FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27750

FusionGeneSummary for PLXNB1_SLC26A6

check button Fusion gene summary
Fusion gene informationFusion gene name: PLXNB1_SLC26A6
Fusion gene ID: 27750
HgeneTgene
Gene symbol

PLXNB1

SLC26A6

Gene ID

5364

65010

Gene nameplexin B1solute carrier family 26 member 6
SynonymsPLEXIN-B1|PLXN5|SEP-
Cytomap

3p21.31

3p21.31

Type of geneprotein-codingprotein-coding
Descriptionplexin-B1plexin 5semaphorin receptor SEPsolute carrier family 26 member 6anion exchange transporteranion transporter 1pendrin L1solute carrier family 26 (anion exchanger), member 6sulfate anion transporter
Modification date2018052320180523
UniProtAcc

O43157

Q9BXS9

Ensembl transtripts involved in fusion geneENST00000296440, ENST00000358459, 
ENST00000358536, ENST00000448774, 
ENST00000456774, ENST00000465117, 
ENST00000420764, ENST00000358747, 
ENST00000395550, ENST00000383733, 
ENST00000337000, ENST00000455886, 
ENST00000482282, 
Fusion gene scores* DoF score7 X 8 X 5=2804 X 3 X 3=36
# samples 74
** MAII scorelog2(7/280*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PLXNB1 [Title/Abstract] AND SLC26A6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLXNB1

GO:0007162

negative regulation of cell adhesion

15218527

HgenePLXNB1

GO:0008360

regulation of cell shape

19843518

HgenePLXNB1

GO:0051493

regulation of cytoskeleton organization

19843518

HgenePLXNB1

GO:0071526

semaphorin-plexin signaling pathway

15218527|19843518

TgeneSLC26A6

GO:0071346

cellular response to interferon-gamma

18655181


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-DD-A1EB-01APLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000296440ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000296440ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000296440ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000296440ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000296440ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000296440ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
5CDS-intronENST00000296440ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358459ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
5CDS-intronENST00000358459ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
In-frameENST00000358536ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
5CDS-intronENST00000358536ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000448774ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-intronENST00000448774ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
Frame-shitENST00000456774ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
5CDS-intronENST00000456774ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000420764PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000358747PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000395550PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000383733PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000337000PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-3CDSENST00000465117ENST00000455886PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-
intron-intronENST00000465117ENST00000482282PLXNB1chr3

48460986

-SLC26A6chr3

48667144

-

Top

FusionProtFeatures for PLXNB1_SLC26A6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLXNB1

O43157

SLC26A6

Q9BXS9

Receptor for SEMA4D. Plays a role in RHOA activation andsubsequent changes of the actin cytoskeleton. Plays a role in axonguidance, invasive growth and cell migration.{ECO:0000269|PubMed:12196628, ECO:0000269|PubMed:12198496,ECO:0000269|PubMed:15210733, ECO:0000269|PubMed:19843518,ECO:0000269|PubMed:20877282, ECO:0000269|PubMed:21912513}. Apical membrane anion-exchanger with wide epithelialdistribution that plays a role as a component of the pH bufferingsystem for maintaining acid-base homeostasis. Acts as a versatileDIDS-sensitive inorganic and organic anion transporter thatmediates the uptake of monovalent anions like chloride,bicarbonate, formate and hydroxyl ion and divalent anions likesulfate and oxalate. Function in multiple exchange modes involvingpairs of these anions, which include chloride-bicarbonate,chloride-oxalate, oxalate-formate, oxalate-sulfate and chloride-formate exchange. Apical membrane chloride-bicarbonate exchangerthat mediates luminal chloride absorption and bicarbonatesecretion by the small intestinal brush border membrane andcontributes to intracellular pH regulation in the duodenal uppervillous epithelium during proton-coupled peptide absorption,possibly by providing a bicarbonate import pathway. Mediates alsointestinal chloride absorption and oxalate secretion, therebypreventing hyperoxaluria and calcium oxalate urolithiasis.Transepithelial oxalate secretion, chloride-formate, chloride-oxalate and chloride-bicarbonate transport activities in theduodenum are inhibited by PKC activation in a calcium-independentmanner. The apical membrane chloride-bicarbonate exchangerprovides also a major route for fluid and bicarbonate secretioninto the proximal tubules of the kidney as well as into theproximal part of the interlobular pancreatic ductal tree, where itmediates electrogenic chloride-bicarbonate exchange with achloride-bicarbonate stoichiometry of 1:2, and hence will diluteand alkalinize protein-rich acinar secretion. Mediates also thetranscellular sulfate absorption and oxalate secretion across theapical membrane in the duodenum and the formate ion efflux at theapical brush border of cells in the proximal tubules of kidney.Plays a role in sperm capacitation by increasing intracellular pH. Isoform 4: Apical membrane chloride-bicarbonateexchanger. Its association with carbonic anhydrase CA2 forms abicarbonate transport metabolon; hence maximizes the localconcentration of bicarbonate at the transporter site.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PLXNB1_SLC26A6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_969aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPEE

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_970aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPE

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_970aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPE

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_951aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GRAPFVCMSGSPAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPEETFP_LPGD_GGGVHGGLP

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_969aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPEE

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_970aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQTDTPGLWEL
APLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEASET
GCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPE

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_1152aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQE

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_1153aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQ

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_1153aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQ

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_1134aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGRAPFVCMSGSPAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQEPEETFP_LPGD_GGGVHG

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_1152aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQE

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_1153aa
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTTLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQ
AQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQTVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSTEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRATVSRVCLRDQHYYSTVELPLACEG
GRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIETDV
NSDCAQLPVDTLDATPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQG
SAVSRDLTFDGTFEHLTVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESTSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFTDCV
AVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEAL
HPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQTDTPGL
WELAPLLCPGAGARHGTLQRCGRVLRGQGSPGGEGLPLLGHRVLCQC_VLQ_CAEAEVWCGCRLPHLPEEETAQEAGAAEAEATAERGEA
SETGCLPQGRLSFH_CQHQP_RHEEQQR_GLQDDAGELRR_DGRCNSQWSRRLQGPRWVHTEGPGPASARLPQPHPGPGCPLLCGHCVPQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_2908nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCT
GGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAA
TATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTT
CTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGA

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_2911nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_2911nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_2854nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCAGGGCCCCTTTTGTCTGCATGTCTGGCTCCCCAGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGA
CTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTC
CTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCA
CAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGT

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_2908nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCT
GGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAA
TATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTT
CTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGA

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_2911nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_3457nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACT
GAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAG
CCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGC
TGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCC

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_3460nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_3460nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_3403nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCAGGGCCCCTTTTGTCTGCATGTCTGGCTCCCCAGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGG
TCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGG
TGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGC
GGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCA

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_3457nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACT
GAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAG
CCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGC
TGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCC

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_3460nt
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_3441nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCT
GGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAA
TATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTT
CTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGA
CAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCCCCT
CACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAGTTC
AGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTTAGCCTCAGG

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_3442nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC
CGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCC
CCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAG
TTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTTAGCCTC

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_3442nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC
CGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCC
CCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAG
TTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTTAGCCTC

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_3385nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCAGGGCCCCTTTTGTCTGCATGTCTGGCTCCCCAGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGA
CTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTC
CTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCA
CAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGT
CACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGC
ACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACAC
ACAACTCAGGGAAGGAGGTCCTGGGACTCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGG

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_3439nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCT
GGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAA
TATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTT
CTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGA
CAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCCCCT
CACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAGTTC
AGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTTAGCCTCAGG

>In-frame_PLXNB1_ENST00000358459_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_3421nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGATGGA
GACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTCTGGGAGCTG
GCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGTCCGGGGGGT
GAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGTGGATGTCGA
CTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCTTCGGAAACA
GGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGACTGCAAGAT
GATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGC
CCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAA
GAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCA
CTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCC
CGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCC
CCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAG
TTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTTAGCCTC

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000420764_chr3_48667144_-_3990nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACT
GAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAG
CCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGC
TGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCC
TGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGA
GAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGAC
TCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTT

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000358747_chr3_48667144_-_3991nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG
GCCTGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCT
TGAGAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGG
GACTCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATAT

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000395550_chr3_48667144_-_3991nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG
GCCTGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCT
TGAGAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGG
GACTCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATAT

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000383733_chr3_48667144_-_3934nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCAGGGCCCCTTTTGTCTGCATGTCTGGCTCCCCAGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGG
TCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGG
TGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGC
GGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCA
TGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCCTGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCC
CAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGAGAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATG
TACACACACACAACTCAGGGAAGGAGGTCCTGGGACTCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCA

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000337000_chr3_48667144_-_3988nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCACACT
GAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAAGAG
CCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGAGGC
TGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAGGCC
TGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCTTGA
GAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGGGAC
TCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATATTTT

>In-frame_PLXNB1_ENST00000358536_chr3_48460986_-_SLC26A6_ENST00000455886_chr3_48667144_-_3970nt
GCCCGGCCGACGCGGCTTTGTCTCCTTTGTTCCCGGCGGTGGCAGCGCCGCGCGGGAGGGGCGGGCAGCGGGCGCAGTTTTCCGCCCCTC
GGTCTCCGGGTAACAGCTGCGGCTCCACCAGACCCGGGGAGAGGCCGCTGCGCGCGGAGCCCGAGCCCGGAGCGGCCGACGCCCGCCTCG
GCGCGCACATCCCGCGGGGCCCGGCCGGGTGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGACC
ATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCTCCAGCCCCTTCCACCAACTGCATTCACTCCC
AATGGCACGTATCTGCAGCACCTGGCAAGGGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCCT
GGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCTGCCACCTGTGATGCCTGATGAGTGCCCCCAG
GCCCAGCCTACCAACAACCCGAATCAGCTGCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGAA
CAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACACACAATATGTGGCTGCCAATGATCCTGCGGTC
AGCACGGTGGGGCTGGTAGCCCAGGGCTTGGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGGC
ATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTATGAGGAGACAGCCAAGCTGGCAGTGGGCCGC
CTCTCCGAGTACAGCCACCACTTCGTGAGTGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCAG
TCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTCCTATGTGGAGTTGCCTCTGGCCTGCGAAGGT
GGCCGCTACGGGCTGATCCAGGCTGCAGCTGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGCT
GCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGCCCTCTGTGCCTTCCCCCTGGATGAGGTGGAC
CGGCTTGCTAATCGCACGCGAGATGCCTGCTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGTC
AATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGACCACACGCCCAGCCCCATGGCCAGCCGGGTC
CCGCTGGAAGCCACACCAATTCTGGAGTGGCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTTC
CTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCACCCATACTCCACACAGAGCATCCAGCAGGGG
TCTGCAGTGAGCAGAGACCTCACCTTTGATGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGCT
TCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGGGTGGTGCGTGCTCCTTGGCAGGTGCAGTCGC
CGTTCTGAGTGCTCGAGGGGCCAGGGCCCAGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAGT
CCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCCACCCCTGTGGCCAGGGGAGTCATATTCCTGC
CACTTTGGGGAACATCAGAGTCCTGCCCTGCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCCG
AGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGCCAAAACTTCCCTCTCTTTCTATGACTGTGTG
GCGGTCACTGAACTCCGCCCATCTGCGCAGTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTGC
ACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGTCTCCCCAGACCCTCCTGCAAGAGGTGGACCC
AGCCCCTCCCCACCCACAGCCCCCAAAGCCCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCACA
GCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGCAGGTTCTGGCTCCATATCTTCCCCTGGCTCC
ACAGGGTCGCCTCTCCATGAGGAGCCCTCCCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACCC
TCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCGTCAGAGGTAGCAGCAGTGCCCCCTGCAGACCCTGGCCCCGAGGCTCTT
CATCCCACAGTGCCCCTGGACCTGCCCCCTGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGAC
TGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGCACCCGCCTTCTCCACTTCCACCCTCCTCTCA
GGTGATGGAGACTCAGCAGAGCTTGAGGGCCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCTC
TGGGAGCTGGCCCCACTACTCTGTCCTGGGGCAGGTGCCAGACACGGATATTTACAGAGATGTGGCAGAGTACTCAGAGGCCAAGGAAGT
CCGGGGGGTGAAGGTCTTCCGCTCCTCGGCCACCGTGTACTTTGCCAATGCTGAGTTCTACAGTGATGCGCTGAAGCAGAGGTGTGGTGT
GGATGTCGACTTCCTCATCTCCCAGAAGAAGAAACTGCTCAAGAAGCAGGAGCAGCTGAAGCTGAAGCAACTGCAGAAAGAGGAGAAGCT
TCGGAAACAGGCTGCCTCCCCCAAGGGCGCCTCAGTTTCCATTAATGTCAACACCAGCCTTGAAGACATGAGGAGCAACAACGTTGAGGA
CTGCAAGATGATGCAGGTGAGCTCAGGAGATAAGATGGAAGATGCAACAGCCAATGGTCAAGAAGACTCCAAGGCCCCAGATGGGTCCAC
ACTGAAGGCCCTGGGCCTGCCTCAGCCAGACTTCCACAGCCTCATCCTGGACCTGGGTGCCCTCTCCTTTGTGGACACTGTGTGCCTCAA
GAGCCTGAAGAATATTTTCCATGACTTCCGGGAGATTGAGGTGGAGGTGTACATGGCGGCCTGCCACAGCCCTGTGGTCAGCCAGCTTGA
GGCTGGGCACTTCTTCGATGCATCCATCACCAAGAAGCATCTCTTTGCCTCTGTCCATGATGCTGTCACCTTTGCCCTCCAACACCCGAG
GCCTGTCCCCGACAGCCCTGTTTCGGTCACCAGACTCTGAACATGCTACATCCTGCCCAAGACTGCACCTCTGGAGGTGCAGGGCACCCT
TGAGAAGCCCCTCACCCCTAGGCCGCCTCCAGGTGCTACCCAGGAGTCCCCTCCATGTACACACACACAACTCAGGGAAGGAGGTCCTGG
GACTCCAAGTTCAGCGCTCCAGGTCTGGGACAGGGCCTGCATGCAGTCAGGCTGGCAGTGGCGCGGTACAGGGAGGGAACTGGTGCATAT


Top

FusionGenePPI for PLXNB1_SLC26A6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLXNB1ARHGEF11, RND1, RND2, RND3, ARHGEF12, SEMA4D, RHOA, AKT1, GRB2, PLCG1, PLCG2, SOX4, DIAPH1, HNRNPD, SGTB, C21orf59, CENPO, CENPU, SMPX, HBB, HBA2SLC26A6LGALS9C, NT5E, FLOT2, ENPP6, FAF2, IRGC, VAC14, PPP6R2, ATP2B2, SLC15A1, P2RX2, PMEL, LRP1, TMCO3, CD79A, PDCD1, TNFSF8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLXNB1_SLC26A6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLXNB1_SLC26A6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource