FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27661

FusionGeneSummary for PLEKHJ1_TCF3

check button Fusion gene summary
Fusion gene informationFusion gene name: PLEKHJ1_TCF3
Fusion gene ID: 27661
HgeneTgene
Gene symbol

PLEKHJ1

TCF3

Gene ID

55111

83439

Gene namepleckstrin homology domain containing J1transcription factor 7 like 1
SynonymsGNRPXTCF-3|TCF3
Cytomap

19p13.3

2p11.2

Type of geneprotein-codingprotein-coding
Descriptionpleckstrin homology domain-containing family J member 1PH domain-containing family J member 1guanine nucleotide releasing protein xtranscription factor 7-like 1HMG box transcription factor 3transcription factor 7-like 1 (T-cell specific, HMG-box)
Modification date2018052320180523
UniProtAcc

Q9NW61

P15923

Ensembl transtripts involved in fusion geneENST00000587394, ENST00000587962, 
ENST00000586608, ENST00000589097, 
ENST00000591099, ENST00000326631, 
ENST00000589791, 
ENST00000344749, 
ENST00000262965, ENST00000453954, 
ENST00000395423, ENST00000588136, 
Fusion gene scores* DoF score5 X 4 X 3=607 X 9 X 3=189
# samples 410
** MAII scorelog2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/189*10)=-0.918386234446348
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PLEKHJ1 [Title/Abstract] AND TCF3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-M7-A71Z-01APLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000587394ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587394ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587394ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587394ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587394ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587962ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587962ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587962ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587962ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000587962ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
intron-3CDSENST00000586608ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
intron-3CDSENST00000586608ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
intron-3CDSENST00000586608ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
intron-3CDSENST00000586608ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
intron-3CDSENST00000586608ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000589097ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000589097ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000589097ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000589097ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000589097ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000591099ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000591099ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000591099ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000591099ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000591099ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000326631ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000326631ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000326631ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000326631ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
In-frameENST00000326631ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
5UTR-3CDSENST00000589791ENST00000344749PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
5UTR-3CDSENST00000589791ENST00000262965PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
5UTR-3CDSENST00000589791ENST00000453954PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
5UTR-3CDSENST00000589791ENST00000395423PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-
5UTR-3CDSENST00000589791ENST00000588136PLEKHJ1chr19

2235922

-TCF3chr19

1622414

-

Top

FusionProtFeatures for PLEKHJ1_TCF3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLEKHJ1

Q9NW61

TCF3

P15923

Transcriptional regulator. Involved in the initiation ofneuronal differentiation. Heterodimers between TCF3 and tissue-specific basic helix-loop-helix (bHLH) proteins play major rolesin determining tissue-specific cell fate during embryogenesis,like muscle or early B-cell differentiation. Dimers bind DNA on E-box motifs: 5'-CANNTG-3'. Binds to the kappa-E2 site in the kappaimmunoglobulin gene enhancer. Binds to IEB1 and IEB2, which areshort DNA sequences in the insulin gene transcription controlregion. {ECO:0000250|UniProtKB:P15806}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTCF3chr19:2235922chr19:1622414ENST00000262965-719549_602183655DomainbHLH
TgeneTCF3chr19:2235922chr19:1622414ENST00000344749-719549_602183652DomainbHLH
TgeneTCF3chr19:2235922chr19:1622414ENST00000588136-619549_602183527DomainbHLH
TgeneTCF3chr19:2235922chr19:1622414ENST00000262965-719389_425183655RegionNote=Leucine-zipper
TgeneTCF3chr19:2235922chr19:1622414ENST00000344749-719389_425183652RegionNote=Leucine-zipper
TgeneTCF3chr19:2235922chr19:1622414ENST00000588136-619389_425183527RegionNote=Leucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLEKHJ1chr19:2235922chr19:1622414ENST00000326631-2615_10854150DomainPH
HgenePLEKHJ1chr19:2235922chr19:1622414ENST00000589097-3715_10854150DomainPH
TgeneTCF3chr19:2235922chr19:1622414ENST00000262965-719170_176183655MotifNuclear localization signal
TgeneTCF3chr19:2235922chr19:1622414ENST00000262965-71919_27183655MotifNote=9aaTAD
TgeneTCF3chr19:2235922chr19:1622414ENST00000344749-719170_176183652MotifNuclear localization signal
TgeneTCF3chr19:2235922chr19:1622414ENST00000344749-71919_27183652MotifNote=9aaTAD
TgeneTCF3chr19:2235922chr19:1622414ENST00000588136-619170_176183527MotifNuclear localization signal
TgeneTCF3chr19:2235922chr19:1622414ENST00000588136-61919_27183527MotifNote=9aaTAD


Top

FusionGeneSequence for PLEKHJ1_TCF3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_526aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLH

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_522aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSD

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_581aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQPTPRHSPPSPHQDAHVHRPHAHRTHTGRPSAGPTLFPQPHCLPLAPSR
RPPHSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_526aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLH

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_522aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSD

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_581aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQPTPRHSPPSPHQDAHVHRPHAHRTHTGRPSAGPTLFPQPHCLPLAPSR
RPPHSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_526aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLH

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_522aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSD

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_581aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQPTPRHSPPSPHQDAHVHRPHAHRTHTGRPSAGPTLFPQPHCLPLAPSR
RPPHSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_526aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLH

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_522aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSD

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_581aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQPTPRHSPPSPHQDAHVHRPHAHRTHTGRPSAGPTLFPQPHCLPLAPSR
RPPHSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_526aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLH

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_522aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSD

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_581aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTRCQPTPRHSPPSPHQDAHVHRPHAHRTHTGRPSAGPTLFPQPHCLPLAPSR
RPPHSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPK

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_523aa
MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEVYPPSSGEDYGRDATAYPSAKTPSSTTPAPFYVADG
SLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTP
PVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDE
AIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAG
ATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_1578nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAG
CGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCAC
CTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGG
AACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCT

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_1566nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCC
AATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGAC
AAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_1743nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGG
CCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGG
CGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAAT
AACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAG
CCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAA
GCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTG

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_1578nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAG
CGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCAC
CTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGG
AACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCT

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_1566nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCC
AATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGAC
AAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_1743nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGG
CCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGG
CGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAAT
AACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAG
CCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAA
GCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTG

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_1578nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAG
CGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCAC
CTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGG
AACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCT

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_1566nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCC
AATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGAC
AAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_1743nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGG
CCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGG
CGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAAT
AACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAG
CCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAA
GCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTG

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_1578nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAG
CGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCAC
CTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGG
AACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCT

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_1566nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCC
AATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGAC
AAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_1743nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGG
CCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGG
CGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAAT
AACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAG
CCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAA
GCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTG

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_1578nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAG
CGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCAC
CTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGG
AACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCT

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_1566nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCC
AATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGAC
AAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_1743nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGG
CCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGG
CGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAAT
AACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAG
CCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAA
GCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTG

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1569nt
ATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGC
AGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCA
GGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGC
AGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTC
CCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCAT
GGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCG
CCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATC
TACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGG
CCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAG
GCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTC
ACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATG
CACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGT
GCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAG
GAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATG
GCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCG
GACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAAT
CCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_4006nt
CGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTG
GGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAG
GCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCC
GCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGT
GGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCAC
GAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTAC
GGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCC
CTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAG
GGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGT
AAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGC
CACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGC
CTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCC
TACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCT
GACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGAC
CTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGC
ATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAG
CAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAG
ATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCAC
CCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCA
TCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACC
ACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCC
CTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGA
AAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTTCTAAAGCCA
CCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAAT
TAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATAAAAGTCCCG
TGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCG
TGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTTTGTTTTTTT
GATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCC
TCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTGCCAAGCAGC
TGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGG
CATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCCTTCACTCCT
TTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCAC
CATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGG
GCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGA
AGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCT
CTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAG
TCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCT
TCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCC
CCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCC
CCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGG
CTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCC
CTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGG
AGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAAAAATTTTTT
TAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGT

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_4015nt
CGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTG
GGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAG
GCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCC
GCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGT
GGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCAC
GAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTAC
GGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCC
CTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAG
GGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGT
AAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGC
CACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGC
CTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCC
TACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCT
GACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAG
CAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAG
CTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAAC
TTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGA
GACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGG
ACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTG
TTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCC
TGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGC
ATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGT
CAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTT
CTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTA
GATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATA
AAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAA
AAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTT
TGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCT
GCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTG
CCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCT
GAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCC
TTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACC
CCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAG
CATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGA
GCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCA
CCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAA
AACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGC
TGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGG
GCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGA
GCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGG
GCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTG
CTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCC
AGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAA
AAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCA

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_2544nt
CGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTG
GGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAG
GCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCC
GCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGT
GGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCAC
GAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTAC
GGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCC
CTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAG
GGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGT
AAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGC
CACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGC
CTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCC
TACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCT
GACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTG
AGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATG
TGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAG
GTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATG
GTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGGACCCAGGCTCATGCTCTGAACTCTG
GCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTA
GACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGG
TCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAAC
CAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAG
GGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAA
CTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCC
TTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCA
GGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTC
AATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCT
GGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGC

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_2225nt
CGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTG
GGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAG
GCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCC
GCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGT
GGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCAC
GAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTAC
GGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCC
CTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAG
GGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGT
AAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGC
CACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGC
CTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCC
TACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCT
GACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCC
CATCAGGACGCACATGTGCACAGGCCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCAC
TGTCTCCCTCTGGCCCCCTCCCGGCGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGG
GAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGC
CAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTG
CGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTG
CTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTT
TCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGC
CAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCAC
TGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTG
CCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAA

>In-frame_PLEKHJ1_ENST00000587394_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1717nt
CGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTG
GGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAG
GCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCC
GCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGT
GGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCAC
GAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTAC
GGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCC
CTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAG
GGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGT
AAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGC
CACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGC
CTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCC
TACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCT
GACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGAC
CTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGC
ATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAG
CAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAG
ATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGTAAACAAAACCTGAAAGCAAGCAA
CAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGG

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_4060nt
ATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAAC
GAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAG
CGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTAC
GGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCC
TCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGC
GGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTG
AACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGG
GCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGAT
CACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGA
GCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTG
CTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATG
TCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCG
GCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCC
GCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCC
CCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCG
CGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAG
ACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCC
TGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAA
GCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCC
ACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGAT
GGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCA
GCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTT
CCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGA
AACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAA
GGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTA
AGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGA
GCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCG
GAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAA
GTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGG
GAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCC
CAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGAC
CACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTG
GCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTA
GACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGG
TCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAAC
CAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAG
GGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAA
CTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCC
TTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCA
GGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTC
AATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCT
GGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGC
CTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATG
GGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGG
CTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGTCCTGTATATAACAGCACTGTAGCAATAAACGTGACA

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_4069nt
ATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAAC
GAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAG
CGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTAC
GGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCC
TCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGC
GGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTG
AACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGG
GCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGAT
CACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGA
GCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTG
CTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATG
TCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCG
GCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCC
GCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCC
CCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCC
AATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAG
AAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCC
AAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGC
CTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCC
AGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTT
CGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCC
CGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTT
TTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGG
AGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATAT
TTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTG
GTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTC
CTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCC
CCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTC
ATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTG
GGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAA
CGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGG
CATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTC
TGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCAT
CGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCC
TCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTG
CTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTT
TGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTT
CCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGC
ATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCG
TTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAA
GGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCC
CTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGG
CCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACC
ACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAA
CACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGTCCTGTATATAACAGCACTGTAGCAATA

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_2598nt
ATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAAC
GAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAG
CGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTAC
GGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCC
TCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGC
GGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTG
AACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGG
GCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGAT
CACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGA
GCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTG
CTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATG
TCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCG
GCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCC
GCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCC
CCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGG
GAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACC
AAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGT
TTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCC
CACAACCCCGCCGGGCACATGTGAAAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACA
CCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAAT
GCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTG
CTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCAT
GTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCT
TGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGC
CTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCT
GCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACT
GGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGG
AGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCT

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_2279nt
ATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAAC
GAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAG
CGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTAC
GGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCC
TCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGC
GGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTG
AACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGG
GCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGAT
CACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGA
GCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTG
CTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATG
TCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCG
GCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCC
GCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCC
CCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGGCCACACGCACAC
CGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGGCGCCCTCCCCAT
AGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAG
CGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAA
CTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTG
AAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCAC
AACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGA
GACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGC
GGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACC
GTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTA
AACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATA

>In-frame_PLEKHJ1_ENST00000587962_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1771nt
ATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAAC
GAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAG
CGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTAC
GGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCC
TCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGC
GGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTG
AACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGG
GCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGAT
CACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGA
GCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTG
CTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATG
TCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCG
GCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCC
GCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCC
CCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCG
CGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAG
ACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCC
TGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAA
GCCCACAACCCCGCCGGGCACATGTGAAAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCC

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_5096nt
AACTAACAGGTATAGATGAGCATACAGAAGCGTTCTCGGCTACAAGGAAGGCGGCCGAAACCATTTCAGCCGCGATCCCGATTCGACCCC
AACGAATCTTGGTTGTTTCTTTTTTATTTTGTCAAACAGGGTCTTGCTCTGTTGTCCAGGCTGGAGTGCAACGGCACAATCACAACTCAC
TGCAGCCTCGACCTCCTGGACTCAAGCGATCTTCCCGCTTCAGCCTCCAGAGTAGCTGGGACTACAGGCGCGCGTCACCAACCACGCCCG
GCTAATTTTTTTTTTTTTTTTTTTTGCAGTGATGGGGTCTCGCTATGTTGCCCAGGCTGGAGTGCAGTGGTGGGATCATGGCTCACTGCA
GCCTCGACATTCCGAGCTCAAGCGATCCTCTCGAGTAGCTGGGCCTACAGGGAACCCCCGGTCCGCGTCGGCCGCCGCCCTCAACCGCCT
CTACTCCTCACCAGAGCCCAAGGCCGCGTTATCTCCTCCTCGTTTCGCCACCTCCACGACTTCGTTTGGCGAACGGCGGGCAAAGAAAGC
ACTTCCGGGGCAAATGAGACGGGCCCTCTGGTGTGCGCATGCCTGGCCCGCCCAGCGGCGTGAGTCAGAGGGTCCCGAGGCGCGAAGGAA
AAGGCTGGAGGGGGAGAGGCTGAAAGCGCGGCCTGGAAGGCAAACTGCGCGTGCGCACAACGCTCTCAACGAACCCTCGGTCCGCTGCGG
CCGCACGGGGCCAACTTTCGCGAGGGAGCGGCTGACACTCTCCGGGCGACGTTATCGCTCCCTCCGCCTGCGCCTGGCCGCTCTAGAAAG
GGGTGCCAGCCATCGCTGGGGTGCCTTGATTCTGTTCCACCTTGGTCCGGTTTATTTCAGTTTAATGGTTATGTAACAACGGTCCGTCTC
TCCTACCAACCGGTACCCCGCCCACGCCAGCAGCCACGGGTCGCCAGCGCCACGCAGCGGAGGCGGGCGGCATGGCTGGCCCAAGGTGCG
CAGGCGCACTAGCCCTGGGGGTGCTTCCGTGTCTGCGCCCTGAGACATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGA
GGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGC
GGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCG
GACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAG
CACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCC
CATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCT
GCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGG
AGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTC
CGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGG
CTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGG
CCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCT
GCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCC
CGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCC
TCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACAC
GTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGA
GGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGA
GCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGG
GCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGG
AGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGG
GACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCT
GTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCC
CTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTG
CATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTG
TCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCT
TCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGT
AGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTAT
AAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAA
AAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTT
TTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCC
TGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCT
GCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTC
TGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTC
CTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCAC
CCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGA
GCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTG
AGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGC
ACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTA
AAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAG
CTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCG
GGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGG
AGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGG
GGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTT
GCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACC
CAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAA
AAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTC

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_5105nt
AACTAACAGGTATAGATGAGCATACAGAAGCGTTCTCGGCTACAAGGAAGGCGGCCGAAACCATTTCAGCCGCGATCCCGATTCGACCCC
AACGAATCTTGGTTGTTTCTTTTTTATTTTGTCAAACAGGGTCTTGCTCTGTTGTCCAGGCTGGAGTGCAACGGCACAATCACAACTCAC
TGCAGCCTCGACCTCCTGGACTCAAGCGATCTTCCCGCTTCAGCCTCCAGAGTAGCTGGGACTACAGGCGCGCGTCACCAACCACGCCCG
GCTAATTTTTTTTTTTTTTTTTTTTGCAGTGATGGGGTCTCGCTATGTTGCCCAGGCTGGAGTGCAGTGGTGGGATCATGGCTCACTGCA
GCCTCGACATTCCGAGCTCAAGCGATCCTCTCGAGTAGCTGGGCCTACAGGGAACCCCCGGTCCGCGTCGGCCGCCGCCCTCAACCGCCT
CTACTCCTCACCAGAGCCCAAGGCCGCGTTATCTCCTCCTCGTTTCGCCACCTCCACGACTTCGTTTGGCGAACGGCGGGCAAAGAAAGC
ACTTCCGGGGCAAATGAGACGGGCCCTCTGGTGTGCGCATGCCTGGCCCGCCCAGCGGCGTGAGTCAGAGGGTCCCGAGGCGCGAAGGAA
AAGGCTGGAGGGGGAGAGGCTGAAAGCGCGGCCTGGAAGGCAAACTGCGCGTGCGCACAACGCTCTCAACGAACCCTCGGTCCGCTGCGG
CCGCACGGGGCCAACTTTCGCGAGGGAGCGGCTGACACTCTCCGGGCGACGTTATCGCTCCCTCCGCCTGCGCCTGGCCGCTCTAGAAAG
GGGTGCCAGCCATCGCTGGGGTGCCTTGATTCTGTTCCACCTTGGTCCGGTTTATTTCAGTTTAATGGTTATGTAACAACGGTCCGTCTC
TCCTACCAACCGGTACCCCGCCCACGCCAGCAGCCACGGGTCGCCAGCGCCACGCAGCGGAGGCGGGCGGCATGGCTGGCCCAAGGTGCG
CAGGCGCACTAGCCCTGGGGGTGCTTCCGTGTCTGCGCCCTGAGACATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGA
GGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGC
GGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCG
GACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAG
CACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCC
CATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCT
GCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGG
AGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTC
CGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGG
CTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGG
CCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCT
GCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCC
CGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCC
TCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACAC
GTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCT
CCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGC
CTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGT
CATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGG
TGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATG
CCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCT
CACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTC
CCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATC
CTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACA
TACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTG
GCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTT
TCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATT
TTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAAACG
TTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCG
GCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTG
GGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCA
GGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGC
ACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGA
CACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGAC
ACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAA
TGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGT
GCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCA
TGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTC
TTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGG
CCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGC
TGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGAC
TGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCG
GAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCC
TCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACG
AGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATG
GTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCA

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_3634nt
AACTAACAGGTATAGATGAGCATACAGAAGCGTTCTCGGCTACAAGGAAGGCGGCCGAAACCATTTCAGCCGCGATCCCGATTCGACCCC
AACGAATCTTGGTTGTTTCTTTTTTATTTTGTCAAACAGGGTCTTGCTCTGTTGTCCAGGCTGGAGTGCAACGGCACAATCACAACTCAC
TGCAGCCTCGACCTCCTGGACTCAAGCGATCTTCCCGCTTCAGCCTCCAGAGTAGCTGGGACTACAGGCGCGCGTCACCAACCACGCCCG
GCTAATTTTTTTTTTTTTTTTTTTTGCAGTGATGGGGTCTCGCTATGTTGCCCAGGCTGGAGTGCAGTGGTGGGATCATGGCTCACTGCA
GCCTCGACATTCCGAGCTCAAGCGATCCTCTCGAGTAGCTGGGCCTACAGGGAACCCCCGGTCCGCGTCGGCCGCCGCCCTCAACCGCCT
CTACTCCTCACCAGAGCCCAAGGCCGCGTTATCTCCTCCTCGTTTCGCCACCTCCACGACTTCGTTTGGCGAACGGCGGGCAAAGAAAGC
ACTTCCGGGGCAAATGAGACGGGCCCTCTGGTGTGCGCATGCCTGGCCCGCCCAGCGGCGTGAGTCAGAGGGTCCCGAGGCGCGAAGGAA
AAGGCTGGAGGGGGAGAGGCTGAAAGCGCGGCCTGGAAGGCAAACTGCGCGTGCGCACAACGCTCTCAACGAACCCTCGGTCCGCTGCGG
CCGCACGGGGCCAACTTTCGCGAGGGAGCGGCTGACACTCTCCGGGCGACGTTATCGCTCCCTCCGCCTGCGCCTGGCCGCTCTAGAAAG
GGGTGCCAGCCATCGCTGGGGTGCCTTGATTCTGTTCCACCTTGGTCCGGTTTATTTCAGTTTAATGGTTATGTAACAACGGTCCGTCTC
TCCTACCAACCGGTACCCCGCCCACGCCAGCAGCCACGGGTCGCCAGCGCCACGCAGCGGAGGCGGGCGGCATGGCTGGCCCAAGGTGCG
CAGGCGCACTAGCCCTGGGGGTGCTTCCGTGTCTGCGCCCTGAGACATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGA
GGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGC
GGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCG
GACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAG
CACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCC
CATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCT
GCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGG
AGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTC
CGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGG
CTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGG
CCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCT
GCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCC
CGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCC
TCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACAC
GTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGA
GAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCT
GGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCT
GGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGA
CCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGGACCCAGGCTCATGCT
CTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCA
TCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCC
CTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCT
GCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTT
TTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGT
TCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTG
CATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACC
GTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCA
AGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCC
CCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTG

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_3315nt
AACTAACAGGTATAGATGAGCATACAGAAGCGTTCTCGGCTACAAGGAAGGCGGCCGAAACCATTTCAGCCGCGATCCCGATTCGACCCC
AACGAATCTTGGTTGTTTCTTTTTTATTTTGTCAAACAGGGTCTTGCTCTGTTGTCCAGGCTGGAGTGCAACGGCACAATCACAACTCAC
TGCAGCCTCGACCTCCTGGACTCAAGCGATCTTCCCGCTTCAGCCTCCAGAGTAGCTGGGACTACAGGCGCGCGTCACCAACCACGCCCG
GCTAATTTTTTTTTTTTTTTTTTTTGCAGTGATGGGGTCTCGCTATGTTGCCCAGGCTGGAGTGCAGTGGTGGGATCATGGCTCACTGCA
GCCTCGACATTCCGAGCTCAAGCGATCCTCTCGAGTAGCTGGGCCTACAGGGAACCCCCGGTCCGCGTCGGCCGCCGCCCTCAACCGCCT
CTACTCCTCACCAGAGCCCAAGGCCGCGTTATCTCCTCCTCGTTTCGCCACCTCCACGACTTCGTTTGGCGAACGGCGGGCAAAGAAAGC
ACTTCCGGGGCAAATGAGACGGGCCCTCTGGTGTGCGCATGCCTGGCCCGCCCAGCGGCGTGAGTCAGAGGGTCCCGAGGCGCGAAGGAA
AAGGCTGGAGGGGGAGAGGCTGAAAGCGCGGCCTGGAAGGCAAACTGCGCGTGCGCACAACGCTCTCAACGAACCCTCGGTCCGCTGCGG
CCGCACGGGGCCAACTTTCGCGAGGGAGCGGCTGACACTCTCCGGGCGACGTTATCGCTCCCTCCGCCTGCGCCTGGCCGCTCTAGAAAG
GGGTGCCAGCCATCGCTGGGGTGCCTTGATTCTGTTCCACCTTGGTCCGGTTTATTTCAGTTTAATGGTTATGTAACAACGGTCCGTCTC
TCCTACCAACCGGTACCCCGCCCACGCCAGCAGCCACGGGTCGCCAGCGCCACGCAGCGGAGGCGGGCGGCATGGCTGGCCCAAGGTGCG
CAGGCGCACTAGCCCTGGGGGTGCTTCCGTGTCTGCGCCCTGAGACATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGA
GGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGC
GGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCG
GACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAG
CACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCC
CATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCT
GCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGG
AGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTC
CGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGG
CTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGG
CCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCT
GCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCC
CGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCC
TCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACAC
GTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCC
ACCCTCACCCCATCAGGACGCACATGTGCACAGGCCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCC
CCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGGCGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAA
GGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGG
GCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGA
GCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCC
CCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAG
CCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTC
AGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCC
TACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTT
GGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAG

>In-frame_PLEKHJ1_ENST00000589097_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_2807nt
AACTAACAGGTATAGATGAGCATACAGAAGCGTTCTCGGCTACAAGGAAGGCGGCCGAAACCATTTCAGCCGCGATCCCGATTCGACCCC
AACGAATCTTGGTTGTTTCTTTTTTATTTTGTCAAACAGGGTCTTGCTCTGTTGTCCAGGCTGGAGTGCAACGGCACAATCACAACTCAC
TGCAGCCTCGACCTCCTGGACTCAAGCGATCTTCCCGCTTCAGCCTCCAGAGTAGCTGGGACTACAGGCGCGCGTCACCAACCACGCCCG
GCTAATTTTTTTTTTTTTTTTTTTTGCAGTGATGGGGTCTCGCTATGTTGCCCAGGCTGGAGTGCAGTGGTGGGATCATGGCTCACTGCA
GCCTCGACATTCCGAGCTCAAGCGATCCTCTCGAGTAGCTGGGCCTACAGGGAACCCCCGGTCCGCGTCGGCCGCCGCCCTCAACCGCCT
CTACTCCTCACCAGAGCCCAAGGCCGCGTTATCTCCTCCTCGTTTCGCCACCTCCACGACTTCGTTTGGCGAACGGCGGGCAAAGAAAGC
ACTTCCGGGGCAAATGAGACGGGCCCTCTGGTGTGCGCATGCCTGGCCCGCCCAGCGGCGTGAGTCAGAGGGTCCCGAGGCGCGAAGGAA
AAGGCTGGAGGGGGAGAGGCTGAAAGCGCGGCCTGGAAGGCAAACTGCGCGTGCGCACAACGCTCTCAACGAACCCTCGGTCCGCTGCGG
CCGCACGGGGCCAACTTTCGCGAGGGAGCGGCTGACACTCTCCGGGCGACGTTATCGCTCCCTCCGCCTGCGCCTGGCCGCTCTAGAAAG
GGGTGCCAGCCATCGCTGGGGTGCCTTGATTCTGTTCCACCTTGGTCCGGTTTATTTCAGTTTAATGGTTATGTAACAACGGTCCGTCTC
TCCTACCAACCGGTACCCCGCCCACGCCAGCAGCCACGGGTCGCCAGCGCCACGCAGCGGAGGCGGGCGGCATGGCTGGCCCAAGGTGCG
CAGGCGCACTAGCCCTGGGGGTGCTTCCGTGTCTGCGCCCTGAGACATTTTTGGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGA
GGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGC
GGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCG
GACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAG
CACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCC
CATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCT
GCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGG
AGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTC
CGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGG
CTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGG
CCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCT
GCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCC
CGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCC
TCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACAC
GTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGA
GGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGA
GCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGG
GCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGG
AGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGTAAACAAAACCTGA
AAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGG

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_4028nt
CGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCC
GGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCT
CTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAA
GACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGC
GGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCAC
GTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTC
CTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCAC
AGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTC
TACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGG
GGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGA
CATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGG
AGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGA
CCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGA
CGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGT
GCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGA
GGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCA
GGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTC
AGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGT
ATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACA
CCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAG
CTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGG
ATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAA
ACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGCTGTGGAAAC
CTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACAAGATTTTTT
TTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAA
ATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCAGATGATTAA
ACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAACGGGGACAG
GCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACC
TTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTC
CCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACC
TGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGGGGACCTCCT
GGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAG
GACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCC
CAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGAC
TGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTC
CCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACT
GTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGT
GGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCC
CGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCA
GACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAG
GCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCT
CCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAA
ACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAG
ATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAACGACCCTCTT

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_4037nt
CGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCC
GGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCT
CTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAA
GACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGC
GGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCAC
GTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTC
CTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCAC
AGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTC
TACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGG
GGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGA
CATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGG
AGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGA
CCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGA
CGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCCCAGACGAGGACGA
GGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGA
CATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCA
GGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGA
AAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACAT
GTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCC
ACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGG
GTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCT
GTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCA
AGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTCAAGGGGGATGC
TGTGGAAACCTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAATAAAAACATTAGTTACA
AGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTTTTTTGCATATGTTTTGT
AAGCAACAAATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTGCATTTCTTGATCAACCA
GATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCCACTGCACACAGACAGAA
CGGGGACAGGCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATGCGTGGGCGTTCCCTGAT
GAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGGACGTCAGCAAGGTGGCT
CTGACCCTCCCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCCCCCCTAAGCTGCTCTCC
CTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACCCTGGAGCCCGGTGCTGG
GGACCTCCTGGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAG
CCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCC
AGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAG
CCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCC
ATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGG
CTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCA
CCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGT
GTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTC
CCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGT
CCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAA
CTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGGAACTGTGCGTTCTGCAT
AGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGTGGGGGGTGTGATCTGAG
TGCCTCAAGATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGATGATTGGGACTTTAAAAC

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_2566nt
CGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCC
GGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCT
CTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAA
GACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGC
GGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCAC
GTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTC
CTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCAC
AGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTC
TACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGG
GGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGA
CATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGG
AGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGA
CCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGA
CGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGTACGGACGAGGTGCT
GTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGAGGC
CTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCAGGT
CATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGG
TGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGGACC
CAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTAC
ACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACAC
CTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGT
GCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCC
TTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGG
ATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCA
TGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCT
GAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCA
AGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTC
TCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCT

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_2247nt
CGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCC
GGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCT
CTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAA
GACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGC
GGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCAC
GTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTC
CTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCAC
AGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTC
TACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGG
GGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGA
CATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGG
AGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGA
CCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGA
CGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGGTGCCAACCCACCCC
TCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGGCCACACGCACACCGCACCCACACTGGGAGGCCGTCGGCGGGCCC
CACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGGCGCCCTCCCCATAGCCCAGACGAGGACGAGGACGACCTTCTCCC
CCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTT
TAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCAT
CCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGT
GGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCT
CCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCAC
ACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCT
GGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTG
AAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATAC

>In-frame_PLEKHJ1_ENST00000591099_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1739nt
CGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAGGAGCTGCAGGCTCTGTCCCGGCAGCC
GGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGGCTGGTGAAGCTGGTGGTGAATTTCCT
CTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGGGATGCCACCGCCTACCCGTCCGCCAA
GACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCCGAGCTCTGGAGTCCCCCGGGCCAGGC
GGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCGGTGGGCAGCAGTGGAAGCAGCAGCAC
GTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGTGGGCTCCCATCTGCATCCTCCTTCTC
CTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGACAGCCTCCTGGGCTCCCGAGGGACCAC
AGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCAAGCAATAACTTCTCGTCCAGCCCTTC
TACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCCGGTGCCTTATCGCCCAGCTACGACGG
GGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGCAGCCACGCCGTGGGCACAGCCGGCGA
CATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTGGGCGGGCGGCACGCAGGCCTGGTTGG
AGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTCCCCAGCCAGCCAGGCACCCTCCCTGA
CCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGCGAGATCAAGCGGGAGGAGAAGGAGGA
CGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGGGCCCGGACCAGCAGTACGGACGAGGT
GCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGGGTGCGCGTGCGGGATATTAACGA
GGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTGCTCATCCTGCAGCAGGCCGTGCA
GGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTC
AGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCCGCCGGGCACATGTGAAAGTA
AACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATA

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000344749_chr19_1622414_-_4054nt
GGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAG
GAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGG
CTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGG
GATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCC
GAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCG
GTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGT
GGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGAC
AGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCA
AGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCC
GGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGC
AGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTG
GGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTC
CCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGC
GAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGG
GCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAG
CGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAG
CTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTG
AAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCAC
AACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGA
GACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGC
GGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACC
GTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTA
AACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATA
TCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTTTAAGGAAAA
TAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTTTTAAGCTTT
TTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGACTGAGCATTG
CATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCCCCGGAAGCC
ACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGGAAAGTGATG
CGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTGGGGGAAGGG
ACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCTCCCCAGGCC
CCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGGGACCACACC
CTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAG
AGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGG
ATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAG
GGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAG
GGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAAC
CAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGG
CAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGG
ACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGAT
CCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCC
TGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGT
TTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCATAGCCTCTGG
AACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATTATGGGGGGT
GGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGCTGGCTGGAT
GATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGTCCTGTATATAACAGCACTGTAGCAATAAACGTGACATTTTAT

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000262965_chr19_1622414_-_4063nt
GGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAG
GAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGG
CTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGG
GATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCC
GAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCG
GTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGT
GGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGAC
AGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCA
AGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCC
GGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGC
AGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTG
GGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTC
CCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGC
GAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGG
GCCCGGACCAGCCCAGACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAAC
GCCCGGGAGCGGCTGCGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCC
CAGACCAAACTGCTCATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCA
GCCTGTTTGAAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGC
GAAGCCCACAACCCCGCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACG
GCCACTCGAGACCCCGGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGT
GATGGGGGCGGCCAAGGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATC
TCAGCCACCGTGTCACTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTT
TTTCCAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAAT
GGAAACATATCACTCAAGGGGGATGCTGTGGAAACCTGGCTTATTCTTCTAAAGCCACCAGCAAATTGTGCCTAAGCGAAATATTTTTTT
TAAGGAAAATAAAAACATTAGTTACAAGATTTTTTTTTTCTTAATGTAGATGAAAATTAGCAAGGATGCTGCCTTTGGTCTCTGGTTTTT
TTAAGCTTTTTTTGCATATGTTTTGTAAGCAACAAATTTTTTTGTATAAAAGTCCCGTGTCTCTCGCTATTTCTGCTGCTGTTCCTAGAC
TGAGCATTGCATTTCTTGATCAACCAGATGATTAAACGTTGTATTAAAAAGACCCCGTGTAAACCTGAGCCCCCCCGTCCCCCCCCCCCC
CCGGAAGCCACTGCACACAGACAGAACGGGGACAGGCGGCGGGTCTTTTGTTTTTTTGATGTTGGGGGTTCTCTTGGTTTTGTCATGTGG
AAAGTGATGCGTGGGCGTTCCCTGATGAAGGCACCTTGGGGCTTCCCTGCCGCATCCTCTCCCCTCAGGAAGGGGACTGACCTGGGCTTG
GGGGAAGGGACGTCAGCAAGGTGGCTCTGACCCTCCCAGGTGACTCTGCCAAGCAGCTGTGGCCCCCAGGGCTACCCTACACAACGCCCT
CCCCAGGCCCCCCTAAGCTGCTCTCCCTTGGAACCTGCACAGCTCTCTGAAATGGGGCATTTTGTTGGGACCAGTGACCCCTGGCATGGG
GACCACACCCTGGAGCCCGGTGCTGGGGACCTCCTGGACACCCTGTCCTTCACTCCTTTGCCCCAGGGACCCAGGCTCATGCTCTGAACT
CTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCCACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGAC
GTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGGGAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTG
TGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTCTGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAG
AACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCAGCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCAT
GAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTTTAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACAC
GAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCTAGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAG
GCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGTCGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCC
CCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTGGGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAG
CTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGAGGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGC
CCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTTTTGCTCCTGGCCCTGCCCCTAGGTCTGGGTGGGCAGTGGCCCCAT
AGCCTCTGGAACTGTGCGTTCTGCATAGAATTCAAACGAGATTCACCCAGCGCGAGGAGGAAGAAACAGCAGTTCCTGGGAACCACAATT
ATGGGGGGTGGGGGGTGTGATCTGAGTGCCTCAAGATGGTTTTCAAAAAAATTTTTTTAAAGAAAATAATTGTATACGTGTCAACACAGC
TGGCTGGATGATTGGGACTTTAAAACGACCCTCTTTCAGGTGGATTCAGAGACCTGTCCTGTATATAACAGCACTGTAGCAATAAACGTG

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000453954_chr19_1622414_-_2592nt
GGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAG
GAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGG
CTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGG
GATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCC
GAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCG
GTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGT
GGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGAC
AGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCA
AGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCC
GGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGC
AGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTG
GGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTC
CCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGC
GAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGG
GCCCGGACCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAGCGG
GTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAGCTG
CTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAA
CGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAAC
CCCGCCGGGCACATGTGAAAGGGACCCAGGCTCATGCTCTGAACTCTGGCTGAGAGGATGCTGCTCAGGAGCCAGCACAGGACACCCCCC
ACCCCACCCCACCATGTCCCCATTACACCAGAGGGCCATCGTGACGTAGACAGGATGCCAGGGGCCTGGCCAGCCTCCCCCAATGCTGGG
GAGCATCCCTGGGCCTGGGGCCACACCTGCTGCCCTCCCTCTGTGTGGTCCAAGGGCAAGAGTGGCTGGAGCCGGGGGACTGTGCTGGTC
TGAGCCCCACGAAGGCCTTGGGCTGTGCGTCCGACCCTGCTGCAGAACCAGCAGGGTGTCCCCTCGGGCCCATCTGTGTCCCATGTCCCA
GCACCCAGGCCTCTCTCCAGGTCTCCTTTTCTGGTCTTTTGCCATGAGGGTAACCAGCTCTTCCCAGCTGGCTGGGGACTGTCTTGGGTT
TAAAACTGCAAGTCTCCTACCCTGGGATCCCATCCAGTTCCACACGAACTAGGGCAGTGGTCACTGTGGCACCCAGGTGTGGGCCTGGCT
AGCTGGGGGCCTTCATGTGCCCTTCATGCCCCTCCCTGCATTGAGGCCTTGTGGACCCCTGGGCTGGCTGTGTTCATCCCCGCTGCAGGT
CGGGCGTCTCCCCCCGTGCCACTCCTGAGACTCCCACCGTTACCCCCAGGAGATCCTGGACTGCCTGACTCCCCTCCCCAGACTGGCTTG
GGAGCCTGGGCCCCATGGTAGATGCAAGGGAAACCTCAAGGCCAGCTCAATGCCTGGTATCTGCCCCCAGTCCAGGCCAGGCGGAGGGGA
GGGGCTGTCCGGCTGCCTCTCCCTTCTCGGTGGCTTCCCCTACGCCCTGGGAGTTTGATCTCTTAAGGGAACTTGCCTCTCCCTCTTGTT

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000395423_chr19_1622414_-_2273nt
GGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAG
GAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGG
CTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGG
GATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCC
GAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCG
GTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGT
GGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGAC
AGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCA
AGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCC
GGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGC
AGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTG
GGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTC
CCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGC
GAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGG
GCCCGGACCAGGTGCCAACCCACCCCTCGGCACTCCCCACCCTCACCCCATCAGGACGCACATGTGCACAGGCCACACGCACACCGCACC
CACACTGGGAGGCCGTCGGCGGGCCCCACGCTCTTCCCCCAACCTCACTGTCTCCCTCTGGCCCCCTCCCGGCGCCCTCCCCATAGCCCA
GACGAGGACGAGGACGACCTTCTCCCCCCAGAGCAGAAGGCCGAGCGGGAGAAGGAGCGCCGGGTGGCCAATAACGCCCGGGAGCGGCTG
CGGGTCCGTGACATCAACGAGGCCTTTAAGGAGCTGGGGCGCATGTGCCAACTGCACCTCAACAGCGAGAAGCCCCAGACCAAACTGCTC
ATCCTGCACCAGGCTGTCTCGGTCATCCTGAACTTGGAGCAGCAAGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTGAAACGG
CGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCACAACCCC
GCCGGGCACATGTGAAAGGTATGCCTCCGTGGGACGAGCCACCCGCTTTCAGCCCTGTGCTCTGGCCCCAGAACGGCCACTCGAGACCCC
GGGCTTCATCCACATCCACACCTCACACACCTGTTGTCAGCATCGAGCCAACACCAACCTGACAAGGTTCGGAGTGATGGGGGCGGCCAA
GGTGACACTGGGTCCAGGAGCTCCCTGGGGCCCTGGCCTACCACTCACTGGCCTCGCTCCCCCTGTCCCCGAATCTCAGCCACCGTGTCA
CTCTGTGACCTGTCCCATGGATCCTGAAACTGCATCTTGGCCCTGTTGCCTGGGCTGACAGGAGCATTTTTTTTTTTTCCAGTAAACAAA
ACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACTATAAAAAGCGGAGAAATGGAAACATATCACTC

>In-frame_PLEKHJ1_ENST00000326631_chr19_2235922_-_TCF3_ENST00000588136_chr19_1622414_-_1765nt
GGCGCCGGCCCCAGCCTGAGCGGGGACGGCGGCCGGGAGGGCGCGGCCCGGGTTCCCGTTCCCCGCGGAGCCATGCGGTACAACGAGAAG
GAGCTGCAGGCTCTGTCCCGGCAGCCGGCCGAGATGGCGGCCGAGCTGGGCATGAGGGGCCCCAAGAAGGGCAGCGTGCTGAAGCGGCGG
CTGGTGAAGCTGGTGGTGAATTTCCTCTTCTACTTTCGGACAGACGAGGCCGAGGTGTACCCACCCAGCTCAGGTGAGGACTACGGCAGG
GATGCCACCGCCTACCCGTCCGCCAAGACCCCCAGCAGCACCTATCCCGCCCCCTTCTACGTGGCAGATGGCAGCCTGCACCCCTCAGCC
GAGCTCTGGAGTCCCCCGGGCCAGGCGGGCTTCGGGCCCATGCTGGGTGGGGGCTCATCCCCGCTGCCCCTCCCGCCCGGTAGCGGCCCG
GTGGGCAGCAGTGGAAGCAGCAGCACGTTTGGTGGCCTGCACCAGCACGAGCGTATGGGCTACCAGCTGCATGGAGCAGAGGTGAACGGT
GGGCTCCCATCTGCATCCTCCTTCTCCTCAGCCCCCGGAGCCACGTACGGCGGCGTCTCCAGCCACACGCCGCCTGTCAGCGGGGCCGAC
AGCCTCCTGGGCTCCCGAGGGACCACAGCTGGCAGCTCCGGGGATGCCCTCGGCAAAGCACTGGCCTCGATCTACTCCCCGGATCACTCA
AGCAATAACTTCTCGTCCAGCCCTTCTACCCCCGTGGGCTCCCCCCAGGGCCTGGCAGGAACGTCACAGTGGCCTCGAGCAGGAGCCCCC
GGTGCCTTATCGCCCAGCTACGACGGGGGTCTCCACGGCCTGCAGAGTAAGATAGAAGACCACCTGGACGAGGCCATCCACGTGCTCCGC
AGCCACGCCGTGGGCACAGCCGGCGACATGCACACGCTGCTGCCTGGCCACGGGGCGCTGGCCTCAGGTTTCACCGGCCCCATGTCACTG
GGCGGGCGGCACGCAGGCCTGGTTGGAGGCAGCCACCCCGAGGACGGCCTCGCAGGCAGCACCAGCCTCATGCACAACCACGCGGCCCTC
CCCAGCCAGCCAGGCACCCTCCCTGACCTGTCTCGGCCTCCCGACTCCTACAGTGGGCTAGGGCGAGCAGGTGCCACGGCGGCCGCCAGC
GAGATCAAGCGGGAGGAGAAGGAGGACGAGGAGAACACGTCAGCGGCTGACCACTCGGAGGAGGAGAAGAAGGAGCTGAAGGCCCCCCGG
GCCCGGACCAGCAGTACGGACGAGGTGCTGTCCCTGGAGGAGAAAGACCTGAGGGACCGGGAGAGGCGCATGGCCAATAACGCGCGGGAG
CGGGTGCGCGTGCGGGATATTAACGAGGCCTTCCGGGAGCTGGGGCGCATGTGCCAGATGCACCTCAAGTCGGACAAAGCGCAGACCAAG
CTGCTCATCCTGCAGCAGGCCGTGCAGGTCATCCTGGGGCTGGAGCAGCAGGTGCGAGAGCGGAACCTGAATCCCAAAGCAGCCTGTTTG
AAACGGCGAGAAGAGGAAAAGGTGTCAGGTGTGGTTGGAGACCCCCAGATGGTGCTTTCAGCTCCCCACCCAGGCCTGAGCGAAGCCCAC
AACCCCGCCGGGCACATGTGAAAGTAAACAAAACCTGAAAGCAAGCAACAAAACATACACTTTGTCAGAGAAGAAAAAAATGCCTTAACT


Top

FusionGenePPI for PLEKHJ1_TCF3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLEKHJ1PINX1, KRT33B, IKBKG, FAM109A, DNMT3B, PPBP, APP, XPO1, FAM109B, OCRL, GPX7TCF3HAND2, ID3, SKP2, NHLH1, TCF3, EP300, CREBBP, KAT2B, CALM1, LMX1A, TAL1, LDB1, CBFA2T3, ELK3, MYOD1, ID1, ID2, MYF5, MYF6, MYOG, UBE2I, LYL1, MAPKAPK3, TWIST1, DAXX, MEN1, TCF4, RUNX1T1, RUNX1, VDR, HDAC2, DNMT1, TRIM33, INO80E, YY1, RB1, ASB2, SOX2, ELAVL1, ID4, KDM1A, PRMT5, MRPL37, RPL23A, UQCRC2, MRPL49, DDX17, SAFB, EIF5A, MYO1B, GSE1, SLC25A10, BHLHA15, PIP, ALDH18A1, SF3A3, DNAJC10, RPL36A, IMMT, RPS13, DDX20, TET2, PRPF8, RCOR1, TCF24, RPL14, PON2, SSBP1, RPL31, MRPL44, C14orf166, SPIN1, CCT2, MYL6B, CHCHD3, ATP2A3, LANCL2, SLC9A3R1, TIMM50, ERLIN2, MRPL39, ATOH8, SERPINH1, SETSIP, SON, FBL, SLC25A4, EEF1A2, LGALS7, C1QBP, CPD, MRPL23, NHLH2, RPL13, COX7A2, CSTA, PCBP1, NDUFB4, TFF3, FLG2, HNRNPR, ERAL1, RPN2, RBM39, RPL24, LBR, CASP14, STK38, CANX, TCF12, FOXH1, TLE1, KAT2A, TRRAP, SUPT3H, TADA2A, USF1, SCX, TCF21, RPL37, MAPKAPK2, RNF14, FAM115A, PTF1A, HAND1, NEUROD1, MESP2, BHLHE40, PARP1, PSMD4, NEDD9, XPO1, BCOR, KIF18A, ATOH1, FERD3L, NEUROG3, FKBP9, COLGALT2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLEKHJ1_TCF3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLEKHJ1_TCF3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTCF3C0006413Burkitt Lymphoma2CTD_human
TgeneTCF3C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human
TgeneTCF3C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human