FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27667

FusionGeneSummary for PLEKHM2_IGF2BP2

check button Fusion gene summary
Fusion gene informationFusion gene name: PLEKHM2_IGF2BP2
Fusion gene ID: 27667
HgeneTgene
Gene symbol

PLEKHM2

IGF2BP2

Gene ID

23207

10644

Gene namepleckstrin homology and RUN domain containing M2insulin like growth factor 2 mRNA binding protein 2
SynonymsSKIPIMP-2|IMP2|VICKZ2
Cytomap

1p36.21

3q27.2

Type of geneprotein-codingprotein-coding
Descriptionpleckstrin homology domain-containing family M member 2PH domain-containing family M member 2SifA (Salmonella-induced filaments A) and kinesin-interacting proteinnovel RUN and PH domain-containing proteinpleckstrin homology domain containing, family Minsulin-like growth factor 2 mRNA-binding protein 2IGF-II mRNA-binding protein 2IGF2 mRNA-binding protein 2VICKZ family member 2
Modification date2018052320180520
UniProtAcc

Q8IWE5

Q9Y6M1

Ensembl transtripts involved in fusion geneENST00000375799, ENST00000375793, 
ENST00000477849, 
ENST00000382199, 
ENST00000421047, ENST00000457616, 
ENST00000346192, ENST00000494906, 
Fusion gene scores* DoF score4 X 3 X 4=484 X 4 X 3=48
# samples 45
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PLEKHM2 [Title/Abstract] AND IGF2BP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePLEKHM2

GO:1903527

positive regulation of membrane tubulation

18996344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-R6-A6Y2-01BPLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375799ENST00000382199PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375799ENST00000421047PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375799ENST00000457616PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375799ENST00000346192PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
5CDS-intronENST00000375799ENST00000494906PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375793ENST00000382199PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375793ENST00000421047PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375793ENST00000457616PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
In-frameENST00000375793ENST00000346192PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
5CDS-intronENST00000375793ENST00000494906PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
intron-3CDSENST00000477849ENST00000382199PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
intron-3CDSENST00000477849ENST00000421047PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
intron-3CDSENST00000477849ENST00000457616PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
intron-3CDSENST00000477849ENST00000346192PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-
intron-intronENST00000477849ENST00000494906PLEKHM2chr1

16046415

+IGF2BP2chr3

185410550

-

Top

FusionProtFeatures for PLEKHM2_IGF2BP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLEKHM2

Q8IWE5

IGF2BP2

Q9Y6M1

RNA-binding factor that recruits target transcripts tocytoplasmic protein-RNA complexes (mRNPs). This transcript'caging' into mRNPs allows mRNA transport and transient storage.It also modulates the rate and location at which targettranscripts encounter the translational apparatus and shields themfrom endonuclease attacks or microRNA-mediated degradation (Bysimilarity). Binds to the 5'-UTR of the insulin-like growth factor2 (IGF2) mRNAs. Binding is isoform-specific. Binds to beta-actin/ACTB and MYC transcripts. {ECO:0000250,ECO:0000269|PubMed:23640942, ECO:0000269|PubMed:9891060}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+62036_1582171020DomainRUN
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-315193_258113557DomainKH 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-315274_341113557DomainKH 2
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-315427_492113557DomainKH 3
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-315509_575113557DomainKH 4
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-316193_258113600DomainKH 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-316274_341113600DomainKH 2
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-316427_492113600DomainKH 3
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-316509_575113600DomainKH 4
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-015193_2580543DomainKH 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-015274_3410543DomainKH 2
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-0153_760543DomainRRM 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-015427_4920543DomainKH 3
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-015509_5750543DomainKH 4
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000421047-01582_1570543DomainRRM 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620317_3202171020Compositional biasNote=Poly-Lys
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620323_3262171020Compositional biasNote=Poly-Lys
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620506_5112171020Compositional biasNote=Poly-Gly
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620593_5962171020Compositional biasNote=Poly-Leu
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620771_8732171020DomainPH
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-3153_76113557DomainRRM 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000346192-31582_157113557DomainRRM 2
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-3163_76113600DomainRRM 1
TgeneIGF2BP2chr1:16046415chr3:185410550ENST00000382199-31682_157113600DomainRRM 2


Top

FusionGeneSequence for PLEKHM2_IGF2BP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_704aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPP
QRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
MILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLR
EAFENDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPT
QAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIG

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_217aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_217aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_661aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPP
QRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
MILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLR
EAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIIT
GPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQ

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_704aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPP
QRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
MILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLR
EAFENDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPT
QAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIG

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_217aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_217aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_661aa
MEPGEVKDRILENISLSVKKLQSYFAACEDEIPAIRNHDKVLQRLCEHLDHALLYGLQDLSSGYWVLVVHFTRREAIKQIEVLQHVATNL
GRSRAWLYLALNENSLESYLRLFQENLGLLHKYYVKNALVCSHDHLTLFLTLVSGLEFIRFELDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPP
QRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACR
MILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLR
EAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIIT
GPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_2112nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT
GCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCC
ATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCT
CAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTG
CGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGG
GTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGC
ATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTT
GGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTG
AGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGT
GAGGCCTTTGAAAATGATATGCTGGCTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACA
GGACTGTCCGTGCTATCTCCACCAGCAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTC
TCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACC
CAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCG
GAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTG
AAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGC
AAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAA
GTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAG

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_652nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_652nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_1983nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT
GCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCC
ATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCT
CAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTG
CGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGG
GTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGC
ATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTT
GGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTG
AGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGT
GAGGCCTTTGAAAATGATATGCTGGCTGTTAACACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCG
CATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACAC
ATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACC
GGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAG
CTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACC
AGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAG
ACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAG

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_2112nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT
GCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCC
ATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCT
CAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTG
CGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGG
GTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGC
ATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTT
GGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTG
AGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGT
GAGGCCTTTGAAAATGATATGCTGGCTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACA
GGACTGTCCGTGCTATCTCCACCAGCAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTC
TCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACC
CAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCG
GAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTG
AAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGC
AAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAA
GTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAG

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_652nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_652nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_1983nt
ATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGAT
GAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTC
TCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTG
GGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTG
CATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGT
TTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGAC
CGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGT
GCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCC
ATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCT
CAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTG
CGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGG
GTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGC
ATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTT
GGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTG
AGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGT
GAGGCCTTTGAAAATGATATGCTGGCTGTTAACACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCG
CATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACAC
ATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACC
GGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAG
CTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACC
AGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAG
ACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_4131nt
GCCTCCTTCCCCGCCGGCCGCGCTCCGGAGCCTCCGGGCCGCGGTGGAGCGAGGGCCCAGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGG
GCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGCCCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGG
GCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCT
CGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTC
TGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAG
AGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACT
CCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATC
ACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCT
ACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCA
ACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCG
CCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCA
AGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCC
ACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAA
AGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGC
CTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAAC
TAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTG
AACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAG
TTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGAAAATGATATGCTGGCTGTTAACCAACAAGCCA
ATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACAGGACTGTCCGTGCTATCTCCACCAGCAGGGCCCCGCGGAGCTC
CCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATC
ATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCA
AACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGC
CACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGG
AAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTG
CAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTG
CACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAGTGAG
GCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCCCTTCCAACACCTGACAGAATGAGACCAAACGCAGCCAGCCAGATCGGGAG
CAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGGCGGCCAGGGACTCTGCCGAGGCCCTGAGAACCCCAGGGGCCGAGGAGGGG
CGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCCGCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTCAGCCATCCACTTCACCAT
CCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTTTTAGTTGAACTAACATAGGTGAACGTGTTCAAAGCCAAGCAAAATGCACA
CCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTACATATTAGAAAGGGAAGATGTTAAGATATGTGGCCTGTGGGTTACACAGGG
TGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAATAACTCAACTAACTCCAATTTTTAATCAATTATTAATTTTTTTTTCTTTT
TAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAGTCTTTGGGAGGTCTCACGGTGTAGAGAGGAGCTTTGAGGCCACCCGCACA
AAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCACGGCAGTTCTGGATCACCTGTGTATGTCAACAGAAGGGATACCGTCTCCTT
GAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCATACACCCATTTCTCTTTGCTTCACAGGTTTTAAACTGGTTTTTTGCATAC
TGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCCTCCCTCCCCTCCCCTTCTTCTCCATCTCCATTCTTTTGAATTTCCTCATC
CCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCCAGGCAAAGCAGTGCTCTGAGTATCACATCACACAAAAGGAACAAAAGCGA
AACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAAAGAACAAGAGTCAATGGTACTTGTCCTAGCGTTTTGGAAGAGGAAAACAG
GAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAATTCCACAATGAAAGAATGTATTTTGTCTTTTTGCATTTTGGTGTATAAGC
CATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAAAAAATGTGGAGGAAAGTAGAAATTTACCAAGGTTGTTGGCCCAGGGCGTT
AAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGAAGCTACCTCAGGTGTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTA
GAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTTTTTTAATAAAAATGAGTTGGAAAAAAAATAAGATATCAACTGCCAGCCTG
GAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAATTGTCTTCCGCTAGCCAAGAACCTATATGGCCTTCTTTTGGACAAACCTTG
AAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAACAGAGAGAGAGAATATTGGAGATGTCCTGAATTTTAATAGGGTACGCGCC
ATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTTTATGTGGACAAGCCATTATACCACCAGACTGCAATGCCAGTTTCCTCTAC

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_4149nt
GCCTCCTTCCCCGCCGGCCGCGCTCCGGAGCCTCCGGGCCGCGGTGGAGCGAGGGCCCAGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGG
GCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGCCCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGG
GCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCT
CGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTC
TGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAG
AGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACT
CCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATC
ACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCT
ACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCA
ACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCCATCTAGTGAGGTTTTTGCCTTTTCCCTAGTCA
ACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCTAAGCGGGCATCAGT
TTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCAGCGTGGGGACCACT
CTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTG
TTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCATAGAAAAGAGAACT
CTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGAAATCATGCAGAAAG
AGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGATTGGAAAAGAAGGCA
GAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAACCCGGAAAGAACCA
TCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGAAAATGATATGCTGG
CTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACAGGACTGTCCGTGCTATCTCCACCAG
CAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGT
TTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGA
AGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGA
TGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCA
AAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAAC
TGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACT
TCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCT
CACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCCCTTCCAACACCTGACAGAATGAGACCAAACGC
AGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGGCGGCCAGGGACTCTGCCGAGGCCCTGAGAACC
CCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCCGCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTC
AGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTTTTAGTTGAACTAACATAGGTGAACGTGTTCAA
AGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTACATATTAGAAAGGGAAGATGTTAAGATATGTGG
CCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAATAACTCAACTAACTCCAATTTTTAATCAATTA
TTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAGTCTTTGGGAGGTCTCACGGTGTAGAGAGGAGC
TTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCACGGCAGTTCTGGATCACCTGTGTATGTCAACAG
AAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCATACACCCATTTCTCTTTGCTTCACAGGTTTTA
AACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCCTCCCTCCCCTCCCCTTCTTCTCCATCTCCATT
CTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCCAGGCAAAGCAGTGCTCTGAGTATCACATCACA
CAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAAAGAACAAGAGTCAATGGTACTTGTCCTAGCGT
TTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAATTCCACAATGAAAGAATGTATTTTGTCTTTTT
GCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAAAAAATGTGGAGGAAAGTAGAAATTTACCAAGG
TTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGAAGCTACCTCAGGTGTTTTTACCTCAGCACCTT
GCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTTTTTTAATAAAAATGAGTTGGAAAAAAAATAAG
ATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAATTGTCTTCCGCTAGCCAAGAACCTATATGGCCT
TCTTTTGGACAAACCTTGAAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAACAGAGAGAGAGAATATTGGAGATGTCCTGAAT
TTTAATAGGGTACGCGCCATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTTTATGTGGACAAGCCATTATACCACCAGACTGC
AATGCCAGTTTCCTCTACTGCAAACAGTGTTCTGTGACAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAGAAAAAACAGAAATATATCCAG

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_4149nt
GCCTCCTTCCCCGCCGGCCGCGCTCCGGAGCCTCCGGGCCGCGGTGGAGCGAGGGCCCAGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGG
GCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGCCCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGG
GCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCT
CGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTC
TGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAG
AGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACT
CCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATC
ACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCT
ACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCA
ACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCCATCTAGTGAGGTTTTTGCCTTTTCCCTAGTCA
ACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCTAAGCGGGCATCAGT
TTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCAGCGTGGGGACCACT
CTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTG
TTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCATAGAAAAGAGAACT
CTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGAAATCATGCAGAAAG
AGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGATTGGAAAAGAAGGCA
GAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAACCCGGAAAGAACCA
TCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGAAAATGATATGCTGG
CTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACAGGACTGTCCGTGCTATCTCCACCAG
CAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGT
TTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGA
AGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGA
TGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCA
AAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAAC
TGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACT
TCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCT
CACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCCCTTCCAACACCTGACAGAATGAGACCAAACGC
AGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGGCGGCCAGGGACTCTGCCGAGGCCCTGAGAACC
CCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCCGCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTC
AGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTTTTAGTTGAACTAACATAGGTGAACGTGTTCAA
AGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTACATATTAGAAAGGGAAGATGTTAAGATATGTGG
CCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAATAACTCAACTAACTCCAATTTTTAATCAATTA
TTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAGTCTTTGGGAGGTCTCACGGTGTAGAGAGGAGC
TTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCACGGCAGTTCTGGATCACCTGTGTATGTCAACAG
AAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCATACACCCATTTCTCTTTGCTTCACAGGTTTTA
AACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCCTCCCTCCCCTCCCCTTCTTCTCCATCTCCATT
CTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCCAGGCAAAGCAGTGCTCTGAGTATCACATCACA
CAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAAAGAACAAGAGTCAATGGTACTTGTCCTAGCGT
TTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAATTCCACAATGAAAGAATGTATTTTGTCTTTTT
GCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAAAAAATGTGGAGGAAAGTAGAAATTTACCAAGG
TTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGAAGCTACCTCAGGTGTTTTTACCTCAGCACCTT
GCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTTTTTTAATAAAAATGAGTTGGAAAAAAAATAAG
ATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAATTGTCTTCCGCTAGCCAAGAACCTATATGGCCT
TCTTTTGGACAAACCTTGAAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAACAGAGAGAGAGAATATTGGAGATGTCCTGAAT
TTTAATAGGGTACGCGCCATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTTTATGTGGACAAGCCATTATACCACCAGACTGC
AATGCCAGTTTCCTCTACTGCAAACAGTGTTCTGTGACAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAGAAAAAACAGAAATATATCCAG

>In-frame_PLEKHM2_ENST00000375799_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_3766nt
GCCTCCTTCCCCGCCGGCCGCGCTCCGGAGCCTCCGGGCCGCGGTGGAGCGAGGGCCCAGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGG
GCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGCCCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGG
GCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGGGGAGGTGAAGGACCGGATCCTGGAGAACATCT
CGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGCCATCCGGAACCATGACAAGGTCCTACAGCGTC
TGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTACTGGGTGCTCGTGGTGCATTTTACTCGGAGAG
AGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCGTGCCTGGCTGTACCTGGCCCTCAACGAGAACT
CCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTACGTCAAGAATGCCCTGGTCTGCAGCCACGATC
ACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGATCTGGATGCCCCTTACCTAGACCTGGCCCCCT
ACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAGCTCGGTCCACGGCTCAGACAGTCTGTCCCTCA
ACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCCATCTAGTGAGGTCAACACAGACACAGAAACCG
CCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCA
AGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCC
ACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAA
AGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGC
CTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAAC
TAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTG
AACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAG
TTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGAAAATGATATGCTGGCTGTTAACACCCACTCCG
GATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCA
TCCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTG
CCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTG
GGAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGG
TGATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAA
ATGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGC
AGCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGC
CCTTCCAACACCTGACAGAATGAGACCAAACGCAGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAG
GCGGCCAGGGACTCTGCCGAGGCCCTGAGAACCCCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCC
CGCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTCAGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCT
TTTAGTTGAACTAACATAGGTGAACGTGTTCAAAGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTA
CATATTAGAAAGGGAAGATGTTAAGATATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAA
ATAACTCAACTAACTCCAATTTTTAATCAATTATTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAA
GTCTTTGGGAGGTCTCACGGTGTAGAGAGGAGCTTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCA
CGGCAGTTCTGGATCACCTGTGTATGTCAACAGAAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTC
ATACACCCATTTCTCTTTGCTTCACAGGTTTTAAACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCC
CTCCCTCCCCTCCCCTTCTTCTCCATCTCCATTCTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCC
CAGGCAAAGCAGTGCTCTGAGTATCACATCACACAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAA
AAGAACAAGAGTCAATGGTACTTGTCCTAGCGTTTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAA
ATTCCACAATGAAAGAATGTATTTTGTCTTTTTGCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAA
AAAAATGTGGAGGAAAGTAGAAATTTACCAAGGTTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAG
AAGCTACCTCAGGTGTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATT
TTTTTAATAAAAATGAGTTGGAAAAAAAATAAGATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAA

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000382199_chr3_185410550_-_4073nt
AGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGGGCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGC
CCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGGGCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGG
GGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGC
CATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTA
CTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCG
TGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTA
CGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGA
TCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAG
CTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCC
ATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCT
AAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCA
GCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGT
CCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCA
TAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGA
AATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGAT
TGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAA
CCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGA
AAATGATATGCTGGCTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTTTTCAACAGGACTGTCCGT
GCTATCTCCACCAGCAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGGATACTTCTCCAGCCTGTA
CCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGG
CGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGA
CGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAA
CTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAA
GACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAG
AATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCC
TCAGGGAGTCGCCTCACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCCCTTCCAACACCTGACAGA
ATGAGACCAAACGCAGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGGCGGCCAGGGACTCTGCCG
AGGCCCTGAGAACCCCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCCGCCTCCCGCCCCCCAGGG
CTTCTGCAGGCTTCAGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTTTTAGTTGAACTAACATAG
GTGAACGTGTTCAAAGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTACATATTAGAAAGGGAAGAT
GTTAAGATATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAATAACTCAACTAACTCCAA
TTTTTAATCAATTATTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAGTCTTTGGGAGGTCTCACG
GTGTAGAGAGGAGCTTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCACGGCAGTTCTGGATCACCT
GTGTATGTCAACAGAAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCATACACCCATTTCTCTTTG
CTTCACAGGTTTTAAACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCCTCCCTCCCCTCCCCTTCT
TCTCCATCTCCATTCTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCCAGGCAAAGCAGTGCTCTG
AGTATCACATCACACAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAAAGAACAAGAGTCAATGGT
ACTTGTCCTAGCGTTTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAATTCCACAATGAAAGAATG
TATTTTGTCTTTTTGCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAAAAAATGTGGAGGAAAGTA
GAAATTTACCAAGGTTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGAAGCTACCTCAGGTGTTTT
TACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTTTTTTAATAAAAATGAGTT
GGAAAAAAAATAAGATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAATTGTCTTCCGCTAGCCAAG
AACCTATATGGCCTTCTTTTGGACAAACCTTGAAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAACAGAGAGAGAGAATATTG
GAGATGTCCTGAATTTTAATAGGGTACGCGCCATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTTTATGTGGACAAGCCATTA
TACCACCAGACTGCAATGCCAGTTTCCTCTACTGCAAACAGTGTTCTGTGACAAAAAAAAAAAAAAAAAAAAGAAAAAAAAAGAAAAAAC

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000421047_chr3_185410550_-_4091nt
AGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGGGCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGC
CCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGGGCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGG
GGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGC
CATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTA
CTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCG
TGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTA
CGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGA
TCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAG
CTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCC
ATCTAGTGAGGTTTTTGCCTTTTCCCTAGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAA
AATAGCCATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTC
GCCCCCTCAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTT
CCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCA
GTCCCGGGTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGC
ATGCCGCATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGG
CTTGGTTGGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCA
GGATTTGAGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAA
GCTGCGTGAGGCCTTTGAAAATGATATGCTGGCTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTT
TTCAACAGGACTGTCCGTGCTATCTCCACCAGCAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGG
ATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCAT
CCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGC
CCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGG
GAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGT
GATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAA
TGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCA
GCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCC
CTTCCAACACCTGACAGAATGAGACCAAACGCAGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGG
CGGCCAGGGACTCTGCCGAGGCCCTGAGAACCCCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCC
GCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTCAGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTT
TTAGTTGAACTAACATAGGTGAACGTGTTCAAAGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTAC
ATATTAGAAAGGGAAGATGTTAAGATATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAA
TAACTCAACTAACTCCAATTTTTAATCAATTATTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAG
TCTTTGGGAGGTCTCACGGTGTAGAGAGGAGCTTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCAC
GGCAGTTCTGGATCACCTGTGTATGTCAACAGAAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCA
TACACCCATTTCTCTTTGCTTCACAGGTTTTAAACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCC
TCCCTCCCCTCCCCTTCTTCTCCATCTCCATTCTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCC
AGGCAAAGCAGTGCTCTGAGTATCACATCACACAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAA
AGAACAAGAGTCAATGGTACTTGTCCTAGCGTTTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAA
TTCCACAATGAAAGAATGTATTTTGTCTTTTTGCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAA
AAAATGTGGAGGAAAGTAGAAATTTACCAAGGTTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGA
AGCTACCTCAGGTGTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTT
TTTTAATAAAAATGAGTTGGAAAAAAAATAAGATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAAT
TGTCTTCCGCTAGCCAAGAACCTATATGGCCTTCTTTTGGACAAACCTTGAAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAA
CAGAGAGAGAGAATATTGGAGATGTCCTGAATTTTAATAGGGTACGCGCCATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTT
TATGTGGACAAGCCATTATACCACCAGACTGCAATGCCAGTTTCCTCTACTGCAAACAGTGTTCTGTGACAAAAAAAAAAAAAAAAAAAA

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000457616_chr3_185410550_-_4091nt
AGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGGGCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGC
CCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGGGCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGG
GGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGC
CATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTA
CTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCG
TGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTA
CGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGA
TCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAG
CTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCC
ATCTAGTGAGGTTTTTGCCTTTTCCCTAGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAA
AATAGCCATGGAGAAGCTAAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTC
GCCCCCTCAGCGAGCCCAGCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTT
CCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCA
GTCCCGGGTAGATATCCATAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGC
ATGCCGCATGATTCTTGAAATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGG
CTTGGTTGGAAGACTGATTGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCA
GGATTTGAGCATATACAACCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAA
GCTGCGTGAGGCCTTTGAAAATGATATGCTGGCTGTTAACCAACAAGCCAATCTGATCCCAGGGTTGAACCTCAGCGCACTTGGCATCTT
TTCAACAGGACTGTCCGTGCTATCTCCACCAGCAGGGCCCCGCGGAGCTCCCCCCGCTGCCCCCTACCACCCCTTCACTACCCACTCCGG
ATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTCTTATCCAGAGCAGGAGATTGTGAATCTCTTCAT
CCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCTGGCGAGATTCGCCGGAGCCTCTATCAAGATTGC
CCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGAAGCCCAGTTCAAGGCCCAGGGACGGATCTTTGG
GAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCATATCAGAGTGCCCTCTTCCACAGCTGGCCGGGT
GATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGTCATCGTGCCTCGTGACCAAACGCCAGATGAAAA
TGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCGCAAGATCAGGGAAATTGTACAACAGGTGAAGCA
GCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAGTGAGGCTCCCACAGGCACCAGCAAAACAACGGATGAATGTAGCC
CTTCCAACACCTGACAGAATGAGACCAAACGCAGCCAGCCAGATCGGGAGCAAACCAAAGACCATCTGAGGAATGAGAAGTCTGCGGAGG
CGGCCAGGGACTCTGCCGAGGCCCTGAGAACCCCAGGGGCCGAGGAGGGGCGGGGAAGGTCAGCCAGGTTTGCCAGAACCACCGAGCCCC
GCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTCAGCCATCCACTTCACCATCCACTCGGATCTCTCCTGAACTCCCACGACGCTATCCCTT
TTAGTTGAACTAACATAGGTGAACGTGTTCAAAGCCAAGCAAAATGCACACCCTTTTTCTGTGGCAAATCGTCTCTGTACATGTGTGTAC
ATATTAGAAAGGGAAGATGTTAAGATATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGGTAATATATTTTAGAAATAATATATCAAA
TAACTCAACTAACTCCAATTTTTAATCAATTATTAATTTTTTTTTCTTTTTAAAGAGAAAGCAGGCTTTTCTAGACTTTAAAGAATAAAG
TCTTTGGGAGGTCTCACGGTGTAGAGAGGAGCTTTGAGGCCACCCGCACAAAATTCACCCAGAGGGAAATCTCGTCGGAAGGACACTCAC
GGCAGTTCTGGATCACCTGTGTATGTCAACAGAAGGGATACCGTCTCCTTGAAGAGGAAACTCTGTCACTCCTCATGCCTGTCTAGCTCA
TACACCCATTTCTCTTTGCTTCACAGGTTTTAAACTGGTTTTTTGCATACTGCTATATAATTCTCTGTCTCTCTCTGTTTATCTCTCCCC
TCCCTCCCCTCCCCTTCTTCTCCATCTCCATTCTTTTGAATTTCCTCATCCCTCCATCTCAATCCCGTATCTACGCACCCCCCCCCCCCC
AGGCAAAGCAGTGCTCTGAGTATCACATCACACAAAAGGAACAAAAGCGAAACACACAAACCAGCCTCAACTTACACTTGGTTACTCAAA
AGAACAAGAGTCAATGGTACTTGTCCTAGCGTTTTGGAAGAGGAAAACAGGAACCCACCAAACCAACCAATCAACCAAACAAAGAAAAAA
TTCCACAATGAAAGAATGTATTTTGTCTTTTTGCATTTTGGTGTATAAGCCATCAATATTCAGCAAAATGATTCCTTTCTTTAAAAAAAA
AAAATGTGGAGGAAAGTAGAAATTTACCAAGGTTGTTGGCCCAGGGCGTTAAATTCACAGATTTTTTTAACGAGAAAAACACACAGAAGA
AGCTACCTCAGGTGTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAGCTGATAGTTGGAGCATTTTTTTATTT
TTTTAATAAAAATGAGTTGGAAAAAAAATAAGATATCAACTGCCAGCCTGGAGAAGGTGACAGTCCAAGTGTGCAACAGCTGTTCTGAAT
TGTCTTCCGCTAGCCAAGAACCTATATGGCCTTCTTTTGGACAAACCTTGAAAATGTTTATTTAAAAAAAAAAAAGATGACAAAGAAAAA
CAGAGAGAGAGAATATTGGAGATGTCCTGAATTTTAATAGGGTACGCGCCATTAGGGCTTTTTGCGCTAAAGGATGAACATGTACTGGTT
TATGTGGACAAGCCATTATACCACCAGACTGCAATGCCAGTTTCCTCTACTGCAAACAGTGTTCTGTGACAAAAAAAAAAAAAAAAAAAA

>In-frame_PLEKHM2_ENST00000375793_chr1_16046415_+_IGF2BP2_ENST00000346192_chr3_185410550_-_3708nt
AGGCGAGGCGAGGGCCGGGCGGCGGGCGCCGGGCCCCGCGGCCGGCACGACGGAGCCCCCGTACGGCCGGCGGCAGCGGTTGGCGGCGGC
CCCCGGCCCCCGGCGCGGGAAGCGGCGGCGGGGCGGCGGCGGCGGTGGCGGTGGCGGTGGCGGCGACGGTGGCAGCGCCATGGAGCCGGG
GGAGGTGAAGGACCGGATCCTGGAGAACATCTCGCTGTCGGTGAAGAAGTTGCAGAGCTATTTTGCTGCATGTGAGGATGAGATCCCTGC
CATCCGGAACCATGACAAGGTCCTACAGCGTCTGTGTGAGCACCTGGACCACGCCCTGCTGTACGGACTGCAAGACCTCTCCTCTGGCTA
CTGGGTGCTCGTGGTGCATTTTACTCGGAGAGAGGCCATCAAGCAGATCGAGGTGCTGCAGCACGTGGCCACCAACCTGGGGCGCAGCCG
TGCCTGGCTGTACCTGGCCCTCAACGAGAACTCCTTGGAGAGCTACCTGCGGTTGTTCCAGGAGAACCTGGGCCTGCTGCATAAGTACTA
CGTCAAGAATGCCCTGGTCTGCAGCCACGATCACCTGACGCTCTTCCTGACCTTGGTGTCCGGGCTAGAGTTCATTCGTTTCGAGCTGGA
TCTGGATGCCCCTTACCTAGACCTGGCCCCCTACATGCCCGACTACTACAAACCTCAGTACCTGCTGGACTTTGAAGACCGCCTTCCCAG
CTCGGTCCACGGCTCAGACAGTCTGTCCCTCAACTCTTTCAACTCCGTCACCTCCACCAACCTGGAGTGGGATGACAGTGCGATTGCCCC
ATCTAGTGAGGTCAACACAGACACAGAAACCGCCGTTGTCAACGTCACATATGCAACAAGAGAAGAAGCAAAAATAGCCATGGAGAAGCT
AAGCGGGCATCAGTTTGAGAACTACTCCTTCAAGATTTCCTACATCCCGGATGAAGAGGTGAGCTCCCCTTCGCCCCCTCAGCGAGCCCA
GCGTGGGGACCACTCTTCCCGGGAGCAAGGCCACGCCCCTGGGGGCACTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGT
CCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCGGGTAGATATCCA
TAGAAAAGAGAACTCTGGAGCTGCAGAGAAGCCTGTCACCATCCATGCCACCCCAGAGGGGACTTCTGAAGCATGCCGCATGATTCTTGA
AATCATGCAGAAAGAGGCAGATGAGACCAAACTAGCCGAAGAGATTCCTCTGAAAATCTTGGCACACAATGGCTTGGTTGGAAGACTGAT
TGGAAAAGAAGGCAGAAATTTGAAGAAAATTGAACATGAAACAGGGACCAAGATAACAATCTCATCTTTGCAGGATTTGAGCATATACAA
CCCGGAAAGAACCATCACTGTGAAGGGCACAGTTGAGGCCTGTGCCAGTGCTGAGATAGAGATTATGAAGAAGCTGCGTGAGGCCTTTGA
AAATGATATGCTGGCTGTTAACACCCACTCCGGATACTTCTCCAGCCTGTACCCCCATCACCAGTTTGGCCCGTTCCCGCATCATCACTC
TTATCCAGAGCAGGAGATTGTGAATCTCTTCATCCCAACCCAGGCTGTGGGCGCCATCATCGGGAAGAAGGGGGCACACATCAAACAGCT
GGCGAGATTCGCCGGAGCCTCTATCAAGATTGCCCCTGCGGAAGGCCCAGACGTCAGCGAAAGGATGGTCATCATCACCGGGCCACCGGA
AGCCCAGTTCAAGGCCCAGGGACGGATCTTTGGGAAACTGAAAGAGGAAAACTTCTTTAACCCCAAAGAAGAAGTGAAGCTGGAAGCGCA
TATCAGAGTGCCCTCTTCCACAGCTGGCCGGGTGATTGGCAAAGGTGGCAAGACCGTGAACGAACTGCAGAACTTAACCAGTGCAGAAGT
CATCGTGCCTCGTGACCAAACGCCAGATGAAAATGAGGAAGTGATCGTCAGAATTATCGGGCACTTCTTTGCTAGCCAGACTGCACAGCG
CAAGATCAGGGAAATTGTACAACAGGTGAAGCAGCAGGAGCAGAAATACCCTCAGGGAGTCGCCTCACAGCGCAGCAAGTGAGGCTCCCA
CAGGCACCAGCAAAACAACGGATGAATGTAGCCCTTCCAACACCTGACAGAATGAGACCAAACGCAGCCAGCCAGATCGGGAGCAAACCA
AAGACCATCTGAGGAATGAGAAGTCTGCGGAGGCGGCCAGGGACTCTGCCGAGGCCCTGAGAACCCCAGGGGCCGAGGAGGGGCGGGGAA
GGTCAGCCAGGTTTGCCAGAACCACCGAGCCCCGCCTCCCGCCCCCCAGGGCTTCTGCAGGCTTCAGCCATCCACTTCACCATCCACTCG
GATCTCTCCTGAACTCCCACGACGCTATCCCTTTTAGTTGAACTAACATAGGTGAACGTGTTCAAAGCCAAGCAAAATGCACACCCTTTT
TCTGTGGCAAATCGTCTCTGTACATGTGTGTACATATTAGAAAGGGAAGATGTTAAGATATGTGGCCTGTGGGTTACACAGGGTGCCTGC
AGCGGTAATATATTTTAGAAATAATATATCAAATAACTCAACTAACTCCAATTTTTAATCAATTATTAATTTTTTTTTCTTTTTAAAGAG
AAAGCAGGCTTTTCTAGACTTTAAAGAATAAAGTCTTTGGGAGGTCTCACGGTGTAGAGAGGAGCTTTGAGGCCACCCGCACAAAATTCA
CCCAGAGGGAAATCTCGTCGGAAGGACACTCACGGCAGTTCTGGATCACCTGTGTATGTCAACAGAAGGGATACCGTCTCCTTGAAGAGG
AAACTCTGTCACTCCTCATGCCTGTCTAGCTCATACACCCATTTCTCTTTGCTTCACAGGTTTTAAACTGGTTTTTTGCATACTGCTATA
TAATTCTCTGTCTCTCTCTGTTTATCTCTCCCCTCCCTCCCCTCCCCTTCTTCTCCATCTCCATTCTTTTGAATTTCCTCATCCCTCCAT
CTCAATCCCGTATCTACGCACCCCCCCCCCCCCAGGCAAAGCAGTGCTCTGAGTATCACATCACACAAAAGGAACAAAAGCGAAACACAC
AAACCAGCCTCAACTTACACTTGGTTACTCAAAAGAACAAGAGTCAATGGTACTTGTCCTAGCGTTTTGGAAGAGGAAAACAGGAACCCA
CCAAACCAACCAATCAACCAAACAAAGAAAAAATTCCACAATGAAAGAATGTATTTTGTCTTTTTGCATTTTGGTGTATAAGCCATCAAT
ATTCAGCAAAATGATTCCTTTCTTTAAAAAAAAAAAATGTGGAGGAAAGTAGAAATTTACCAAGGTTGTTGGCCCAGGGCGTTAAATTCA
CAGATTTTTTTAACGAGAAAAACACACAGAAGAAGCTACCTCAGGTGTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTT
TGTAAAGCTGATAGTTGGAGCATTTTTTTATTTTTTTAATAAAAATGAGTTGGAAAAAAAATAAGATATCAACTGCCAGCCTGGAGAAGG
TGACAGTCCAAGTGTGCAACAGCTGTTCTGAATTGTCTTCCGCTAGCCAAGAACCTATATGGCCTTCTTTTGGACAAACCTTGAAAATGT


Top

FusionGenePPI for PLEKHM2_IGF2BP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLEKHM2CBR1, POLR2F, OFD1IGF2BP2PUF60, HNRNPA1, MEPCE, CDK9, MYC, ICT1, ELAVL1, ARRB1, SIRT7, CUL3, CAND1, HNRNPD, RAB5A, PPAP2A, PA2G4, FN1, ITGA4, CBX6, CBX8, TARDBP, SAV1, WWOX, EIF2AK2, STAU1, CCDC8, IGF2BP1, OFD1, CCP110, CNTRL, FBF1, DCTN1, MCM2, ZNF746, CDC14A, ELAVL2, RBM3, CYLD, TRIM25, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+6201_3102171020KIF5B
HgenePLEKHM2chr1:16046415chr3:185410550ENST00000375799+620762_8852171020sifA


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLEKHM2_IGF2BP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLEKHM2_IGF2BP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneIGF2BP2C0036341Schizophrenia1PSYGENET
TgeneIGF2BP2C0221765Chronic schizophrenia1PSYGENET