FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27733

FusionGeneSummary for PLXNA1_TNK2

check button Fusion gene summary
Fusion gene informationFusion gene name: PLXNA1_TNK2
Fusion gene ID: 27733
HgeneTgene
Gene symbol

PLXNA1

TNK2

Gene ID

5361

10188

Gene nameplexin A1tyrosine kinase non receptor 2
SynonymsNOV|NOVP|PLEXIN-A1|PLXN1ACK|ACK-1|ACK1|p21cdc42Hs
Cytomap

3q21.3

3q29

Type of geneprotein-codingprotein-coding
Descriptionplexin-A1plexin 1semaphorin receptor NOVactivated CDC42 kinase 1activated Cdc42-associated kinase 1activated p21cdc42Hs kinasetyrosine kinase non-receptor protein 2
Modification date2018052320180523
UniProtAcc

Q9UIW2

Q07912

Ensembl transtripts involved in fusion geneENST00000393409, ENST00000251772, 
ENST00000505278, 
ENST00000381916, 
ENST00000333602, ENST00000428187, 
ENST00000392400, ENST00000316664, 
ENST00000468819, 
Fusion gene scores* DoF score4 X 3 X 4=483 X 3 X 3=27
# samples 64
** MAII scorelog2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PLXNA1 [Title/Abstract] AND TNK2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTNK2

GO:0016310

phosphorylation

20333297|20979614

TgeneTNK2

GO:0050731

positive regulation of peptidyl-tyrosine phosphorylation

10587647

TgeneTNK2

GO:2000369

regulation of clathrin-dependent endocytosis

18262180


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-D9-A6EA-06APLXNA1chr3

126710409

+TNK2chr3

195615477

-
TCGALDSKCMTCGA-EE-A2A1-06APLXNA1chr3

126710409

+TNK2chr3

195615477

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393409ENST00000381916PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000393409ENST00000333602PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000393409ENST00000428187PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000393409ENST00000392400PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000393409ENST00000316664PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000393409ENST00000468819PLXNA1chr3

126710409

+TNK2chr3

195615477

-
In-frameENST00000251772ENST00000381916PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000251772ENST00000333602PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000251772ENST00000428187PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000251772ENST00000392400PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000251772ENST00000316664PLXNA1chr3

126710409

+TNK2chr3

195615477

-
5CDS-5UTRENST00000251772ENST00000468819PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-3CDSENST00000505278ENST00000381916PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-5UTRENST00000505278ENST00000333602PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-5UTRENST00000505278ENST00000428187PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-5UTRENST00000505278ENST00000392400PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-5UTRENST00000505278ENST00000316664PLXNA1chr3

126710409

+TNK2chr3

195615477

-
intron-5UTRENST00000505278ENST00000468819PLXNA1chr3

126710409

+TNK2chr3

195615477

-

Top

FusionProtFeatures for PLXNA1_TNK2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLXNA1

Q9UIW2

TNK2

Q07912

Coreceptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D.Necessary for signaling by class 3 semaphorins and subsequentremodeling of the cytoskeleton. Plays a role in axon guidance,invasive growth and cell migration. Class 3 semaphorins bind to acomplex composed of a neuropilin and a plexin. The plexinmodulates the affinity of the complex for specific semaphorins,and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).{ECO:0000250}. Non-receptor tyrosine-protein and serine/threonine-protein kinase that is implicated in cell spreading and migration,cell survival, cell growth and proliferation. Transducesextracellular signals to cytosolic and nuclear effectors.Phosphorylates AKT1, AR, MCF2, WASL and WWOX. Implicated intrafficking and clathrin-mediated endocytosis through binding toepidermal growth factor receptor (EGFR) and clathrin. Binds toboth poly- and mono-ubiquitin and regulates ligand-induceddegradation of EGFR, thereby contributing to the accumulation ofEGFR at the limiting membrane of early endosomes. Downstreameffector of CDC42 which mediates CDC42-dependent cell migrationvia phosphorylation of BCAR1. May be involved both in adultsynaptic function and plasticity and in brain development.Activates AKT1 by phosphorylating it on 'Tyr-176'. PhosphorylatesAR on 'Tyr-267' and 'Tyr-363' thereby promoting its recruitment toandrogen-responsive enhancers (AREs). Phosphorylates WWOX on 'Tyr-287'. Phosphorylates MCF2, thereby enhancing its activity as aguanine nucleotide exchange factor (GEF) toward Rho familyproteins. Contributes to the control of AXL receptor levels.Confers metastatic properties on cancer cells and promotes tumorgrowth by negatively regulating tumor suppressor such as WWOX andpositively regulating pro-survival factors such as AKT1 and AR.Phosphorylates WASP (PubMed:20110370).{ECO:0000269|PubMed:10652228, ECO:0000269|PubMed:11278436,ECO:0000269|PubMed:16247015, ECO:0000269|PubMed:16257963,ECO:0000269|PubMed:16472662, ECO:0000269|PubMed:17038317,ECO:0000269|PubMed:18262180, ECO:0000269|PubMed:18435854,ECO:0000269|PubMed:19815557, ECO:0000269|PubMed:20110370,ECO:0000269|PubMed:20333297, ECO:0000269|PubMed:20383201}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011577_958-6529Compositional biasNote=Pro-rich
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015577_958-61039Compositional biasNote=Pro-rich
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015577_958571087Compositional biasNote=Pro-rich
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015577_958-61039Compositional biasNote=Pro-rich
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011126_385-6529DomainProtein kinase
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011388_448-6529DomainSH3
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011454_466-6529DomainNote=CRIB
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011958_996-6529DomainNote=UBA
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015126_385-61039DomainProtein kinase
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015388_448-61039DomainSH3
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015454_466-61039DomainNote=CRIB
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015958_996-61039DomainNote=UBA
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015126_385571087DomainProtein kinase
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015388_448571087DomainSH3
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015454_466571087DomainNote=CRIB
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015958_996571087DomainNote=UBA
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015126_385-61039DomainProtein kinase
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015388_448-61039DomainSH3
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015454_466-61039DomainNote=CRIB
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015958_996-61039DomainNote=UBA
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011132_140-6529Nucleotide bindingNote=ATP
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015132_140-61039Nucleotide bindingNote=ATP
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015132_140571087Nucleotide bindingNote=ATP
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015132_140-61039Nucleotide bindingNote=ATP
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-0111_110-6529RegionNote=SAM-like domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000316664-011733_876-6529RegionEBD domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-0151_110-61039RegionNote=SAM-like domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000333602-015733_876-61039RegionEBD domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-015733_876571087RegionEBD domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-0151_110-61039RegionNote=SAM-like domain
TgeneTNK2chr3:126710409chr3:195615477ENST00000392400-015733_876-61039RegionEBD domain

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+2311264_13174591897Coiled coilOntology_term=ECO:0000255
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+2311048_11474591897DomainNote=IPT/TIG 3
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+2311150_12364591897DomainNote=IPT/TIG 4
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+23127_5124591897DomainSema
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+231864_9594591897DomainNote=IPT/TIG 1
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+231961_10454591897DomainNote=IPT/TIG 2
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+2311266_18964591897Topological domainCytoplasmic
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+23127_12444591897Topological domainExtracellular
HgenePLXNA1chr3:126710409chr3:195615477ENST00000393409+2311245_12654591897TransmembraneHelical
TgeneTNK2chr3:126710409chr3:195615477ENST00000381916-0151_110571087RegionNote=SAM-like domain


Top

FusionGeneSequence for PLXNA1_TNK2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLXNA1_ENST00000393409_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_1489aa
MPLPPRSLQVLLLLLLLLLLLPGMWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVTVGAVNRITKLSGNLTLLRAHVTGPVE
DNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDTAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQ
GQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYTVYSFRSEQFVYYLTLQLDTQLTSP
DAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLF
TLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKDDGLTAVAATDTRGRTVVFA
GTRSGRIRKRLGGGRMQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSW
MSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVL
SQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAA
RNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDK
EGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCV
GPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELTLGNPMDPPDLLSVELSTSRPPQHLGGVKREPPPRPPQPA
FFTQKPTTDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLL
DETPPQSPTRALPRPLHPTPVVDWDARPLPPPPATDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLP
PQGGGKPPSSAQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPP
REPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHTYLLPERPSYLE
RYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPAD

>In-frame_PLXNA1_ENST00000251772_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_1466aa
MWAEAGLPRAGGGSQPPFRTFSASDWGLTHLVVHEQTGEVTVGAVNRITKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSCPHGLGSTDN
VNKLLLLDTAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVQEAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSS
RRLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYTVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVRLCVDDPKFY
SYVEFPIGCEQAGVEYRLVQDAYLSRPGRALAHQLGLAEDEDVLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIKERIQSCYRGEGKL
SLPWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKDDGLTAVAATDTRGRTVVFAGTRSGRIRKRLGGGRMQPEEGTG
WLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTF
RKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRN
LIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALP
QNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCW
AHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPL
QNSFIHTGHGDSDPRHCWGFPDRIDELTLGNPMDPPDLLSVELSTSRPPQHLGGVKREPPPRPPQPAFFTQKPTTDPVSEDQDPLSSDFK
RLGLRKPGLPRGLWLAKPSARVPGTKASRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVD
WDARPLPPPPATDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSSAQTAEIFQALQQE
CMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPL
PPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHTYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLL
LPPPSTPAPAAPTATVRPMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMVEQLFGLGLRPRGECHKVL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLXNA1_ENST00000393409_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_4467nt
ATGCCGCTGCCACCGCGGAGCCTGCAGGTGCTCCTGCTGCTGCTGCTGTTGCTGCTGCTGCTGCCGGGCATGTGGGCTGAGGCAGGCTTG
CCCAGGGCAGGCGGGGGTTCACAGCCCCCCTTCCGCACCTTCTCGGCCAGCGACTGGGGCCTCACCCACCTAGTGGTGCATGAGCAGACA
GGCGAGGTGTATGTGGGCGCAGTGAACCGCATCTATAAGCTGTCGGGGAACCTGACACTGCTGCGGGCCCACGTCACGGGCCCTGTGGAG
GACAACGAGAAGTGCTACCCGCCGCCCAGCGTGCAGTCCTGCCCCCACGGCCTGGGCAGTACTGACAACGTCAACAAGCTGCTGCTGCTG
GACTATGCCGCTAACCGCCTGCTGGCCTGTGGCAGCGCCTCCCAGGGCATCTGCCAGTTCCTGCGTCTGGACGATCTCTTCAAACTGGGT
GAGCCACACCACCGTAAGGAGCACTACCTGTCCAGCGTGCAGGAGGCAGGCAGCATGGCGGGCGTGCTCATTGCCGGGCCACCGGGCCAG
GGCCAGGCCAAGCTCTTCGTGGGCACACCCATCGATGGCAAGTCCGAGTACTTCCCCACACTGTCCAGCCGTCGGCTCATGGCCAACGAG
GAGGATGCCGACATGTTCGGCTTCGTGTACCAGGATGAGTTTGTGTCATCACAGCTCAAGATCCCTTCGGACACGCTGTCCAAGTTCCCG
GCCTTTGACATCTACTATGTGTACAGCTTCCGCAGCGAGCAGTTTGTCTACTACCTCACGCTGCAGCTAGACACACAGCTGACCTCGCCT
GATGCCGCCGGCGAGCACTTCTTCACGTCCAAGATCGTGCGGCTCTGTGTGGACGACCCCAAATTCTACTCGTACGTTGAGTTCCCCATT
GGCTGCGAGCAGGCGGGTGTGGAGTACCGCCTGGTGCAGGATGCCTACCTGAGCCGGCCCGGCCGTGCCCTGGCCCACCAGCTGGGCCTG
GCTGAGGACGAGGACGTGCTGTTCACTGTGTTCGCCCAGGGCCAGAAGAACCGCGTGAAGCCACCAAAGGAGTCAGCACTGTGCCTGTTC
ACGCTCAGGGCCATCAAGGAGAAGATTAAGGAGCGCATCCAGTCCTGCTACCGTGGTGAGGGCAAGCTCTCCCTGCCGTGGCTGCTCAAC
AAGGAGCTGGGCTGCATCAACTCGCCCCTGCAGATCGATGACGACTTCTGCGGGCAGGACTTCAACCAGCCCCTGGGGGGCACAGTCACC
ATTGAGGGGACGCCCCTGTTCGTGGACAAGGATGATGGCCTGACCGCCGTGGCTGCCTATGACTATCGGGGCCGCACTGTGGTATTCGCC
GGCACGCGAAGTGGCCGCATCCGCAAGAGGCTGGGAGGCGGCAGAATGCAGCCAGAGGAGGGCACAGGCTGGCTGCTGGAGCTGCTGTCC
GAGGTGCAGCTGCAACAGTACTTCCTGCGGCTCCGAGATGACCTCAACGTCACCCGCCTGTCCCACTTTGAGTACGTCAAGAATGAGGAC
CTGGAGAAGATCGGCATGGGTCGGCCTGGCCAGCGGCGGCTGTGGGAGGCTGTGAAGAGGAGGAAGGCCTTGTGCAAACGCAAGTCGTGG
ATGAGTAAGGTGTTCAGTGGAAAGCGACTGGAGGCTGAGTTCCCACCTCATCACTCTCAGAGCACCTTCCGGAAGACCTCGCCCGCCCCT
GGGGGCCCAGCAGGGGAGGGGCCCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAGGACCTGCGCCTCCTGGAGAAGCTGGGTGATGGT
TCCTTTGGCGTGGTGCGCAGGGGCGAGTGGGACGCGCCCTCAGGGAAGACGGTGAGTGTGGCTGTGAAGTGCCTGAAGCCCGATGTCCTG
AGCCAGCCAGAAGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCACTCGCTCGACCACCGAAACCTCATCCGCCTCTACGGGGTG
GTGCTCACGCCGCCCATGAAGATGGTGACAGAGCTGGCACCTCTGGGATCGTTGTTGGACCGGCTACGTAAGCACCAGGGCCACTTCCTC
CTGGGGACTCTGAGCCGCTACGCTGTGCAGGTGGCTGAGGGCATGGGCTACCTGGAGTCCAAGCGCTTTATTCACCGTGACCTGGCTGCC
CGCAATCTGCTGTTGGCTACCCGCGACCTGGTCAAGATCGGGGACTTTGGGCTGATGCGAGCACTACCTCAGAATGACGACCATTACGTC
ATGCAGGAACATCGCAAGGTGCCCTTCGCCTGGTGTGCCCCCGAGAGCCTGAAGACACGCACCTTCTCCCATGCCAGCGACACCTGGATG
TTCGGGGTGACACTGTGGGAAATGTTCACCTACGGCCAGGAGCCCTGGATCGGCCTCAACGGCAGTCAGATCCTGCATAAGATCGACAAG
GAGGGGGAGCGGCTGCCCCGGCCCGAGGACTGTCCCCAGGACATCTACAACGTCATGGTCCAGTGCTGGGCTCACAAGCCAGAGGACAGA
CCCACGTTTGTGGCCCTGCGGGACTTCCTGCTGGAGGCCCAGCCCACAGACATGCGGGCCCTTCAGGACTTTGAGGAACCGGACAAGCTG
CACATCCAGATGAATGATGTCATCACCGTCATCGAGGGAAGGGCCGAGAACTACTGGTGGCGTGGCCAGAACACACGGACGCTGTGTGTG
GGGCCCTTCCCTCGCAACGTGGTGACCTCCGTGGCCGGCCTGTCGGCCCAGGACATCAGCCAGCCCCTGCAGAACAGCTTCATCCACACA
GGGCATGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCGGACAGGATTGACGAACTGTATCTGGGAAACCCCATGGACCCCCCCGAC
CTCCTGAGCGTGGAACTGAGCACCTCCCGGCCCCCCCAGCATCTAGGAGGGGTGAAAAGGGAGCCTCCACCTCGCCCACCTCAGCCTGCC
TTCTTCACTCAGAAACCAACCTATGACCCTGTGAGCGAGGACCAAGACCCCTTGTCCAGCGACTTCAAGAGGCTGGGCCTGCGGAAGCCA
GGCCTGCCCCGAGGGCTGTGGCTGGCGAAGCCCTCGGCGCGGGTGCCGGGCACCAAGGCCAGCCGAGGCAGCGGGGCTGAGGTCACGCTC
ATCGACTTCGGTGAGGAGCCCGTGGTCCCGGCCCTACGGCCCTGCGCGCCCTCCCTGGCGCAGCTGGCCATGGACGCCTGCTCCCTGCTG
GACGAGACCCCGCCTCAGAGCCCCACGCGGGCACTGCCCCGGCCCCTGCACCCCACGCCTGTGGTGGACTGGGACGCACGCCCGCTGCCC
CCCCCGCCCGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGATCTGCTCCATCAACAGCACCCTCGTGGGCGCGGGGGTCCCT
GCCGGGCCCAGCCAGGGCCAGACCAACTACGCCTTTGTGCCTGAGCAGGCGCGGCCGCCCCCTCCCCTGGAGGACAACCTGTTCCTCCCG
CCCCAGGGTGGGGGCAAGCCGCCCAGCTCCGCACAGACCGCAGAGATCTTCCAGGCGCTACAGCAGGAGTGCATGAGGCAACTGCAGGCT
CCGGCCGGCTCCCCGGCCCCCTCTCCCAGCCCGGGGGGTGACGACAAGCCCCAGGTGCCTCCTCGGGTACCCATCCCCCCTCGGCCCACG
CGCCCACACGTCCAGCTGTCTCCAGCCCCCCCGGGCGAGGAGGAGACCAGCCAGTGGCCTGGACCTGCTTCCCCTCCCCGGGTGCCTCCG
CGGGAGCCCCTGTCCCCTCAAGGCTCGAGGACACCCAGCCCCCTGGTACCACCTGGCAGCTCCCCGCTGCCACCCCGGCTCTCAAGCTCA
CCTGGGAAGACCATGCCCACCACCCAGAGCTTTGCCTCAGACCCCAAGTACGCCACCCCCCAGGTGATCCAGGCCCCTGGCCCGCGGGCT
GGTCCCTGCATCCTGCCCATCGTCCGGGATGGCAAGAAGGTCAGCAGCACCCACTATTACTTGCTGCCCGAGCGACCATCCTACCTGGAG
CGCTACCAGCGCTTCCTGCGTGAGGCCCAGAGCCCCGAGGAGCCTACCCCCCTGCCTGTGCCTCTGCTGCTGCCCCCACCCAGCACCCCA
GCCCCCGCCGCCCCCACGGCCACCGTGCGGCCGATGCCCCAGGCTGCCTTGGACCCCAAGGCCAACTTCTCCACCAACAACAGCAACCCA
GGGGCCCGGCCACCACCCCCGAGGGCCACTGCTCGGCTGCCACAGAGGGGCTGCCCTGGCGATGGGCCAGAGGCGGGCCGGCCAGCAGAC
AAGATCCAGATGGTGGAGCAGCTCTTCGGGCTGGGTCTGCGGCCCAGAGGGGAGTGCCACAAAGTGCTGGAGATGTTCGACTGGAACCTG

>In-frame_PLXNA1_ENST00000251772_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_4398nt
ATGTGGGCTGAGGCAGGCTTGCCCAGGGCAGGCGGGGGTTCACAGCCCCCCTTCCGCACCTTCTCGGCCAGCGACTGGGGCCTCACCCAC
CTAGTGGTGCATGAGCAGACAGGCGAGGTGTATGTGGGCGCAGTGAACCGCATCTATAAGCTGTCGGGGAACCTGACACTGCTGCGGGCC
CACGTCACGGGCCCTGTGGAGGACAACGAGAAGTGCTACCCGCCGCCCAGCGTGCAGTCCTGCCCCCACGGCCTGGGCAGTACTGACAAC
GTCAACAAGCTGCTGCTGCTGGACTATGCCGCTAACCGCCTGCTGGCCTGTGGCAGCGCCTCCCAGGGCATCTGCCAGTTCCTGCGTCTG
GACGATCTCTTCAAACTGGGTGAGCCACACCACCGTAAGGAGCACTACCTGTCCAGCGTGCAGGAGGCAGGCAGCATGGCGGGCGTGCTC
ATTGCCGGGCCACCGGGCCAGGGCCAGGCCAAGCTCTTCGTGGGCACACCCATCGATGGCAAGTCCGAGTACTTCCCCACACTGTCCAGC
CGTCGGCTCATGGCCAACGAGGAGGATGCCGACATGTTCGGCTTCGTGTACCAGGATGAGTTTGTGTCATCACAGCTCAAGATCCCTTCG
GACACGCTGTCCAAGTTCCCGGCCTTTGACATCTACTATGTGTACAGCTTCCGCAGCGAGCAGTTTGTCTACTACCTCACGCTGCAGCTA
GACACACAGCTGACCTCGCCTGATGCCGCCGGCGAGCACTTCTTCACGTCCAAGATCGTGCGGCTCTGTGTGGACGACCCCAAATTCTAC
TCGTACGTTGAGTTCCCCATTGGCTGCGAGCAGGCGGGTGTGGAGTACCGCCTGGTGCAGGATGCCTACCTGAGCCGGCCCGGCCGTGCC
CTGGCCCACCAGCTGGGCCTGGCTGAGGACGAGGACGTGCTGTTCACTGTGTTCGCCCAGGGCCAGAAGAACCGCGTGAAGCCACCAAAG
GAGTCAGCACTGTGCCTGTTCACGCTCAGGGCCATCAAGGAGAAGATTAAGGAGCGCATCCAGTCCTGCTACCGTGGTGAGGGCAAGCTC
TCCCTGCCGTGGCTGCTCAACAAGGAGCTGGGCTGCATCAACTCGCCCCTGCAGATCGATGACGACTTCTGCGGGCAGGACTTCAACCAG
CCCCTGGGGGGCACAGTCACCATTGAGGGGACGCCCCTGTTCGTGGACAAGGATGATGGCCTGACCGCCGTGGCTGCCTATGACTATCGG
GGCCGCACTGTGGTATTCGCCGGCACGCGAAGTGGCCGCATCCGCAAGAGGCTGGGAGGCGGCAGAATGCAGCCAGAGGAGGGCACAGGC
TGGCTGCTGGAGCTGCTGTCCGAGGTGCAGCTGCAACAGTACTTCCTGCGGCTCCGAGATGACCTCAACGTCACCCGCCTGTCCCACTTT
GAGTACGTCAAGAATGAGGACCTGGAGAAGATCGGCATGGGTCGGCCTGGCCAGCGGCGGCTGTGGGAGGCTGTGAAGAGGAGGAAGGCC
TTGTGCAAACGCAAGTCGTGGATGAGTAAGGTGTTCAGTGGAAAGCGACTGGAGGCTGAGTTCCCACCTCATCACTCTCAGAGCACCTTC
CGGAAGACCTCGCCCGCCCCTGGGGGCCCAGCAGGGGAGGGGCCCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAGGACCTGCGCCTC
CTGGAGAAGCTGGGTGATGGTTCCTTTGGCGTGGTGCGCAGGGGCGAGTGGGACGCGCCCTCAGGGAAGACGGTGAGTGTGGCTGTGAAG
TGCCTGAAGCCCGATGTCCTGAGCCAGCCAGAAGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCACTCGCTCGACCACCGAAAC
CTCATCCGCCTCTACGGGGTGGTGCTCACGCCGCCCATGAAGATGGTGACAGAGCTGGCACCTCTGGGATCGTTGTTGGACCGGCTACGT
AAGCACCAGGGCCACTTCCTCCTGGGGACTCTGAGCCGCTACGCTGTGCAGGTGGCTGAGGGCATGGGCTACCTGGAGTCCAAGCGCTTT
ATTCACCGTGACCTGGCTGCCCGCAATCTGCTGTTGGCTACCCGCGACCTGGTCAAGATCGGGGACTTTGGGCTGATGCGAGCACTACCT
CAGAATGACGACCATTACGTCATGCAGGAACATCGCAAGGTGCCCTTCGCCTGGTGTGCCCCCGAGAGCCTGAAGACACGCACCTTCTCC
CATGCCAGCGACACCTGGATGTTCGGGGTGACACTGTGGGAAATGTTCACCTACGGCCAGGAGCCCTGGATCGGCCTCAACGGCAGTCAG
ATCCTGCATAAGATCGACAAGGAGGGGGAGCGGCTGCCCCGGCCCGAGGACTGTCCCCAGGACATCTACAACGTCATGGTCCAGTGCTGG
GCTCACAAGCCAGAGGACAGACCCACGTTTGTGGCCCTGCGGGACTTCCTGCTGGAGGCCCAGCCCACAGACATGCGGGCCCTTCAGGAC
TTTGAGGAACCGGACAAGCTGCACATCCAGATGAATGATGTCATCACCGTCATCGAGGGAAGGGCCGAGAACTACTGGTGGCGTGGCCAG
AACACACGGACGCTGTGTGTGGGGCCCTTCCCTCGCAACGTGGTGACCTCCGTGGCCGGCCTGTCGGCCCAGGACATCAGCCAGCCCCTG
CAGAACAGCTTCATCCACACAGGGCATGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCGGACAGGATTGACGAACTGTATCTGGGA
AACCCCATGGACCCCCCCGACCTCCTGAGCGTGGAACTGAGCACCTCCCGGCCCCCCCAGCATCTAGGAGGGGTGAAAAGGGAGCCTCCA
CCTCGCCCACCTCAGCCTGCCTTCTTCACTCAGAAACCAACCTATGACCCTGTGAGCGAGGACCAAGACCCCTTGTCCAGCGACTTCAAG
AGGCTGGGCCTGCGGAAGCCAGGCCTGCCCCGAGGGCTGTGGCTGGCGAAGCCCTCGGCGCGGGTGCCGGGCACCAAGGCCAGCCGAGGC
AGCGGGGCTGAGGTCACGCTCATCGACTTCGGTGAGGAGCCCGTGGTCCCGGCCCTACGGCCCTGCGCGCCCTCCCTGGCGCAGCTGGCC
ATGGACGCCTGCTCCCTGCTGGACGAGACCCCGCCTCAGAGCCCCACGCGGGCACTGCCCCGGCCCCTGCACCCCACGCCTGTGGTGGAC
TGGGACGCACGCCCGCTGCCCCCCCCGCCCGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGATCTGCTCCATCAACAGCACC
CTCGTGGGCGCGGGGGTCCCTGCCGGGCCCAGCCAGGGCCAGACCAACTACGCCTTTGTGCCTGAGCAGGCGCGGCCGCCCCCTCCCCTG
GAGGACAACCTGTTCCTCCCGCCCCAGGGTGGGGGCAAGCCGCCCAGCTCCGCACAGACCGCAGAGATCTTCCAGGCGCTACAGCAGGAG
TGCATGAGGCAACTGCAGGCTCCGGCCGGCTCCCCGGCCCCCTCTCCCAGCCCGGGGGGTGACGACAAGCCCCAGGTGCCTCCTCGGGTA
CCCATCCCCCCTCGGCCCACGCGCCCACACGTCCAGCTGTCTCCAGCCCCCCCGGGCGAGGAGGAGACCAGCCAGTGGCCTGGACCTGCT
TCCCCTCCCCGGGTGCCTCCGCGGGAGCCCCTGTCCCCTCAAGGCTCGAGGACACCCAGCCCCCTGGTACCACCTGGCAGCTCCCCGCTG
CCACCCCGGCTCTCAAGCTCACCTGGGAAGACCATGCCCACCACCCAGAGCTTTGCCTCAGACCCCAAGTACGCCACCCCCCAGGTGATC
CAGGCCCCTGGCCCGCGGGCTGGTCCCTGCATCCTGCCCATCGTCCGGGATGGCAAGAAGGTCAGCAGCACCCACTATTACTTGCTGCCC
GAGCGACCATCCTACCTGGAGCGCTACCAGCGCTTCCTGCGTGAGGCCCAGAGCCCCGAGGAGCCTACCCCCCTGCCTGTGCCTCTGCTG
CTGCCCCCACCCAGCACCCCAGCCCCCGCCGCCCCCACGGCCACCGTGCGGCCGATGCCCCAGGCTGCCTTGGACCCCAAGGCCAACTTC
TCCACCAACAACAGCAACCCAGGGGCCCGGCCACCACCCCCGAGGGCCACTGCTCGGCTGCCACAGAGGGGCTGCCCTGGCGATGGGCCA
GAGGCGGGCCGGCCAGCAGACAAGATCCAGATGGTGGAGCAGCTCTTCGGGCTGGGTCTGCGGCCCAGAGGGGAGTGCCACAAAGTGCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLXNA1_ENST00000393409_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_5284nt
ATGCCGCTGCCACCGCGGAGCCTGCAGGTGCTCCTGCTGCTGCTGCTGTTGCTGCTGCTGCTGCCGGGCATGTGGGCTGAGGCAGGCTTG
CCCAGGGCAGGCGGGGGTTCACAGCCCCCCTTCCGCACCTTCTCGGCCAGCGACTGGGGCCTCACCCACCTAGTGGTGCATGAGCAGACA
GGCGAGGTGTATGTGGGCGCAGTGAACCGCATCTATAAGCTGTCGGGGAACCTGACACTGCTGCGGGCCCACGTCACGGGCCCTGTGGAG
GACAACGAGAAGTGCTACCCGCCGCCCAGCGTGCAGTCCTGCCCCCACGGCCTGGGCAGTACTGACAACGTCAACAAGCTGCTGCTGCTG
GACTATGCCGCTAACCGCCTGCTGGCCTGTGGCAGCGCCTCCCAGGGCATCTGCCAGTTCCTGCGTCTGGACGATCTCTTCAAACTGGGT
GAGCCACACCACCGTAAGGAGCACTACCTGTCCAGCGTGCAGGAGGCAGGCAGCATGGCGGGCGTGCTCATTGCCGGGCCACCGGGCCAG
GGCCAGGCCAAGCTCTTCGTGGGCACACCCATCGATGGCAAGTCCGAGTACTTCCCCACACTGTCCAGCCGTCGGCTCATGGCCAACGAG
GAGGATGCCGACATGTTCGGCTTCGTGTACCAGGATGAGTTTGTGTCATCACAGCTCAAGATCCCTTCGGACACGCTGTCCAAGTTCCCG
GCCTTTGACATCTACTATGTGTACAGCTTCCGCAGCGAGCAGTTTGTCTACTACCTCACGCTGCAGCTAGACACACAGCTGACCTCGCCT
GATGCCGCCGGCGAGCACTTCTTCACGTCCAAGATCGTGCGGCTCTGTGTGGACGACCCCAAATTCTACTCGTACGTTGAGTTCCCCATT
GGCTGCGAGCAGGCGGGTGTGGAGTACCGCCTGGTGCAGGATGCCTACCTGAGCCGGCCCGGCCGTGCCCTGGCCCACCAGCTGGGCCTG
GCTGAGGACGAGGACGTGCTGTTCACTGTGTTCGCCCAGGGCCAGAAGAACCGCGTGAAGCCACCAAAGGAGTCAGCACTGTGCCTGTTC
ACGCTCAGGGCCATCAAGGAGAAGATTAAGGAGCGCATCCAGTCCTGCTACCGTGGTGAGGGCAAGCTCTCCCTGCCGTGGCTGCTCAAC
AAGGAGCTGGGCTGCATCAACTCGCCCCTGCAGATCGATGACGACTTCTGCGGGCAGGACTTCAACCAGCCCCTGGGGGGCACAGTCACC
ATTGAGGGGACGCCCCTGTTCGTGGACAAGGATGATGGCCTGACCGCCGTGGCTGCCTATGACTATCGGGGCCGCACTGTGGTATTCGCC
GGCACGCGAAGTGGCCGCATCCGCAAGAGGCTGGGAGGCGGCAGAATGCAGCCAGAGGAGGGCACAGGCTGGCTGCTGGAGCTGCTGTCC
GAGGTGCAGCTGCAACAGTACTTCCTGCGGCTCCGAGATGACCTCAACGTCACCCGCCTGTCCCACTTTGAGTACGTCAAGAATGAGGAC
CTGGAGAAGATCGGCATGGGTCGGCCTGGCCAGCGGCGGCTGTGGGAGGCTGTGAAGAGGAGGAAGGCCTTGTGCAAACGCAAGTCGTGG
ATGAGTAAGGTGTTCAGTGGAAAGCGACTGGAGGCTGAGTTCCCACCTCATCACTCTCAGAGCACCTTCCGGAAGACCTCGCCCGCCCCT
GGGGGCCCAGCAGGGGAGGGGCCCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAGGACCTGCGCCTCCTGGAGAAGCTGGGTGATGGT
TCCTTTGGCGTGGTGCGCAGGGGCGAGTGGGACGCGCCCTCAGGGAAGACGGTGAGTGTGGCTGTGAAGTGCCTGAAGCCCGATGTCCTG
AGCCAGCCAGAAGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCACTCGCTCGACCACCGAAACCTCATCCGCCTCTACGGGGTG
GTGCTCACGCCGCCCATGAAGATGGTGACAGAGCTGGCACCTCTGGGATCGTTGTTGGACCGGCTACGTAAGCACCAGGGCCACTTCCTC
CTGGGGACTCTGAGCCGCTACGCTGTGCAGGTGGCTGAGGGCATGGGCTACCTGGAGTCCAAGCGCTTTATTCACCGTGACCTGGCTGCC
CGCAATCTGCTGTTGGCTACCCGCGACCTGGTCAAGATCGGGGACTTTGGGCTGATGCGAGCACTACCTCAGAATGACGACCATTACGTC
ATGCAGGAACATCGCAAGGTGCCCTTCGCCTGGTGTGCCCCCGAGAGCCTGAAGACACGCACCTTCTCCCATGCCAGCGACACCTGGATG
TTCGGGGTGACACTGTGGGAAATGTTCACCTACGGCCAGGAGCCCTGGATCGGCCTCAACGGCAGTCAGATCCTGCATAAGATCGACAAG
GAGGGGGAGCGGCTGCCCCGGCCCGAGGACTGTCCCCAGGACATCTACAACGTCATGGTCCAGTGCTGGGCTCACAAGCCAGAGGACAGA
CCCACGTTTGTGGCCCTGCGGGACTTCCTGCTGGAGGCCCAGCCCACAGACATGCGGGCCCTTCAGGACTTTGAGGAACCGGACAAGCTG
CACATCCAGATGAATGATGTCATCACCGTCATCGAGGGAAGGGCCGAGAACTACTGGTGGCGTGGCCAGAACACACGGACGCTGTGTGTG
GGGCCCTTCCCTCGCAACGTGGTGACCTCCGTGGCCGGCCTGTCGGCCCAGGACATCAGCCAGCCCCTGCAGAACAGCTTCATCCACACA
GGGCATGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCGGACAGGATTGACGAACTGTATCTGGGAAACCCCATGGACCCCCCCGAC
CTCCTGAGCGTGGAACTGAGCACCTCCCGGCCCCCCCAGCATCTAGGAGGGGTGAAAAGGGAGCCTCCACCTCGCCCACCTCAGCCTGCC
TTCTTCACTCAGAAACCAACCTATGACCCTGTGAGCGAGGACCAAGACCCCTTGTCCAGCGACTTCAAGAGGCTGGGCCTGCGGAAGCCA
GGCCTGCCCCGAGGGCTGTGGCTGGCGAAGCCCTCGGCGCGGGTGCCGGGCACCAAGGCCAGCCGAGGCAGCGGGGCTGAGGTCACGCTC
ATCGACTTCGGTGAGGAGCCCGTGGTCCCGGCCCTACGGCCCTGCGCGCCCTCCCTGGCGCAGCTGGCCATGGACGCCTGCTCCCTGCTG
GACGAGACCCCGCCTCAGAGCCCCACGCGGGCACTGCCCCGGCCCCTGCACCCCACGCCTGTGGTGGACTGGGACGCACGCCCGCTGCCC
CCCCCGCCCGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGATCTGCTCCATCAACAGCACCCTCGTGGGCGCGGGGGTCCCT
GCCGGGCCCAGCCAGGGCCAGACCAACTACGCCTTTGTGCCTGAGCAGGCGCGGCCGCCCCCTCCCCTGGAGGACAACCTGTTCCTCCCG
CCCCAGGGTGGGGGCAAGCCGCCCAGCTCCGCACAGACCGCAGAGATCTTCCAGGCGCTACAGCAGGAGTGCATGAGGCAACTGCAGGCT
CCGGCCGGCTCCCCGGCCCCCTCTCCCAGCCCGGGGGGTGACGACAAGCCCCAGGTGCCTCCTCGGGTACCCATCCCCCCTCGGCCCACG
CGCCCACACGTCCAGCTGTCTCCAGCCCCCCCGGGCGAGGAGGAGACCAGCCAGTGGCCTGGACCTGCTTCCCCTCCCCGGGTGCCTCCG
CGGGAGCCCCTGTCCCCTCAAGGCTCGAGGACACCCAGCCCCCTGGTACCACCTGGCAGCTCCCCGCTGCCACCCCGGCTCTCAAGCTCA
CCTGGGAAGACCATGCCCACCACCCAGAGCTTTGCCTCAGACCCCAAGTACGCCACCCCCCAGGTGATCCAGGCCCCTGGCCCGCGGGCT
GGTCCCTGCATCCTGCCCATCGTCCGGGATGGCAAGAAGGTCAGCAGCACCCACTATTACTTGCTGCCCGAGCGACCATCCTACCTGGAG
CGCTACCAGCGCTTCCTGCGTGAGGCCCAGAGCCCCGAGGAGCCTACCCCCCTGCCTGTGCCTCTGCTGCTGCCCCCACCCAGCACCCCA
GCCCCCGCCGCCCCCACGGCCACCGTGCGGCCGATGCCCCAGGCTGCCTTGGACCCCAAGGCCAACTTCTCCACCAACAACAGCAACCCA
GGGGCCCGGCCACCACCCCCGAGGGCCACTGCTCGGCTGCCACAGAGGGGCTGCCCTGGCGATGGGCCAGAGGCGGGCCGGCCAGCAGAC
AAGATCCAGATGGTGGAGCAGCTCTTCGGGCTGGGTCTGCGGCCCAGAGGGGAGTGCCACAAAGTGCTGGAGATGTTCGACTGGAACCTG
GAGCAGGCCGGCTGCCACCTTCTGGGCTCCTGGGGCCCTGCCCACCACAAGCGCTGAGATGCGTCTGGAGAGCCAGAGGGCCTGCCTGAA
GGAATCACCTGAGCCTGTCCGTCCACCAGGAGTGGGGAGATGCCCCCATCCAGTCCTGGAGGACCCGCTGCTCCTGCTGCTCCCGGGGAT
GGAGCAAGGCCAAGGCTGCGGGAGGCTGGGAGCCCTGCCCTGCCCATCCCTCCTGCACCAGCGCTGTCCCTGCACACTTTGGTTCAGTCC
CGGTGCCCCTGCCAAGATGTGGAAGGGGCCGGGTGAAGACAGGCTTGAGGGCTGCCCCAGCAGGCTCTGGGTATGACCTGCCTCTGGCCC
TGGTCCTGGGCGGGGCCTGTGGGTGGAGTAGTACCCCCAGGCCCTGCCCTGGGTGACAGACTGGGAGGAAACCAGGCTGGACCTGGGCAG
GCGGGATGTGTTGGCCACAGGGAGAGGCGGACCGGCACCCGGTGGGACCTCCTAGGACTGGGCCTTCTTCCAGGGGGCCCCTGGCAGCAG
CTGGGGTGTCGGGCAGAATGTGACTTGTGGCCTTACCATGGACTTGAATGGGACTTGGCTGGCCTCAGGATCTTGTGCCTGGAAATAGCC
TGAGGTGGCTCAGGAAGCGGAGAAAGGGTGCCAGACCATTCTCTGGCGGGGACCAGGGCCCAAGGCCCCAGGGCTGGAAGGAGACCAAGG
GGCAGCCGCCCTGGAGGGACATCAGTGCTTCCTCTTCCACCCAATTCCCCCACGCGGTTCCATGTTTTCCCACCAGCCTGTTGGCGAAGT

>In-frame_PLXNA1_ENST00000251772_chr3_126710409_+_TNK2_ENST00000381916_chr3_195615477_-_5284nt
ATGCCGCTGCCACCGCGGAGCCTGCAGGTGCTCCTGCTGCTGCTGCTGTTGCTGCTGCTGCTGCCGGGCATGTGGGCTGAGGCAGGCTTG
CCCAGGGCAGGCGGGGGTTCACAGCCCCCCTTCCGCACCTTCTCGGCCAGCGACTGGGGCCTCACCCACCTAGTGGTGCATGAGCAGACA
GGCGAGGTGTATGTGGGCGCAGTGAACCGCATCTATAAGCTGTCGGGGAACCTGACACTGCTGCGGGCCCACGTCACGGGCCCTGTGGAG
GACAACGAGAAGTGCTACCCGCCGCCCAGCGTGCAGTCCTGCCCCCACGGCCTGGGCAGTACTGACAACGTCAACAAGCTGCTGCTGCTG
GACTATGCCGCTAACCGCCTGCTGGCCTGTGGCAGCGCCTCCCAGGGCATCTGCCAGTTCCTGCGTCTGGACGATCTCTTCAAACTGGGT
GAGCCACACCACCGTAAGGAGCACTACCTGTCCAGCGTGCAGGAGGCAGGCAGCATGGCGGGCGTGCTCATTGCCGGGCCACCGGGCCAG
GGCCAGGCCAAGCTCTTCGTGGGCACACCCATCGATGGCAAGTCCGAGTACTTCCCCACACTGTCCAGCCGTCGGCTCATGGCCAACGAG
GAGGATGCCGACATGTTCGGCTTCGTGTACCAGGATGAGTTTGTGTCATCACAGCTCAAGATCCCTTCGGACACGCTGTCCAAGTTCCCG
GCCTTTGACATCTACTATGTGTACAGCTTCCGCAGCGAGCAGTTTGTCTACTACCTCACGCTGCAGCTAGACACACAGCTGACCTCGCCT
GATGCCGCCGGCGAGCACTTCTTCACGTCCAAGATCGTGCGGCTCTGTGTGGACGACCCCAAATTCTACTCGTACGTTGAGTTCCCCATT
GGCTGCGAGCAGGCGGGTGTGGAGTACCGCCTGGTGCAGGATGCCTACCTGAGCCGGCCCGGCCGTGCCCTGGCCCACCAGCTGGGCCTG
GCTGAGGACGAGGACGTGCTGTTCACTGTGTTCGCCCAGGGCCAGAAGAACCGCGTGAAGCCACCAAAGGAGTCAGCACTGTGCCTGTTC
ACGCTCAGGGCCATCAAGGAGAAGATTAAGGAGCGCATCCAGTCCTGCTACCGTGGTGAGGGCAAGCTCTCCCTGCCGTGGCTGCTCAAC
AAGGAGCTGGGCTGCATCAACTCGCCCCTGCAGATCGATGACGACTTCTGCGGGCAGGACTTCAACCAGCCCCTGGGGGGCACAGTCACC
ATTGAGGGGACGCCCCTGTTCGTGGACAAGGATGATGGCCTGACCGCCGTGGCTGCCTATGACTATCGGGGCCGCACTGTGGTATTCGCC
GGCACGCGAAGTGGCCGCATCCGCAAGAGGCTGGGAGGCGGCAGAATGCAGCCAGAGGAGGGCACAGGCTGGCTGCTGGAGCTGCTGTCC
GAGGTGCAGCTGCAACAGTACTTCCTGCGGCTCCGAGATGACCTCAACGTCACCCGCCTGTCCCACTTTGAGTACGTCAAGAATGAGGAC
CTGGAGAAGATCGGCATGGGTCGGCCTGGCCAGCGGCGGCTGTGGGAGGCTGTGAAGAGGAGGAAGGCCTTGTGCAAACGCAAGTCGTGG
ATGAGTAAGGTGTTCAGTGGAAAGCGACTGGAGGCTGAGTTCCCACCTCATCACTCTCAGAGCACCTTCCGGAAGACCTCGCCCGCCCCT
GGGGGCCCAGCAGGGGAGGGGCCCCTGCAGAGCCTCACCTGCCTCATTGGGGAGAAGGACCTGCGCCTCCTGGAGAAGCTGGGTGATGGT
TCCTTTGGCGTGGTGCGCAGGGGCGAGTGGGACGCGCCCTCAGGGAAGACGGTGAGTGTGGCTGTGAAGTGCCTGAAGCCCGATGTCCTG
AGCCAGCCAGAAGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCACTCGCTCGACCACCGAAACCTCATCCGCCTCTACGGGGTG
GTGCTCACGCCGCCCATGAAGATGGTGACAGAGCTGGCACCTCTGGGATCGTTGTTGGACCGGCTACGTAAGCACCAGGGCCACTTCCTC
CTGGGGACTCTGAGCCGCTACGCTGTGCAGGTGGCTGAGGGCATGGGCTACCTGGAGTCCAAGCGCTTTATTCACCGTGACCTGGCTGCC
CGCAATCTGCTGTTGGCTACCCGCGACCTGGTCAAGATCGGGGACTTTGGGCTGATGCGAGCACTACCTCAGAATGACGACCATTACGTC
ATGCAGGAACATCGCAAGGTGCCCTTCGCCTGGTGTGCCCCCGAGAGCCTGAAGACACGCACCTTCTCCCATGCCAGCGACACCTGGATG
TTCGGGGTGACACTGTGGGAAATGTTCACCTACGGCCAGGAGCCCTGGATCGGCCTCAACGGCAGTCAGATCCTGCATAAGATCGACAAG
GAGGGGGAGCGGCTGCCCCGGCCCGAGGACTGTCCCCAGGACATCTACAACGTCATGGTCCAGTGCTGGGCTCACAAGCCAGAGGACAGA
CCCACGTTTGTGGCCCTGCGGGACTTCCTGCTGGAGGCCCAGCCCACAGACATGCGGGCCCTTCAGGACTTTGAGGAACCGGACAAGCTG
CACATCCAGATGAATGATGTCATCACCGTCATCGAGGGAAGGGCCGAGAACTACTGGTGGCGTGGCCAGAACACACGGACGCTGTGTGTG
GGGCCCTTCCCTCGCAACGTGGTGACCTCCGTGGCCGGCCTGTCGGCCCAGGACATCAGCCAGCCCCTGCAGAACAGCTTCATCCACACA
GGGCATGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCGGACAGGATTGACGAACTGTATCTGGGAAACCCCATGGACCCCCCCGAC
CTCCTGAGCGTGGAACTGAGCACCTCCCGGCCCCCCCAGCATCTAGGAGGGGTGAAAAGGGAGCCTCCACCTCGCCCACCTCAGCCTGCC
TTCTTCACTCAGAAACCAACCTATGACCCTGTGAGCGAGGACCAAGACCCCTTGTCCAGCGACTTCAAGAGGCTGGGCCTGCGGAAGCCA
GGCCTGCCCCGAGGGCTGTGGCTGGCGAAGCCCTCGGCGCGGGTGCCGGGCACCAAGGCCAGCCGAGGCAGCGGGGCTGAGGTCACGCTC
ATCGACTTCGGTGAGGAGCCCGTGGTCCCGGCCCTACGGCCCTGCGCGCCCTCCCTGGCGCAGCTGGCCATGGACGCCTGCTCCCTGCTG
GACGAGACCCCGCCTCAGAGCCCCACGCGGGCACTGCCCCGGCCCCTGCACCCCACGCCTGTGGTGGACTGGGACGCACGCCCGCTGCCC
CCCCCGCCCGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGATCTGCTCCATCAACAGCACCCTCGTGGGCGCGGGGGTCCCT
GCCGGGCCCAGCCAGGGCCAGACCAACTACGCCTTTGTGCCTGAGCAGGCGCGGCCGCCCCCTCCCCTGGAGGACAACCTGTTCCTCCCG
CCCCAGGGTGGGGGCAAGCCGCCCAGCTCCGCACAGACCGCAGAGATCTTCCAGGCGCTACAGCAGGAGTGCATGAGGCAACTGCAGGCT
CCGGCCGGCTCCCCGGCCCCCTCTCCCAGCCCGGGGGGTGACGACAAGCCCCAGGTGCCTCCTCGGGTACCCATCCCCCCTCGGCCCACG
CGCCCACACGTCCAGCTGTCTCCAGCCCCCCCGGGCGAGGAGGAGACCAGCCAGTGGCCTGGACCTGCTTCCCCTCCCCGGGTGCCTCCG
CGGGAGCCCCTGTCCCCTCAAGGCTCGAGGACACCCAGCCCCCTGGTACCACCTGGCAGCTCCCCGCTGCCACCCCGGCTCTCAAGCTCA
CCTGGGAAGACCATGCCCACCACCCAGAGCTTTGCCTCAGACCCCAAGTACGCCACCCCCCAGGTGATCCAGGCCCCTGGCCCGCGGGCT
GGTCCCTGCATCCTGCCCATCGTCCGGGATGGCAAGAAGGTCAGCAGCACCCACTATTACTTGCTGCCCGAGCGACCATCCTACCTGGAG
CGCTACCAGCGCTTCCTGCGTGAGGCCCAGAGCCCCGAGGAGCCTACCCCCCTGCCTGTGCCTCTGCTGCTGCCCCCACCCAGCACCCCA
GCCCCCGCCGCCCCCACGGCCACCGTGCGGCCGATGCCCCAGGCTGCCTTGGACCCCAAGGCCAACTTCTCCACCAACAACAGCAACCCA
GGGGCCCGGCCACCACCCCCGAGGGCCACTGCTCGGCTGCCACAGAGGGGCTGCCCTGGCGATGGGCCAGAGGCGGGCCGGCCAGCAGAC
AAGATCCAGATGGTGGAGCAGCTCTTCGGGCTGGGTCTGCGGCCCAGAGGGGAGTGCCACAAAGTGCTGGAGATGTTCGACTGGAACCTG
GAGCAGGCCGGCTGCCACCTTCTGGGCTCCTGGGGCCCTGCCCACCACAAGCGCTGAGATGCGTCTGGAGAGCCAGAGGGCCTGCCTGAA
GGAATCACCTGAGCCTGTCCGTCCACCAGGAGTGGGGAGATGCCCCCATCCAGTCCTGGAGGACCCGCTGCTCCTGCTGCTCCCGGGGAT
GGAGCAAGGCCAAGGCTGCGGGAGGCTGGGAGCCCTGCCCTGCCCATCCCTCCTGCACCAGCGCTGTCCCTGCACACTTTGGTTCAGTCC
CGGTGCCCCTGCCAAGATGTGGAAGGGGCCGGGTGAAGACAGGCTTGAGGGCTGCCCCAGCAGGCTCTGGGTATGACCTGCCTCTGGCCC
TGGTCCTGGGCGGGGCCTGTGGGTGGAGTAGTACCCCCAGGCCCTGCCCTGGGTGACAGACTGGGAGGAAACCAGGCTGGACCTGGGCAG
GCGGGATGTGTTGGCCACAGGGAGAGGCGGACCGGCACCCGGTGGGACCTCCTAGGACTGGGCCTTCTTCCAGGGGGCCCCTGGCAGCAG
CTGGGGTGTCGGGCAGAATGTGACTTGTGGCCTTACCATGGACTTGAATGGGACTTGGCTGGCCTCAGGATCTTGTGCCTGGAAATAGCC
TGAGGTGGCTCAGGAAGCGGAGAAAGGGTGCCAGACCATTCTCTGGCGGGGACCAGGGCCCAAGGCCCCAGGGCTGGAAGGAGACCAAGG
GGCAGCCGCCCTGGAGGGACATCAGTGCTTCCTCTTCCACCCAATTCCCCCACGCGGTTCCATGTTTTCCCACCAGCCTGTTGGCGAAGT


Top

FusionGenePPI for PLXNA1_TNK2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLXNA1AKT1, PLXNA1, KDR, RHOD, FBXO6, PDIA3, HLA-DRA, TAZ, SUSD4, LGALS9, TMEM25, CANT1, PTCH1, PTPRK, NRP1, GAN, OS9, FAM19A4, ST8SIA4, DEFA5, SCGB1D1, DEFA1, MGAT4CTNK2HSH2D, GRB2, CDC42, CLTC, FYN, MCF2, EGFR, NEDD4, CLTA, AMPH, BIN1, FABP4, NEDD4L, SMURF1, WWP2, HECW1, BAG3, MAGI3, WWOX, SRC, KAT8, KAT5, AXL, PDGFRB, LTK, ALK, EEA1, BCAR1, HSP90AA1, MERTK, AR, NPHP1, WAS, SNX9, ZBTB16, EP300, TP73, YES1, HCK, LYN, NCK1, CTTN, TNK2, KCNA5, SIAH1, SIAH2, ATG16L1, SQSTM1, NBR1, TP53, NTRK1, NTRK2, NTRK3, TRIM50, AQP1, GALT, SH2D1A, NEK6, KRTAP10-3, NOTCH2NL, NCK2, KDM3A, AKT1, PDK1, SOCS4, GAK, GTSE1, FGFR1, HSP90AB3P, ISG15, CDC37, LCP2, STAT1, HSP90AB1, HSPA9, SLC25A5, CSK, HSP90AB2P, HAX1, CRKL


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLXNA1_TNK2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLXNA1_TNK2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTNK2C0023903Liver neoplasms1CTD_human
TgeneTNK2C0032927Precancerous Conditions1CTD_human