTTCTTG
CCAGGCGGTCTCTGCAGCCACCTGGAATTGAGAGTGAGAAGAGTGAAAAGCTCTCCAGTTTCCCATCTTTGCAGAAAGATGGTGCCAAGG
AACCTGAAAGGAAGGAGCAGCCTCTACAAAGGCATCCCAGCAGCATCCCTCCGCCCCCTCTGACGGCCAAAGACCTGTCCAGCCCGGCTG
CCAGGCAGCATTGCAGTTCCCCAAGCCACGCTTCTGGCAGAGAGCCGGGGGCCAAGCCCAGCACTGCAGAGCCCAGCTCGAGCCCCCAGG
ACCCTCCCAAGCCTGTTGCTGCGCACAGTGAAAGCAGCAGCCACAAGCCCCGGCCTGGCCCTGACCCGGGCCCTCCAAAGACTAAGCACC
CCGACCGGTCCCTCTCCTCTCAGAAACCAAGTGTCGGGGCCACAAAGGGCAAAGAGCCTGCCACTCAGTCCCTCGGTGGCTCTAGCAGAG
AGGGGAAGGGCCACAGTAAGAGTGGGCCGGATGTGTTTCCTGCTACCCCAGGCTCCCAGAACAAAGCCAGCGATGGGATTGGCCAGGGAG
AAGGTGGGCCCTCTGTCCCACTGCACACTGACAGGGCTCCTCTAGACGCCAAGCCACAACCCACCAGTGGTGGGCGGCCCCTGGAGGTGC
TGGAGAAGCCTGTGCATTTGCCAAGGCCGGGACACCCAGGGCCTAGTGAGCCAGCGGACCAGAAACTGTCCGCTGTTGGTGAAAAGCAAA
CCCTGTCTCCAAAGCACCCCAAACCATCCACTGTGAAAGATTGCCCCACCCTGTGCAAACAGACAGACAACAGACAGACAGACAAAAGCC
CGAGTCAGCCGGCCGCCAACACCGACAGAAGGGCGGAAGGGAAGAAATGCACTGAAGCACTTTATGCTCCAGCAGAGGGCGACAAGCTCG
AGGCCGGCCTTTCCTTTGTGCATAGCGAGAACCGGTTGAAAGGCGCGGAGCGGCCAGCCGCGGGGGTGGGGAAGGGCTTCCCTGAGGCCA
GAGGGAAAGGGCCCGGTCCCCAGAAGCCACCGACGGAGGCAGACAAGCCCAATGGCATGAAACGGTCCCCCTCAGCCACTGGGCAGAGTT
CTTTCCGATCCACGGCCCTCCCGGAAAAGTCTCTGAGCTGCTCCTCCAGCTTCCCTGAAACCAGGGCCGGAGTTAGAGAGGCCTCTGCAG
CCAGCAGCGACACCTCTTCTGCCAAGGCCGCCGGGGGCATGCTGGAGCTTCCAGCCCCCAGCAACAGGGACCATAGGAAGGCTCAGCCTG
CCGGGGAGGGCCGAACCCACATGACAAAGAGTGACTCCCTGCCCTCCTTCCGGGTCTCCACCCTGCCTCTGGAGTCACACCACCCCGACC
CAAACACCATGGGCGGGGCCAGCCACCGGGACAGGGCTCTCTCGGTGACTGCCACCGTAGGGGAAACCAAAGGGAAGGACCCTGCCCCAG
CCCAGCCTCCCCCAGCTAGGAAACAGAACGTGGGCAGAGACGTGACCAAGCCATCCCCAGCCCCAAACACTGACCGCCCCATCTCTCTTT

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406374_chr5_66195779_+_2681nt
ATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAAGCTGGACTTCTTCCGCAGC
GAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCTCTACCAGCTGGATGCGAAG
CTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGCCAGCCAGTGCCATGAGGCT
GAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAGCCTCTTCAAGGGCATCTGC
GCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGTGGCCAGCAATGATGAGGGC
GTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAATGGGCCACACGACAACGGC
ATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGCCACCTACAAGGCCGGCTAC
CTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCAGCAGGACAAGCACCCGGCC
CGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCTGCAGTGCCGGGACCCCGAC
ATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATATGCTGTCTTCAGCAGAGAC
AGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGAGGCCAACCGCAACGCCTGT
TACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCACGCGCCGGGCTCCAGCAAG
AGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGTGCTGCAGCGTGGAGGCCTG
AACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCGGATCCTCAAGGTGTACCTC
ACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCTGGTACTGTCTGGAGACCTG
GGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGACCTGCACCCAGTGCCGCGAC
TCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGCCGAGGAGGCCAGCCACTGG
CTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCAGGGGGAGGTGCAGCTGACC
GTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCCCGCCCGCGTGGAGGGCGAG
GCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCATCCAGCTCCTCCTTAGACGA
GGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAACCTGCCGTGCATCTCCTGC
GTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGAGGACGGCATCGTCCGTGCC
CACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGATGTGAACTTCCAGGGCAAG
AACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGACCATGCAGGAATCTGGGACC
TTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTCTTACGGCAAGAATATCGAC
AGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAACCCCGACTACAGGTGTGCG
TGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGTCATCACCAGGATCCAGCCT
GAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGACATCCAGAGGATCTCTGTG
GCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGAAGAGGAAGTTTGATAGATT

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406039_chr5_66195779_+_2645nt
ATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAAGCTGGACTTCTTCCGCAGC
GAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCTCTACCAGCTGGATGCGAAG
CTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGCCAGCCAGTGCCATGAGGCT
GAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAGCCTCTTCAAGGGCATCTGC
GCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGTGGCCAGCAATGATGAGGGC
GTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAATGGGCCACACGACAACGGC
ATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGCCACCTACAAGGCCGGCTAC
CTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCAGCAGGACAAGCACCCGGCC
CGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCTGCAGTGCCGGGACCCCGAC
ATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATATGCTGTCTTCAGCAGAGAC
AGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGAGGCCAACCGCAACGCCTGT
TACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCACGCGCCGGGCTCCAGCAAG
AGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGTGCTGCAGCGTGGAGGCCTG
AACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCGGATCCTCAAGGTGTACCTC
ACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCTGGTACTGTCTGGAGACCTG
GGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGACCTGCACCCAGTGCCGCGAC
TCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGCCGAGGAGGCCAGCCACTGG
CTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCAGGGGGAGGTGCAGCTGACC
GTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCCCGCCCGCGTGGAGGGCGAG
GCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCATCCAGCTCCTCCTTAGACGA
GGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAACCTGCCGTGCATCTCCTGC
GTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGAGGACGGCATCGTCCGTGCC
CACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGATGTGAACTTCCAGGGCAAG
AACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGACCATGCAGGAATCTGGGACC
TTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTCTTACGGCAAGAATATCGAC
AGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAACCCCGACTACAGGTGTGCG
TGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGTCATCACCAGGATCCAGCCT
GAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGACATCCAGAGGATCTCTGTG
GCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGAAGAGGAAGTTTCCCTGTGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000404260_chr5_66195779_+_12462nt
CCCGGGCGCCATCGAGCCTTGGCGGCGGACGTGCAGAGAATCTCGATGCTGGCCTGGAGCAGAAACTGAGCTGGACCACTGGAGCCTCGG
TGAGGGGGTGCGGGGGGCAATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAA
GCTGGACTTCTTCCGCAGCGAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCT
CTACCAGCTGGATGCGAAGCTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGC
CAGCCAGTGCCATGAGGCTGAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAG
CCTCTTCAAGGGCATCTGCGCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGT
GGCCAGCAATGATGAGGGCGTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAA
TGGGCCACACGACAACGGCATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGC
CACCTACAAGGCCGGCTACCTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCA
GCAGGACAAGCACCCGGCCCGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCT
GCAGTGCCGGGACCCCGACATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATA
TGCTGTCTTCAGCAGAGACAGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGA
GGCCAACCGCAACGCCTGTTACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCA
CGCGCCGGGCTCCAGCAAGAGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGT
GCTGCAGCGTGGAGGCCTGAACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCG
GATCCTCAAGGTGTACCTCACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCT
GGTACTGTCTGGAGACCTGGGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGAC
CTGCACCCAGTGCCGCGACTCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGC
CGAGGAGGCCAGCCACTGGCTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCA
GGGGGAGGTGCAGCTGACCGTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCC
CGCCCGCGTGGAGGGCGAGGCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCAT
CCAGCTCCTCCTTAGACGAGGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAA
CCTGCCGTGCATCTCCTGCGTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGA
GGACGGCATCGTCCGTGCCCACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGA
TGTGAACTTCCAGGGCAAGAACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGAC
CATGCAGGAATCTGGGACCTTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTC
TTACGGCAAGAATATCGACAGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAA
CCCCGACTACAGGTGTGCGTGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGT
CATCACCAGGATCCAGCCTGAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGA
CATCCAGAGGATCTCTGTGGCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGA
AGAGGAAGTTTTTGCCGAACAAGCAACCGGAAAAGCTTAATAGGCAATGGGCAGTCACCAGCATTGCCTCGACCACACTCACCTCTCTCT
GCTCATGCAGGAAATAGCCCTCAAGATAGTCCAAGAAATTTCTCCCCCAGTGCCTCAGCCCATTTTTCATTTGCACGGAGTCTCAATAGG
ACTGATGGACGCCGCTGGTCGTTGGCTTCTCTCCCTTCCTCTGGCTATGGGACAAACACACCCAGCTCTACGGTCTCTTCATCCTGTTCC
TCCCAGGAGAAGTTGCATCAGTTACCATACCAACCAACACCAGACGAGTTACACTTCTTATCAAAACATTTCTGTACCACCGAAAGCATC
GCCACTGAGAACAGATGCAGGAACACGCCGATGCGCCCCCGTTCCCGAAGTCTGAGCCCTGGACGTTCTCCCGCCTGCTGTGACCATGAA
ATAATTATGATGAACCATGTCTACAAAGAAAGGTTCCCAAAGGCTACAGCTCAGATGGAAGAACGTCTAAAGGAAATTATCACCAGCTAC
TCTCCTGACAACGTTCTACCCTTAGCAGATGGAGTGCTTAGTTTCACTCACCACCAGATTATTGAACTGGCTCGAGATTGCTTGGATAAA
TCCCACCAGGGCCTCATCACCTCACGATACTTCCTTGAATTACAGCACAAATTAGATAAGTTGCTACAGGAGGCTCATGATCGTTCAGAA
AGTGGAGAATTGGCATTTATTAAACAACTAGTTCGAAAGATCCTAATTGTTATTGCCCGCCCTGCTCGGTTATTAGAGTGCCTGGAATTT
GATCCGGAAGAATTTTACTACCTATTGGAAGCAGCAGAAGGCCATGCCAAAGAAGGACAGGGTATTAAAACCGACATTCCCAGGTACATC
ATTAGCCAACTGGGACTCAATAAGGATCCCTTGGAAGAAATGGCTCATTTGGGAAACTACGATAGTGGGACAGCAGAAACACCAGAAACA
GATGAATCAGTGAGTAGCTCTAATGCCTCCCTGAAACTTCGAAGGAAACCTCGGGAAAGTGATTTTGAAACGATTAAATTGATTAGCAAT
GGAGCCTATGGGGCAGTCTACTTTGTTCGGCATAAAGAATCCCGGCAGAGGTTTGCCATGAAGAAGATTAATAAACAGAACCTCATCCTT
CGAAACCAGATCCAGCAGGCCTTTGTGGAGCGGGATATCCTGACTTTTGCAGAAAACCCCTTTGTTGTCAGCATGTATTGCTCCTTTGAA
ACAAGGCGCCACTTGTGCATGGTCATGGAATATGTGGAAGGGGGAGACTGTGCTACTTTAATGAAAAACATGGGTCCTCTCCCTGTTGAT
ATGGCCAGAATGTACTTTGCTGAGACGGTCTTGGCCTTGGAATATTTACATAATTATGGAATTGTACACAGGGATTTGAAACCAGACAAC
TTGTTGGTTACCTCCATGGGGCACATAAAGCTGACAGATTTTGGATTATCTAAGGTGGGACTAATGAGCATGACTACCAACCTTTACGAG
GGTCATATTGAGAAGGATGCTAGAGAGTTCCTGGATAAACAGGTCTGTGGCACACCTGAATACATTGCACCAGAAGTGATTCTGAGGCAG
GGTTATGGAAAGCCGGTGGACTGGTGGGCCATGGGGATTATCCTCTATGAATTTCTGGTTGGATGCGTGCCATTCTTTGGGGATACTCCA
GAGGAGCTATTTGGACAAGTCATCAGTGATGAGATCAACTGGCCTGAGAAGGATGAGGCACCCCCACCTGATGCCCAGGATCTGATTACC
TTACTCCTCAGGCAGAATCCCCTGGAGAGGCTGGGAACAGGTGGTGCATATGAAGTCAAACAGCATCGATTCTTCCGTTCTTTAGACTGG
AACAGTTTGCTGAGACAGAAGGCAGAATTTATTCCCCAACTGGAATCTGAGGATGACACAAGTTATTTTGATACTCGGTCTGAGAAGTAT
CATCATATGGAAACGGAGGAAGAAGATGACACAAATGATGAAGACTTTAATGTGGAAATAAGGCAGTTTTCTTCATGTTCACACAGGTTT
TCAAAAGTTTTCAGCAGTATAGATCGAATCACTCAGAATTCAGCAGAAGAGAAGGAAGACTCTGTGGACAAAACCAAAAGCACCACCTTG
CCATCCACAGAAACACTGAGCTGGAGTTCAGAATATTCTGAAATGCAACAGCTATCAACATCCAACTCTTCAGATACTGAAAGCAACAGA
CATAAACTCAGTTCTGGCCTACTTCCCAAACTGGCTATTTCAACAGAGGGAGAGCAAGATGAAGCTGCCTCCTGCCCTGGAGACCCCCAT
GAGGAGCCAGGAAAGCCAGCCCTTCCTCCTGAAGAGTGTGCCCAGGAGGAGCCTGAGGTCACCACCCCAGCCAGCACCATCAGCAGCTCC
ACCCTGTCAGTTGGCAGTTTTTCAGAGCACTTGGATCAGATAAATGGACGAAGCGAGTGTGTGGACAGTACAGATAATTCCTCAAAGCCA
TCCAGTGAACCCGCTTCTCACATGGCTCGGCAGCGATTAGAAAGCACAGAAAAAAAGAAAATCTCGGGGAAAGTCACAAAGTCCCTCTCT
GCCAGTGCTCTTTCCCTCATGATCCCAGGAGATATGTTTGCTGTTTCCCCTCTGGGAAGTCCAATGTCTCCCCATTCCCTGTCCTCGGAC
CCTTCTTCTTCACGAGATTCCTCTCCCAGCCGAGATTCCTCAGCAGCTTCTGCCAGTCCACATCAGCCGATTGTGATCCACAGTTCGGGG
AAGAACTACGGCTTTACCATCCGAGCCATCCGGGTGTATGTGGGAGACAGTGACATCTATACAGTGCACCATATCGTCTGGAATGTAGAA
GAAGGAAGTCCGGCATGCCAGGCAGGACTGAAGGCTGGAGATCTTATCACTCACATCAATGGAGAACCAGTGCATGGACTTGTCCACACA
GAAGTTATAGAACTCCTACTGAAGAGTGGGAATAAGGTGTCAATCACTACTACCCCATTTGAAAACACATCAATCAAAACTGGACCAGCC
AGGAGAAACAGCTATAAGAGCCGGATGGTGAGGCGGAGCAAGAAATCCAAGAAGAAAGAAAGTCTCGAAAGGAGGAGATCTCTTTTCAAA
AAGCTAGCCAAGCAGCCTTCTCCTTTACTCCACACCAGCCGAAGTTTCTCCTGCTTGAACAGATCCCTGTCATCGGGTGAGAGCCTCCCA
GGTTCCCCCACTCATAGCTTGTCTCCCCGGTCTCCAACACCAAGCTACCGCTCCACCCCTGACTTCCCATCTGGTACTAATTCCTCCCAG
AGCAGCTCCCCTAGTTCTAGTGCCCCCAATTCCCCAGCAGGGTCCGGGCACATCCGGCCCAGCACTCTCCACGGTCTTGCACCCAAACTC
GGCGGGCAGCGGTACCGGTCCGGAAGGCGAAAGTCCGCCGGCAACATCCCACTGTCCCCGCTGGCCCGGACGCCCTCTCCAACCCCGCAA
CCCACCTCCCCGCAGCGGTCACCATCCCCTCTTCTGGGACACTCACTGGGCAATTCCAAGATCGCGCAAGCCTTTCCCAGCAAGATGCAC
TCCCCGCCCACCATCGTCAGACACATCGTGAGGCCCAAGAGTGCGGAGCCCCCCAGGTCCCCGCTGCTCAAGCGCGTGCAGTCCGAGGAG
AAGCTGTCGCCCTCTTACGGCAGTGACAAGAAGCACCTGTGCTCCCGCAAGCACAGCCTGGAGGTGACCCAAGAGGAGGTGCAGCGGGAG
CAGTCCCAGCGGGAGGCGCCGCTGCAGAGCCTGGATGAGAACGTGTGCGACGTGCCGCCGCTCAGCCGCGCCCGGCCAGTGGAGCAAGGC
TGCCTGAAACGCCCAGTCTCCCGGAAGGTGGGCCGCCAGGAGTCTGTGGACGACCTGGACCGCGACAAGCTGAAGGCCAAGGTGGTGGTG
AAGAAAGCAGACGGCTTCCCAGAGAAACAGGAATCCCACCAGAAATCCCATGGACCCGGGAGTGATTTGGAAAACTTTGCTCTGTTTAAG
CTGGAAGAGAGAGAGAAGAAAGTCTATCCGAAGGCTGTGGAAAGGTCAAGTACTTTTGAAAACAAAGCGTCTATGCAGGAGGCGCCACCG
CTGGGCAGCCTGCTGAAGGATGCTCTTCACAAGCAGGCCAGCGTGCGCGCCAGCGAGGGTGCGATGTCGGATGGCCGGGTGCCTGCGGAG
CACCGCCAGGGTGGCGGGGACTTCAGACGGGCCCCCGCTCCTGGCACCCTCCAGGATGGTCTCTGCCACTCCCTCGACAGGGGCATCTCT
GGGAAGGGGGAAGGCACGGAGAAGTCCTCCCAGGCCAAGGAGCTTCTCCGATGTGAAAAGTTAGACAGCAAGCTGGCCAACATCGATTAC
CTCCGAAAGAAAATGTCACTTGAGGACAAAGAGGACAACCTCTGCCCTGTGCTGAAGCCCAAGATGACAGCTGGCTCCCACGAATGCCTG
CCAGGGAACCCAGTCCGACCCACGGGTGGGCAGCAGGAGCCCCCGCCGGCTTCTGAGAGCCGAGCTTTTGTCAGCAGCACCCATGCAGCT
CAGATGAGTGCCGTCTCTTTTGTTCCCCTCAAGGCCTTAACAGGCCGGGTGGACAGTGGAACGGAGAAGCCTGGCTTGGTTGCTCCTGAG
TCCCCTGTTAGGAAGAGCCCCTCCGAGTATAAGCTGGAAGGTAGGTCTGTCTCATGCCTGAAGCCGATCGAGGGCACTCTGGACATTGCT
CTCCTGTCCGGACCTCAGGCCTCCAAGACAGAACTGCCTTCCCCAGAGTCTGCACAGAGCCCCAGCCCAAGTGGTGACGTGAGGGCCTCT
GTGCCACCAGTTCTCCCCAGCAGCAGTGGGAAAAAGAACGATACCACCAGTGCAAGAGAGCTTTCTCCTTCCAGCTTAAAGATGAATAAA
TCCTACCTGCTGGAGCCTTGGTTCCTGCCCCCCAGCCGAGGTCTCCAGAATTCACCAGCAGTTTCCCTGCCTGACCCAGAGTTCAAGAGG
GACAGGAAAGGTCCCCATCCTACTGCCAGGAGCCCTGGAACAGTCATGGAAAGCAATCCCCAACAGAGAGAGGGCAGCTCCCCTAAACAC
CAAGACCACACCACTGACCCCAAGCTTCTGACCTGCCTGGGGCAGAACCTCCACAGCCCTGACCTGGCCAGGCCACGCTGCCCGCTCCCA
CCTGAAGCTTCCCCCTCAAGGGAGAAGCCAGGCCTGAGGGAATCGTCTGAAAGAGGCCCTCCCACAGCCAGAAGCGAGCGCTCTGCTGCG
AGGGCTGACACATGCAGAGAGCCCTCCATGGAACTGTGCTTTCCAGAAACTGCGAAAACCAGTGACAACTCCAAAAATCTCCTCTCTGTG
GGAAGGACCCACCCAGATTTCTATACACAGACCCAGGCCATGGAGAAAGCATGGGCGCCGGGTGGGAAAACGAACCACAAAGATGGCCCA
GGTGAGGCGAGGCCCCCGCCCAGAGACAACTCCTCTCTGCACTCAGCTGGAATTCCCTGTGAGAAGGAGCTGGGCAAGGTGAGGCGTGGC
GTGGAACCCAAGCCCGAAGCGCTTCTTGCCAGGCGGTCTCTGCAGCCACCTGGAATTGAGAGTGAGAAGAGTGAAAAGCTCTCCAGTTTC
CCATCTTTGCAGAAAGATGGTGCCAAGGAACCTGAAAGGAAGGAGCAGCCTCTACAAAGGCATCCCAGCAGCATCCCTCCGCCCCCTCTG
ACGGCCAAAGACCTGTCCAGCCCGGCTGCCAGGCAGCATTGCAGTTCCCCAAGCCACGCTTCTGGCAGAGAGCCGGGGGCCAAGCCCAGC
ACTGCAGAGCCCAGCTCGAGCCCCCAGGACCCTCCCAAGCCTGTTGCTGCGCACAGTGAAAGCAGCAGCCACAAGCCCCGGCCTGGCCCT
GACCCGGGCCCTCCAAAGACTAAGCACCCCGACCGGTCCCTCTCCTCTCAGAAACCAAGTGTCGGGGCCACAAAGGGCAAAGAGCCTGCC
ACTCAGTCCCTCGGTGGCTCTAGCAGAGAGGGGAAGGGCCACAGTAAGAGTGGGCCGGATGTGTTTCCTGCTACCCCAGGCTCCCAGAAC
AAAGCCAGCGATGGGATTGGCCAGGGAGAAGGTGGGCCCTCTGTCCCACTGCACACTGACAGGGCTCCTCTAGACGCCAAGCCACAACCC
ACCAGTGGTGGGCGGCCCCTGGAGGTGCTGGAGAAGCCTGTGCATTTGCCAAGGCCGGGACACCCAGGGCCTAGTGAGCCAGCGGACCAG
AAACTGTCCGCTGTTGGTGAAAAGCAAACCCTGTCTCCAAAGCACCCCAAACCATCCACTGTGAAAGATTGCCCCACCCTGTGCAAACAG
ACAGACAACAGACAGACAGACAAAAGCCCGAGTCAGCCGGCCGCCAACACCGACAGAAGGGCGGAAGGGAAGAAATGCACTGAAGCACTT
TATGCTCCAGCAGAGGGCGACAAGCTCGAGGCCGGCCTTTCCTTTGTGCATAGCGAGAACCGGTTGAAAGGCGCGGAGCGGCCAGCCGCG
GGGGTGGGGAAGGGCTTCCCTGAGGCCAGAGGGAAAGGGCCCGGTCCCCAGAAGCCACCGACGGAGGCAGACAAGCCCAATGGCATGAAA
CGGTCCCCCTCAGCCACTGGGCAGAGTTCTTTCCGATCCACGGCCCTCCCGGAAAAGTCTCTGAGCTGCTCCTCCAGCTTCCCTGAAACC
AGGGCCGGAGTTAGAGAGGCCTCTGCAGCCAGCAGCGACACCTCTTCTGCCAAGGCCGCCGGGGGCATGCTGGAGCTTCCAGCCCCCAGC
AACAGGGACCATAGGAAGGCTCAGCCTGCCGGGGAGGGCCGAACCCACATGACAAAGAGTGACTCCCTGCCCTCCTTCCGGGTCTCCACC
CTGCCTCTGGAGTCACACCACCCCGACCCAAACACCATGGGCGGGGCCAGCCACCGGGACAGGGCTCTCTCGGTGACTGCCACCGTAGGG
GAAACCAAAGGGAAGGACCCTGCCCCAGCCCAGCCTCCCCCAGCTAGGAAACAGAACGTGGGCAGAGACGTGACCAAGCCATCCCCAGCC
CCAAACACTGACCGCCCCATCTCTCTTTCTAATGAGAAGGACTTTGTGGTACGGCAGAGGCGGGGGAAAGAGAGTTTGCGTAGCAGCCCT
CACAAAAAGGCCTTGTAACGGGGAGGGCCCAGGGGCAGGACTGTGGAGACCCGTCCTGAACGGGCGACTGTGTCTTGACTACCTTTCAAA
ACCAGCACTGTGTGGGAATGTCCGCCAGGCAGAGCTCGGAGCCTCATTGAGACAGGGGAGAGAGAAAGACAAAGAGGGGACCTTCTTCCA
GATGCCTTCCCAGTTGTAACCGGTAAAACTGTTACCAGATAGTGTTTGTACAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTACCTTTAC
AGTTGAGGGTTGTTGAGGAAAATGATTTTCTTTGTAAATATATAGCATCGTGTTTGGTTTGGGATGTAGAGTCTATACCTGGCTGCTGAT
TGCGTCGTTTACTACAGCTTTTTTTAAATAAGATTTTTGCTTTACCATTTATCATAATGTAGTAATGAAGCAAAATGGTCAAAACTGGGT
GTGTGTGAACAGAGATACACCCATATTCGTGTATATACACATCCACCTACATGTTTTGGTCTGTGGTTTAAGAGACTATTTCAAGGTTCC
ATTTTTATAAGCTAAAACATTCTAAGTTAAGATGGAAGAAAGCCCTAAACACAGTAGATTCTGAGTTTTTATGTGTATTTTAACCAGAGT
TTCTGATAGTACTGTATCTGGCTACCTATATTTCCAGATCTAAAGCAAGAACTACTCTAAGTACTGCATTTGGAATCCTCCTCCATTAGG
AATGGCCAGGACAAGTGGAGCTAGCCATTTTCATTACACGGCCATCCCAATGGACACTGGATCCCTGGTCCAACTGTCTAAAAGGCCAGT
TGTTCCTTTCTGTGGATGTGGATGTCTGGCCTTCACCTGAGGTAGAGCGGGGACTATAAACACACATCAACTTTCTTTCTGTTTGCTTTC
TTTTCCTTCTTTTCAAACTCTTAAACTCAGGCCTTTATGCTGTGAGTGACTAGTCCAAGAAGCACACATTTTGTAGTAGTCCTGCACCAG
CCCTGCTCTTGAATAAAAAGGAAAATTACTGGCTGCACCCAAATCTTCTAGTACTTGAGTAATAAGCATCAGGCATTGGAAGAGGTTTTA
AATTTGCTTTTTTGAGGAAAAGAACTGGGGGTGGATTTTGGCATCGTAGCATATCGATTAAAGAATAATCAGGACATCAGATACATTTTA
ATACATAGCTGGGGCCTTATGTTGTAGATGAAGCTTGCTGTTTTTAGCAAGTTCCTGGGTTTCACATTCATTTCTGCTGCATCTAGTAGC
TCCACACATTTCATAACCTGATCTCTTTATTTGTATGCAAAAAATACTGTCTTAATACAGAGCAGCATTTTTGTAACAAAGAGACTCGCT
GGAGCTATTTGGTGCTTGAATGTGACCATCCTTTTTACTTTTGCTAAGCCTTATTTAAATTTTGTATACCGTGGAATATGTAGAATTTGT
CAAATCATTTTAGTGCTGAAGGTTTTTGATTTCTTGTTTTTGTTTCTGTTGTTGCAGTTTCTTTGGTGGCTTGTTTTGTATTGTAAGATG
GCACTTGCTGATATAAATACTAAGGCACTAAGAGAAAATACAGATAAGTATTTATAAGTTGCTTGGGAACCATAGCAGAATTTTTTGTTT
GGTTTTGTAAGAGAAAAAAAATTACCAATAAATAACTGATCTAGCACCCAAACTCTCTTGGGGGATGTCTTAGTATCTTCACGCTATAAA
ATTGTTCATCTAAGCACAGCATCATCTTATGGCCTTATGGATTGTAAATCTTCTAGTGAGGCTATAAACTCCACTCTGAAAACAAAGGCA
TAACTTAACCGACTGCTCAGTTGTCCTTCGTTGTAAAATGAATTGGCTTTGGGAAAAAGGAAAAAAACAAACAAAAAAAGAAAAAGAAAA
AAGCCTCCTCCTTGCCCCTAATTTTTTTTTCCCATATGGTTTTAGCCATTCCCCATCACTATATTGTGAAGCTGTAAAAATATATATATA
TACTTTACAAGAGTTTACTAATGGATTTCAAAACTGGTCTCAACGTTTATAATACATATCTGTGTTTGGCAGTTGTCATAACCCAATCCT
ACATTCAGCCATCGGGACAAGTCTGTCGGGGAGGTAGTTCATGGTTTACAAGCCTTTGCTTTTTAACTGTCCAATTTCCTTTAAAGCACA
ACTAGCTATTTGTTTACAAATGATATTTTTATGTATATTTTGTATAGTGTATCATCATTTTTGCCAAATATGTTTTTCATTATAAATGAG
TAAAGAGTACTTAAGGTTGCATTCATGTATTACATGTTTGTTGTTGTAAACCTCTCCAATCAGCTGGTAGAAATTCTCCTCATTGTGTTC
TATTTGGTCAGTCTCTGTGTGATTGTAGGATGTGCTCCTTGGTAGTACTCCCAGCTGTAGATTTACCAGCTTAAAAGTTTGTTAGGATCT
GTGCAATAAAGTGTTTGCAGTCTTATTTTCTCTAAGAAATTCCTTATGGACGTCATAATTGTTGTATATTGAACAAAATATTTATACTTA

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000403625_chr5_66195779_+_12453nt
CCCGGGCGCCATCGAGCCTTGGCGGCGGACGTGCAGAGAATCTCGATGCTGGCCTGGAGCAGAAACTGAGCTGGACCACTGGAGCCTCGG
TGAGGGGGTGCGGGGGGCAATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAA
GCTGGACTTCTTCCGCAGCGAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCT
CTACCAGCTGGATGCGAAGCTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGC
CAGCCAGTGCCATGAGGCTGAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAG
CCTCTTCAAGGGCATCTGCGCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGT
GGCCAGCAATGATGAGGGCGTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAA
TGGGCCACACGACAACGGCATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGC
CACCTACAAGGCCGGCTACCTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCA
GCAGGACAAGCACCCGGCCCGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCT
GCAGTGCCGGGACCCCGACATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATA
TGCTGTCTTCAGCAGAGACAGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGA
GGCCAACCGCAACGCCTGTTACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCA
CGCGCCGGGCTCCAGCAAGAGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGT
GCTGCAGCGTGGAGGCCTGAACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCG
GATCCTCAAGGTGTACCTCACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCT
GGTACTGTCTGGAGACCTGGGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGAC
CTGCACCCAGTGCCGCGACTCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGC
CGAGGAGGCCAGCCACTGGCTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCA
GGGGGAGGTGCAGCTGACCGTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCC
CGCCCGCGTGGAGGGCGAGGCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCAT
CCAGCTCCTCCTTAGACGAGGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAA
CCTGCCGTGCATCTCCTGCGTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGA
GGACGGCATCGTCCGTGCCCACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGA
TGTGAACTTCCAGGGCAAGAACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGAC
CATGCAGGAATCTGGGACCTTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTC
TTACGGCAAGAATATCGACAGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAA
CCCCGACTACAGGTGTGCGTGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGT
CATCACCAGGATCCAGCCTGAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGA
CATCCAGAGGATCTCTGTGGCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGA
AGAGGAAGTTTTTGCCGAACAAGCAACCGGAAAAGCTTAATAGGCAATGGGCAGTCACCAGCATTGCCTCGACCACACTCACCTCTCTCT
GCTCATGCAGGAAATAGCCCTCAAGATAGTCCAAGAAATTTCTCCCCCAGTGCCTCAGCCCATTTTTCATTTGCACGGAGGACTGATGGA
CGCCGCTGGTCGTTGGCTTCTCTCCCTTCCTCTGGCTATGGGACAAACACACCCAGCTCTACGGTCTCTTCATCCTGTTCCTCCCAGGAG
AAGTTGCATCAGTTACCATACCAACCAACACCAGACGAGTTACACTTCTTATCAAAACATTTCTGTACCACCGAAAGCATCGCCACTGAG
AACAGATGCAGGAACACGCCGATGCGCCCCCGTTCCCGAAGTCTGAGCCCTGGACGTTCTCCCGCCTGCTGTGACCATGAAATAATTATG
ATGAACCATGTCTACAAAGAAAGGTTCCCAAAGGCTACAGCTCAGATGGAAGAACGTCTAAAGGAAATTATCACCAGCTACTCTCCTGAC
AACGTTCTACCCTTAGCAGATGGAGTGCTTAGTTTCACTCACCACCAGATTATTGAACTGGCTCGAGATTGCTTGGATAAATCCCACCAG
GGCCTCATCACCTCACGATACTTCCTTGAATTACAGCACAAATTAGATAAGTTGCTACAGGAGGCTCATGATCGTTCAGAAAGTGGAGAA
TTGGCATTTATTAAACAACTAGTTCGAAAGATCCTAATTGTTATTGCCCGCCCTGCTCGGTTATTAGAGTGCCTGGAATTTGATCCGGAA
GAATTTTACTACCTATTGGAAGCAGCAGAAGGCCATGCCAAAGAAGGACAGGGTATTAAAACCGACATTCCCAGGTACATCATTAGCCAA
CTGGGACTCAATAAGGATCCCTTGGAAGAAATGGCTCATTTGGGAAACTACGATAGTGGGACAGCAGAAACACCAGAAACAGATGAATCA
GTGAGTAGCTCTAATGCCTCCCTGAAACTTCGAAGGAAACCTCGGGAAAGTGATTTTGAAACGATTAAATTGATTAGCAATGGAGCCTAT
GGGGCAGTCTACTTTGTTCGGCATAAAGAATCCCGGCAGAGGTTTGCCATGAAGAAGATTAATAAACAGAACCTCATCCTTCGAAACCAG
ATCCAGCAGGCCTTTGTGGAGCGGGATATCCTGACTTTTGCAGAAAACCCCTTTGTTGTCAGCATGTATTGCTCCTTTGAAACAAGGCGC
CACTTGTGCATGGTCATGGAATATGTGGAAGGGGGAGACTGTGCTACTTTAATGAAAAACATGGGTCCTCTCCCTGTTGATATGGCCAGA
ATGTACTTTGCTGAGACGGTCTTGGCCTTGGAATATTTACATAATTATGGAATTGTACACAGGGATTTGAAACCAGACAACTTGTTGGTT
ACCTCCATGGGGCACATAAAGCTGACAGATTTTGGATTATCTAAGGTGGGACTAATGAGCATGACTACCAACCTTTACGAGGGTCATATT
GAGAAGGATGCTAGAGAGTTCCTGGATAAACAGGTCTGTGGCACACCTGAATACATTGCACCAGAAGTGATTCTGAGGCAGGGTTATGGA
AAGCCGGTGGACTGGTGGGCCATGGGGATTATCCTCTATGAATTTCTGGTTGGATGCGTGCCATTCTTTGGGGATACTCCAGAGGAGCTA
TTTGGACAAGTCATCAGTGATGAGATCAACTGGCCTGAGAAGGATGAGGCACCCCCACCTGATGCCCAGGATCTGATTACCTTACTCCTC
AGGCAGAATCCCCTGGAGAGGCTGGGAACAGGTGGTGCATATGAAGTCAAACAGCATCGATTCTTCCGTTCTTTAGACTGGAACAGTTTG
CTGAGACAGAAGGCAGAATTTATTCCCCAACTGGAATCTGAGGATGACACAAGTTATTTTGATACTCGGTCTGAGAAGTATCATCATATG
GAAACGGAGGAAGAAGATGACACAAATGATGAAGACTTTAATGTGGAAATAAGGCAGTTTTCTTCATGTTCACACAGGTTTTCAAAAGTT
TTCAGCAGTATAGATCGAATCACTCAGAATTCAGCAGAAGAGAAGGAAGACTCTGTGGACAAAACCAAAAGCACCACCTTGCCATCCACA
GAAACACTGAGCTGGAGTTCAGAATATTCTGAAATGCAACAGCTATCAACATCCAACTCTTCAGATACTGAAAGCAACAGACATAAACTC
AGTTCTGGCCTACTTCCCAAACTGGCTATTTCAACAGAGGGAGAGCAAGATGAAGCTGCCTCCTGCCCTGGAGACCCCCATGAGGAGCCA
GGAAAGCCAGCCCTTCCTCCTGAAGAGTGTGCCCAGGAGGAGCCTGAGGTCACCACCCCAGCCAGCACCATCAGCAGCTCCACCCTGTCA
GTTGGCAGTTTTTCAGAGCACTTGGATCAGATAAATGGACGAAGCGAGTGTGTGGACAGTACAGATAATTCCTCAAAGCCATCCAGTGAA
CCCGCTTCTCACATGGCTCGGCAGCGATTAGAAAGCACAGAAAAAAAGAAAATCTCGGGGAAAGTCACAAAGTCCCTCTCTGCCAGTGCT
CTTTCCCTCATGATCCCAGGAGATATGTTTGCTGTTTCCCCTCTGGGAAGTCCAATGTCTCCCCATTCCCTGTCCTCGGACCCTTCTTCT
TCACGAGATTCCTCTCCCAGCCGAGATTCCTCAGCAGCTTCTGCCAGTCCACATCAGCCGATTGTGATCCACAGTTCGGGGAAGAACTAC
GGCTTTACCATCCGAGCCATCCGGGTGTATGTGGGAGACAGTGACATCTATACAGTGCACCATATCGTCTGGAATGTAGAAGAAGGAAGT
CCGGCATGCCAGGCAGGACTGAAGGCTGGAGATCTTATCACTCACATCAATGGAGAACCAGTGCATGGACTTGTCCACACAGAAGTTATA
GAACTCCTACTGAAGAGTGGGAATAAGGTGTCAATCACTACTACCCCATTTGAAAACACATCAATCAAAACTGGACCAGCCAGGAGAAAC
AGCTATAAGAGCCGGATGGTGAGGCGGAGCAAGAAATCCAAGAAGAAAGAAAGTCTCGAAAGGAGGAGATCTCTTTTCAAAAAGCTAGCC
AAGCAGCCTTCTCCTTTACTCCACACCAGCCGAAGTTTCTCCTGCTTGAACAGATCCCTGTCATCGGGTGAGAGCCTCCCAGGTTCCCCC
ACTCATAGCTTGTCTCCCCGGTCTCCAACACCAAGCTACCGCTCCACCCCTGACTTCCCATCTGGTACTAATTCCTCCCAGAGCAGCTCC
CCTAGTTCTAGTGCCCCCAATTCCCCAGCAGGGTCCGGGCACATCCGGCCCAGCACTCTCCACGGTCTTGCACCCAAACTCGGCGGGCAG
CGGTACCGGTCCGGAAGGCGAAAGTCCGCCGGCAACATCCCACTGTCCCCGCTGGCCCGGACGCCCTCTCCAACCCCGCAACCCACCTCC
CCGCAGCGGTCACCATCCCCTCTTCTGGGACACTCACTGGGCAATTCCAAGATCGCGCAAGCCTTTCCCAGCAAGATGCACTCCCCGCCC
ACCATCGTCAGACACATCGTGAGGCCCAAGAGTGCGGAGCCCCCCAGGTCCCCGCTGCTCAAGCGCGTGCAGTCCGAGGAGAAGCTGTCG
CCCTCTTACGGCAGTGACAAGAAGCACCTGTGCTCCCGCAAGCACAGCCTGGAGGTGACCCAAGAGGAGGTGCAGCGGGAGCAGTCCCAG
CGGGAGGCGCCGCTGCAGAGCCTGGATGAGAACGTGTGCGACGTGCCGCCGCTCAGCCGCGCCCGGCCAGTGGAGCAAGGCTGCCTGAAA
CGCCCAGTCTCCCGGAAGGTGGGCCGCCAGGAGTCTGTGGACGACCTGGACCGCGACAAGCTGAAGGCCAAGGTGGTGGTGAAGAAAGCA
GACGGCTTCCCAGAGAAACAGGAATCCCACCAGAAATCCCATGGACCCGGGAGTGATTTGGAAAACTTTGCTCTGTTTAAGCTGGAAGAG
AGAGAGAAGAAAGTCTATCCGAAGGCTGTGGAAAGGTCAAGTACTTTTGAAAACAAAGCGTCTATGCAGGAGGCGCCACCGCTGGGCAGC
CTGCTGAAGGATGCTCTTCACAAGCAGGCCAGCGTGCGCGCCAGCGAGGGTGCGATGTCGGATGGCCGGGTGCCTGCGGAGCACCGCCAG
GGTGGCGGGGACTTCAGACGGGCCCCCGCTCCTGGCACCCTCCAGGATGGTCTCTGCCACTCCCTCGACAGGGGCATCTCTGGGAAGGGG
GAAGGCACGGAGAAGTCCTCCCAGGCCAAGGAGCTTCTCCGATGTGAAAAGTTAGACAGCAAGCTGGCCAACATCGATTACCTCCGAAAG
AAAATGTCACTTGAGGACAAAGAGGACAACCTCTGCCCTGTGCTGAAGCCCAAGATGACAGCTGGCTCCCACGAATGCCTGCCAGGGAAC
CCAGTCCGACCCACGGGTGGGCAGCAGGAGCCCCCGCCGGCTTCTGAGAGCCGAGCTTTTGTCAGCAGCACCCATGCAGCTCAGATGAGT
GCCGTCTCTTTTGTTCCCCTCAAGGCCTTAACAGGCCGGGTGGACAGTGGAACGGAGAAGCCTGGCTTGGTTGCTCCTGAGTCCCCTGTT
AGGAAGAGCCCCTCCGAGTATAAGCTGGAAGGTAGGTCTGTCTCATGCCTGAAGCCGATCGAGGGCACTCTGGACATTGCTCTCCTGTCC
GGACCTCAGGCCTCCAAGACAGAACTGCCTTCCCCAGAGTCTGCACAGAGCCCCAGCCCAAGTGGTGACGTGAGGGCCTCTGTGCCACCA
GTTCTCCCCAGCAGCAGTGGGAAAAAGAACGATACCACCAGTGCAAGAGAGCTTTCTCCTTCCAGCTTAAAGATGAATAAATCCTACCTG
CTGGAGCCTTGGTTCCTGCCCCCCAGCCGAGGTCTCCAGAATTCACCAGCAGTTTCCCTGCCTGACCCAGAGTTCAAGAGGGACAGGAAA
GGTCCCCATCCTACTGCCAGGAGCCCTGGAACAGTCATGGAAAGCAATCCCCAACAGAGAGAGGGCAGCTCCCCTAAACACCAAGACCAC
ACCACTGACCCCAAGCTTCTGACCTGCCTGGGGCAGAACCTCCACAGCCCTGACCTGGCCAGGCCACGCTGCCCGCTCCCACCTGAAGCT
TCCCCCTCAAGGGAGAAGCCAGGCCTGAGGGAATCGTCTGAAAGAGGCCCTCCCACAGCCAGAAGCGAGCGCTCTGCTGCGAGGGCTGAC
ACATGCAGAGAGCCCTCCATGGAACTGTGCTTTCCAGAAACTGCGAAAACCAGTGACAACTCCAAAAATCTCCTCTCTGTGGGAAGGACC
CACCCAGATTTCTATACACAGACCCAGGCCATGGAGAAAGCATGGGCGCCGGGTGGGAAAACGAACCACAAAGATGGCCCAGGTGAGGCG
AGGCCCCCGCCCAGAGACAACTCCTCTCTGCACTCAGCTGGAATTCCCTGTGAGAAGGAGCTGGGCAAGGTGAGGCGTGGCGTGGAACCC
AAGCCCGAAGCGCTTCTTGCCAGGCGGTCTCTGCAGCCACCTGGAATTGAGAGTGAGAAGAGTGAAAAGCTCTCCAGTTTCCCATCTTTG
CAGAAAGATGGTGCCAAGGAACCTGAAAGGAAGGAGCAGCCTCTACAAAGGCATCCCAGCAGCATCCCTCCGCCCCCTCTGACGGCCAAA
GACCTGTCCAGCCCGGCTGCCAGGCAGCATTGCAGTTCCCCAAGCCACGCTTCTGGCAGAGAGCCGGGGGCCAAGCCCAGCACTGCAGAG
CCCAGCTCGAGCCCCCAGGACCCTCCCAAGCCTGTTGCTGCGCACAGTGAAAGCAGCAGCCACAAGCCCCGGCCTGGCCCTGACCCGGGC
CCTCCAAAGACTAAGCACCCCGACCGGTCCCTCTCCTCTCAGAAACCAAGTGTCGGGGCCACAAAGGGCAAAGAGCCTGCCACTCAGTCC
CTCGGTGGCTCTAGCAGAGAGGGGAAGGGCCACAGTAAGAGTGGGCCGGATGTGTTTCCTGCTACCCCAGGCTCCCAGAACAAAGCCAGC
GATGGGATTGGCCAGGGAGAAGGTGGGCCCTCTGTCCCACTGCACACTGACAGGGCTCCTCTAGACGCCAAGCCACAACCCACCAGTGGT
GGGCGGCCCCTGGAGGTGCTGGAGAAGCCTGTGCATTTGCCAAGGCCGGGACACCCAGGGCCTAGTGAGCCAGCGGACCAGAAACTGTCC
GCTGTTGGTGAAAAGCAAACCCTGTCTCCAAAGCACCCCAAACCATCCACTGTGAAAGATTGCCCCACCCTGTGCAAACAGACAGACAAC
AGACAGACAGACAAAAGCCCGAGTCAGCCGGCCGCCAACACCGACAGAAGGGCGGAAGGGAAGAAATGCACTGAAGCACTTTATGCTCCA
GCAGAGGGCGACAAGCTCGAGGCCGGCCTTTCCTTTGTGCATAGCGAGAACCGGTTGAAAGGCGCGGAGCGGCCAGCCGCGGGGGTGGGG
AAGGGCTTCCCTGAGGCCAGAGGGAAAGGGCCCGGTCCCCAGAAGCCACCGACGGAGGCAGACAAGCCCAATGGCATGAAACGGTCCCCC
TCAGCCACTGGGCAGAGTTCTTTCCGATCCACGGCCCTCCCGGAAAAGTCTCTGAGCTGCTCCTCCAGCTTCCCTGAAACCAGGGCCGGA
GTTAGAGAGGCCTCTGCAGCCAGCAGCGACACCTCTTCTGCCAAGGCCGCCGGGGGCATGCTGGAGCTTCCAGCCCCCAGCAACAGGGAC
CATAGGAAGGCTCAGCCTGCCGGGGAGGGCCGAACCCACATGACAAAGAGTGACTCCCTGCCCTCCTTCCGGGTCTCCACCCTGCCTCTG
GAGTCACACCACCCCGACCCAAACACCATGGGCGGGGCCAGCCACCGGGACAGGGCTCTCTCGGTGACTGCCACCGTAGGGGAAACCAAA
GGGAAGGACCCTGCCCCAGCCCAGCCTCCCCCAGCTAGGAAACAGAACGTGGGCAGAGACGTGACCAAGCCATCCCCAGCCCCAAACACT
GACCGCCCCATCTCTCTTTCTAATGAGAAGGACTTTGTGGTACGGCAGAGGCGGGGGAAAGAGAGTTTGCGTAGCAGCCCTCACAAAAAG
GCCTTGTAACGGGGAGGGCCCAGGGGCAGGACTGTGGAGACCCGTCCTGAACGGGCGACTGTGTCTTGACTACCTTTCAAAACCAGCACT
GTGTGGGAATGTCCGCCAGGCAGAGCTCGGAGCCTCATTGAGACAGGGGAGAGAGAAAGACAAAGAGGGGACCTTCTTCCAGATGCCTTC
CCAGTTGTAACCGGTAAAACTGTTACCAGATAGTGTTTGTACAAAAAAAAAAAAAAAAAAAAAAAAAAAAATTACCTTTACAGTTGAGGG
TTGTTGAGGAAAATGATTTTCTTTGTAAATATATAGCATCGTGTTTGGTTTGGGATGTAGAGTCTATACCTGGCTGCTGATTGCGTCGTT
TACTACAGCTTTTTTTAAATAAGATTTTTGCTTTACCATTTATCATAATGTAGTAATGAAGCAAAATGGTCAAAACTGGGTGTGTGTGAA
CAGAGATACACCCATATTCGTGTATATACACATCCACCTACATGTTTTGGTCTGTGGTTTAAGAGACTATTTCAAGGTTCCATTTTTATA
AGCTAAAACATTCTAAGTTAAGATGGAAGAAAGCCCTAAACACAGTAGATTCTGAGTTTTTATGTGTATTTTAACCAGAGTTTCTGATAG
TACTGTATCTGGCTACCTATATTTCCAGATCTAAAGCAAGAACTACTCTAAGTACTGCATTTGGAATCCTCCTCCATTAGGAATGGCCAG
GACAAGTGGAGCTAGCCATTTTCATTACACGGCCATCCCAATGGACACTGGATCCCTGGTCCAACTGTCTAAAAGGCCAGTTGTTCCTTT
CTGTGGATGTGGATGTCTGGCCTTCACCTGAGGTAGAGCGGGGACTATAAACACACATCAACTTTCTTTCTGTTTGCTTTCTTTTCCTTC
TTTTCAAACTCTTAAACTCAGGCCTTTATGCTGTGAGTGACTAGTCCAAGAAGCACACATTTTGTAGTAGTCCTGCACCAGCCCTGCTCT
TGAATAAAAAGGAAAATTACTGGCTGCACCCAAATCTTCTAGTACTTGAGTAATAAGCATCAGGCATTGGAAGAGGTTTTAAATTTGCTT
TTTTGAGGAAAAGAACTGGGGGTGGATTTTGGCATCGTAGCATATCGATTAAAGAATAATCAGGACATCAGATACATTTTAATACATAGC
TGGGGCCTTATGTTGTAGATGAAGCTTGCTGTTTTTAGCAAGTTCCTGGGTTTCACATTCATTTCTGCTGCATCTAGTAGCTCCACACAT
TTCATAACCTGATCTCTTTATTTGTATGCAAAAAATACTGTCTTAATACAGAGCAGCATTTTTGTAACAAAGAGACTCGCTGGAGCTATT
TGGTGCTTGAATGTGACCATCCTTTTTACTTTTGCTAAGCCTTATTTAAATTTTGTATACCGTGGAATATGTAGAATTTGTCAAATCATT
TTAGTGCTGAAGGTTTTTGATTTCTTGTTTTTGTTTCTGTTGTTGCAGTTTCTTTGGTGGCTTGTTTTGTATTGTAAGATGGCACTTGCT
GATATAAATACTAAGGCACTAAGAGAAAATACAGATAAGTATTTATAAGTTGCTTGGGAACCATAGCAGAATTTTTTGTTTGGTTTTGTA
AGAGAAAAAAAATTACCAATAAATAACTGATCTAGCACCCAAACTCTCTTGGGGGATGTCTTAGTATCTTCACGCTATAAAATTGTTCAT
CTAAGCACAGCATCATCTTATGGCCTTATGGATTGTAAATCTTCTAGTGAGGCTATAAACTCCACTCTGAAAACAAAGGCATAACTTAAC
CGACTGCTCAGTTGTCCTTCGTTGTAAAATGAATTGGCTTTGGGAAAAAGGAAAAAAACAAACAAAAAAAGAAAAAGAAAAAAGCCTCCT
CCTTGCCCCTAATTTTTTTTTCCCATATGGTTTTAGCCATTCCCCATCACTATATTGTGAAGCTGTAAAAATATATATATATACTTTACA
AGAGTTTACTAATGGATTTCAAAACTGGTCTCAACGTTTATAATACATATCTGTGTTTGGCAGTTGTCATAACCCAATCCTACATTCAGC
CATCGGGACAAGTCTGTCGGGGAGGTAGTTCATGGTTTACAAGCCTTTGCTTTTTAACTGTCCAATTTCCTTTAAAGCACAACTAGCTAT
TTGTTTACAAATGATATTTTTATGTATATTTTGTATAGTGTATCATCATTTTTGCCAAATATGTTTTTCATTATAAATGAGTAAAGAGTA
CTTAAGGTTGCATTCATGTATTACATGTTTGTTGTTGTAAACCTCTCCAATCAGCTGGTAGAAATTCTCCTCATTGTGTTCTATTTGGTC
AGTCTCTGTGTGATTGTAGGATGTGCTCCTTGGTAGTACTCCCAGCTGTAGATTTACCAGCTTAAAAGTTTGTTAGGATCTGTGCAATAA
AGTGTTTGCAGTCTTATTTTCTCTAAGAAATTCCTTATGGACGTCATAATTGTTGTATATTGAACAAAATATTTATACTTATGCAGTTGC

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406374_chr5_66195779_+_2827nt
CCCGGGCGCCATCGAGCCTTGGCGGCGGACGTGCAGAGAATCTCGATGCTGGCCTGGAGCAGAAACTGAGCTGGACCACTGGAGCCTCGG
TGAGGGGGTGCGGGGGGCAATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAA
GCTGGACTTCTTCCGCAGCGAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCT
CTACCAGCTGGATGCGAAGCTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGC
CAGCCAGTGCCATGAGGCTGAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAG
CCTCTTCAAGGGCATCTGCGCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGT
GGCCAGCAATGATGAGGGCGTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAA
TGGGCCACACGACAACGGCATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGC
CACCTACAAGGCCGGCTACCTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCA
GCAGGACAAGCACCCGGCCCGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCT
GCAGTGCCGGGACCCCGACATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATA
TGCTGTCTTCAGCAGAGACAGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGA
GGCCAACCGCAACGCCTGTTACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCA
CGCGCCGGGCTCCAGCAAGAGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGT
GCTGCAGCGTGGAGGCCTGAACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCG
GATCCTCAAGGTGTACCTCACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCT
GGTACTGTCTGGAGACCTGGGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGAC
CTGCACCCAGTGCCGCGACTCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGC
CGAGGAGGCCAGCCACTGGCTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCA
GGGGGAGGTGCAGCTGACCGTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCC
CGCCCGCGTGGAGGGCGAGGCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCAT
CCAGCTCCTCCTTAGACGAGGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAA
CCTGCCGTGCATCTCCTGCGTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGA
GGACGGCATCGTCCGTGCCCACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGA
TGTGAACTTCCAGGGCAAGAACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGAC
CATGCAGGAATCTGGGACCTTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTC
TTACGGCAAGAATATCGACAGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAA
CCCCGACTACAGGTGTGCGTGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGT
CATCACCAGGATCCAGCCTGAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGA
CATCCAGAGGATCTCTGTGGCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGA
AGAGGAAGTTTGATAGATTCCCAGAAGTGGAATTGCTTGGTCAAACGCCCTGTGTGTCCAAATGCTGGGAGAACATCACCCCTTGGATGA

>In-frame_PLXNB2_ENST00000359337_chr22_50722031_-_MAST4_ENST00000406039_chr5_66195779_+_2754nt
CCCGGGCGCCATCGAGCCTTGGCGGCGGACGTGCAGAGAATCTCGATGCTGGCCTGGAGCAGAAACTGAGCTGGACCACTGGAGCCTCGG
TGAGGGGGTGCGGGGGGCAATGGCACTGCAGCTCTGGGCCCTGACCCTGCTGGGCCTGCTGGGCGCAGGTGCCAGCCTGAGGCCCCGCAA
GCTGGACTTCTTCCGCAGCGAGAAAGAGCTGAACCACCTGGCTGTGGATGAGGCCTCAGGCGTGGTGTACCTGGGGGCGGTGAATGCCCT
CTACCAGCTGGATGCGAAGCTGCAGCTGGAGCAGCAGGTGGCCACGGGCCCGGCCCTGGACAACAAGAAGTGCACGCCGCCCATCGAGGC
CAGCCAGTGCCATGAGGCTGAGATGACTGACAATGTCAACCAGCTGCTGCTGCTCGACCCTCCCAGGAAGCGCCTGGTGGAGTGCGGCAG
CCTCTTCAAGGGCATCTGCGCTCTGCGCGCCCTGAGCAACATCTCCCTCCGCCTGTTCTACGAGGACGGCAGCGGGGAGAAGTCTTTCGT
GGCCAGCAATGATGAGGGCGTGGCCACAGTGGGGCTGGTGAGCTCCACGGGTCCTGGTGGTGACCGCGTGCTGTTTGTGGGCAAAGGCAA
TGGGCCACACGACAACGGCATCATCGTGAGCACTCGGCTGTTGGACCGGACTGACAGCAGGGAGGCCTTTGAAGCCTACACGGACCACGC
CACCTACAAGGCCGGCTACCTGTCCACCAACACACAGCAGTTCGTGGCGGCCTTCGAGGACGGCCCCTACGTCTTCTTTGTCTTCAACCA
GCAGGACAAGCACCCGGCCCGGAACCGCACGCTGCTGGCACGCATGTGCAGAGAAGACCCCAACTACTACTCCTACCTGGAGATGGACCT
GCAGTGCCGGGACCCCGACATCCACGCCGCTGCCTTTGGCACCTGCCTGGCCGCCTCCGTGGCTGCGCCTGGCTCTGGCAGGGTGCTATA
TGCTGTCTTCAGCAGAGACAGCCGGAGCAGTGGGGGGCCCGGTGCGGGCCTCTGCCTGTTCCCGCTGGACAAGGTGCACGCCAAGATGGA
GGCCAACCGCAACGCCTGTTACACAGGCACCCGGGAGGCCCGTGACATCTTCTACAAGCCCTTCCACGGCGATATCCAGTGCGGCGGCCA
CGCGCCGGGCTCCAGCAAGAGCTTCCCATGTGGCTCGGAGCACCTGCCCTACCCGCTGGGCAGCCGCGACGGGCTCAGAGGCACAGCCGT
GCTGCAGCGTGGAGGCCTGAACCTCACGGCCGTGACGGTCGCCGCCGAGAACAACCACACTGTTGCTTTTCTGGGCACCTCTGATGGCCG
GATCCTCAAGGTGTACCTCACCCCAGATGGCACCTCCTCAGAGTACGACTCTATCCTTGTGGAGATAAACAAGAGAGTCAAGCGCGACCT
GGTACTGTCTGGAGACCTGGGCAGCCTGTACGCCATGACCCAGGACAAGGTGTTCCGGCTGCCGGTGCAGGAGTGCCTGAGCTACCCGAC
CTGCACCCAGTGCCGCGACTCCCAGGACCCCTACTGCGGCTGGTGCGTCGTCGAGGGACGATGCACCCGGAAGGCCGAGTGTCCGCGGGC
CGAGGAGGCCAGCCACTGGCTGTGGAGCCGAAGCAAGTCCTGCGTGGCCGTCACCAGCGCCCAGCCACAGAACATGAGCCGGCGGGCCCA
GGGGGAGGTGCAGCTGACCGTCAGCCCCCTCCCTGCCCTGAGCGAGGAGGACGAGTTGCTGTGCCTTTTTGGGGAGTCGCCGCCACACCC
CGCCCGCGTGGAGGGCGAGGCCGTCATCTGCAACTCCCCAAGCAGCATCCCCGTCACACCGCCAGGCCAGGACCACGTGGCCGTGACCAT
CCAGCTCCTCCTTAGACGAGGCAACATCTTCCTCACGTCCTACCAGTACCCCTTCTACGACTGCCGCCAGGCCATGAGCCTGGAGGAGAA
CCTGCCGTGCATCTCCTGCGTGAGCAACCGCTGGACCTGCCAGTGGGACCTGCGCTACCACGAGTGCCGGGAGGCTTCGCCCAACCCTGA
GGACGGCATCGTCCGTGCCCACATGGAGGACAGCTGTCCCCAGTTCCTGGGACCCAGCCCCCTGGTGATCCCCATGAACCACGAGACAGA
TGTGAACTTCCAGGGCAAGAACCTGGACACCGTGAAGGGTTCCTCCCTGCACGTGGGCAGTGACTTGCTCAAGTTCATGGAGCCGGTGAC
CATGCAGGAATCTGGGACCTTCGCCTTTCGGACCCCAAAGCTGTCCCACGATGCCAACGAGACGCTGCCCCTGCACCTCTACGTCAAGTC
TTACGGCAAGAATATCGACAGCAAGCTCCATGTGACCCTCTACAACTGCTCCTTTGGCCGCAGCGACTGCAGCCTGTGCCGGGCCGCTAA
CCCCGACTACAGGTGTGCGTGGTGCGGGGGCCAGAGCAGGTGCGTGTATGAGGCCCTGTGCAACACCACCTCCGAGTGCCCGCCGCCCGT
CATCACCAGGATCCAGCCTGAGACGGGCCCCCTGGGTGGGGGCATCCGCATCACCATCCTGGGGTCCAATTTGGGCGTCCAAGCAGGGGA
CATCCAGAGGATCTCTGTGGCCGGCCGGAACTGCTCCTTTCAGCCGGAACGTTACTCCGTGTCCACCCGAAGGAGCTGAGTCTCCCCAGA


Top

FusionGenePPI for PLXNB2_MAST4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLXNB2ARHGEF11, RND1, PTN, ARHGEF12, PLCG1, HMOX2, CENPU, PFDN1, C12orf57, TACC1, NIF3L1, FBXO6, CCDC8, RHOD, PVRIG, HLA-E, LMAN2, BTNL8, PTCH1, PTPRK, SIAE, LYPD6, NTRK1, TMX1, DEFA1, DEFA5, ST8SIA4, IL17RC, TMED6, SCGB1D1, ADAM21, TLR1, IL27RA, MPPE1, TMPRSS3, TRIM25MAST4SMAD1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLXNB2_MAST4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLXNB2_MAST4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource