FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27648

FusionGeneSummary for PLEKHH1_GPHN

check button Fusion gene summary
Fusion gene informationFusion gene name: PLEKHH1_GPHN
Fusion gene ID: 27648
HgeneTgene
Gene symbol

PLEKHH1

GPHN

Gene ID

57475

10243

Gene namepleckstrin homology, MyTH4 and FERM domain containing H1gephyrin
Synonyms-GEPH|GPH|GPHRYN|HKPX1|MOCODC
Cytomap

14q24.1

14q23.3-q24.1

Type of geneprotein-codingprotein-coding
Descriptionpleckstrin homology domain-containing family H member 1PH domain-containing family H member 1pleckstrin homology domain containing, family H (with MyTH4 domain) member 1gephyrin
Modification date2018051920180523
UniProtAcc

Q9ULM0

Q9NQX3

Ensembl transtripts involved in fusion geneENST00000329153, ENST00000417684, 
ENST00000559832, 
ENST00000315266, 
ENST00000478722, ENST00000459628, 
ENST00000543237, ENST00000305960, 
ENST00000544752, 
Fusion gene scores* DoF score7 X 7 X 3=1479 X 13 X 12=1404
# samples 820
** MAII scorelog2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1404*10)=-2.81147103052984
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PLEKHH1 [Title/Abstract] AND GPHN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGPHN

GO:0032324

molybdopterin cofactor biosynthetic process

26613940

TgeneGPHN

GO:0097112

gamma-aminobutyric acid receptor clustering

26613940


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-K4-A3WV-01APLEKHH1chr14

68028752

+GPHNchr14

67525366

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000329153ENST00000315266PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
In-frameENST00000329153ENST00000478722PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
Frame-shiftENST00000329153ENST00000459628PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
In-frameENST00000329153ENST00000543237PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
In-frameENST00000329153ENST00000305960PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
5CDS-3UTRENST00000329153ENST00000544752PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000417684ENST00000315266PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000417684ENST00000478722PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000417684ENST00000459628PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000417684ENST00000543237PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000417684ENST00000305960PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3UTRENST00000417684ENST00000544752PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000559832ENST00000315266PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000559832ENST00000478722PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000559832ENST00000459628PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000559832ENST00000543237PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3CDSENST00000559832ENST00000305960PLEKHH1chr14

68028752

+GPHNchr14

67525366

+
intron-3UTRENST00000559832ENST00000544752PLEKHH1chr14

68028752

+GPHNchr14

67525366

+

Top

FusionProtFeatures for PLEKHH1_GPHN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PLEKHH1

Q9ULM0

GPHN

Q9NQX3

Microtubule-associated protein involved in membraneprotein-cytoskeleton interactions. It is thought to anchor theinhibitory glycine receptor (GLYR) to subsynaptic microtubules.Catalyzes two steps in the biosynthesis of the molybdenumcofactor. In the first step, molybdopterin is adenylated.Subsequently, molybdate is inserted into adenylated molybdopterinand AMP is released. {ECO:0000269|PubMed:26613940}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+62928_1691681365Coiled coilOntology_term=ECO:0000255
TgeneGPHNchr14:68028752chr14:67525366ENST00000315266+822326_736302737RegionNote=MPT adenylyltransferase

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+629239_2421681365Compositional biasNote=Poly-Ser
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+629578_6721681365DomainPH 1
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+629687_7961681365DomainPH 2
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+629832_9861681365DomainMyTH4
HgenePLEKHH1chr14:68028752chr14:67525366ENST00000329153+629997_13331681365DomainFERM
TgeneGPHNchr14:68028752chr14:67525366ENST00000315266+82214_166302737RegionNote=MPT Mo-transferase
TgeneGPHNchr14:68028752chr14:67525366ENST00000478722+92314_166335770RegionNote=MPT Mo-transferase
TgeneGPHNchr14:68028752chr14:67525366ENST00000478722+923326_736335770RegionNote=MPT adenylyltransferase


Top

FusionGeneSequence for PLEKHH1_GPHN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000315266_chr14_67525366_+_603aa
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDSEGSLHRKYQ
ELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEGHSAVDITKVAR
RHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM
PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVE
VNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQ
VLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYH

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000478722_chr14_67525366_+_603aa
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDSEGSLHRKYQ
ELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEGHSAVDITKVAR
RHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM
PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVE
VNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQ
VLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYH

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000543237_chr14_67525366_+_603aa
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDSEGSLHRKYQ
ELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEGHSAVDITKVAR
RHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM
PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVE
VNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQ
VLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYH

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000305960_chr14_67525366_+_603aa
MAELKVEAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENAETQVGVMEEKVKLSNLKNVDSEGSLHRKYQ
ELLKAIKGKDELISQLEAQLEKQKQMRAEEAKTVQEKAAKIKEWVTLKLAKLEMENQHLKSHNQRLVEQVGSLQDALEGHSAVDITKVAR
RHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVYAKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVM
PGQVMRVTTGAPIPCGADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPSEIGLLATVGVTEVE
VNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQ
VLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEYH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000315266_chr14_67525366_+_1809nt
ATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAACGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTA
CAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTGGAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCT
GAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTGAAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAA
GAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTAGAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAA
GCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACACTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAA
AGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCGCTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGA
AGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTTATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATC
ATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATATGCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGAT
GGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATTGGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATG
CCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGTGCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGG
GAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAAGCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATT
AAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCAGAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAA
GTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTGCTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGAC
AGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCCACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTA
CTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACATCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAG
GTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTTATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATT
GATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCGGCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGG
AAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGGTTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCAT
CGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAGAGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGC
AGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTGGAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGA

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000478722_chr14_67525366_+_1809nt
ATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAACGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTA
CAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTGGAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCT
GAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTGAAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAA
GAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTAGAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAA
GCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACACTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAA
AGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCGCTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGA
AGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTTATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATC
ATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATATGCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGAT
GGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATTGGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATG
CCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGTGCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGG
GAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAAGCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATT
AAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCAGAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAA
GTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTGCTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGAC
AGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCCACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTA
CTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACATCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAG
GTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTTATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATT
GATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCGGCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGG
AAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGGTTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCAT
CGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAGAGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGC
AGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTGGAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGA

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000543237_chr14_67525366_+_1809nt
ATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAACGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTA
CAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTGGAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCT
GAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTGAAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAA
GAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTAGAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAA
GCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACACTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAA
AGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCGCTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGA
AGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTTATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATC
ATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATATGCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGAT
GGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATTGGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATG
CCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGTGCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGG
GAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAAGCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATT
AAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCAGAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAA
GTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTGCTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGAC
AGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCCACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTA
CTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACATCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAG
GTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTTATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATT
GATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCGGCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGG
AAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGGTTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCAT
CGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAGAGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGC
AGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTGGAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGA

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000305960_chr14_67525366_+_1809nt
ATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAACGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTA
CAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTGGAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCT
GAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTGAAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAA
GAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTAGAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAA
GCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACACTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAA
AGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCGCTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGA
AGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTTATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATC
ATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATATGCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGAT
GGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATTGGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATG
CCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGTGCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGG
GAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAAGCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATT
AAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCAGAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAA
GTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTGCTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGAC
AGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCCACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTA
CTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACATCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAG
GTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTTATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATT
GATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCGGCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGG
AAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGGTTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCAT
CGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAGAGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGC
AGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTGGAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000315266_chr14_67525366_+_2802nt
GGGACTCCGGCGAGAGCGACGCAAGGTCGGCTGCGGCGGCGGCCCGAGGGCGCCCGTGTGCCCAGTGCGCGGCGGGGACGGCCGCGAGCT
CGCTGGAGGGCTCCCCAGAATAATCCAGAAGTCGATTCCATCATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAA
CGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTACAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTG
GAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCTGAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTG
AAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAAGAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTA
GAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAAGCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACA
CTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAAAGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCG
CTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGAAGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTT
ATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATCATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATAT
GCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGATGGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATT
GGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATGCCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGT
GCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGGGAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAA
GCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATTAAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCA
GAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAAGTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTG
CTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGACAGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCC
ACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTACTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACA
TCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAGGTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTT
ATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATTGATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCG
GCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGGAAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGG
TTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCATCGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAG
AGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGCAGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTG
GAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGACGGCTATGATGGTCACCAGCAGGAGAAAGCTTTGATGCATGTCCACAT
ATCATTGACTGTATCCTGTAATATGCAACGGCACAGCTAGTTTTCCCGATTTGGATAAAAGTTGATCTGTATAGTCAACATCTTGAACTA
TATTTCAAATGAATTTAAATATCTTTTAAAGAAAAAAACACCTAAAAATAAATCTTAACAGAAAATTCTGTTCTGATTATATCAAGGCAA
ATTTTTCCTTTCTTGCAAATTGCTTTGTGTGTTCAATGCTAGGTCTGATAGCGATAGCTTTTAGTAGACAGCGGTAGGTGCCTGCAGAAC
TTGTGTTTTTCTCATCTTTAAAATACAACTACTTATGCTCTTAAATCAAGGCTGTCTGCTTATTTATACTAGCGTAGGCAACACTTGGAT
TTCCCTTCTTAGTATGCTTCATAACTGCTTTACAGAGAGCTTTTGCTTGTTCTTTCTCATGTATCTCGTGTTTATGTGCACAGTGCCAAA
AGAAGACTGACTGGGTGGAGGCTCTGCCTTGCCTCAAGAACCATCCCCTGCAGAGCATCCAGGGAGGTTTCTCGCCCCAATAGCCTCACG
GCACAGTACTCTTGGGCAGTAACTGGACACCTTTTATTTGAAGAAACAAACTGAAGAAAAAATGCTTCCTTAAGTGCTGACAGCCTTTTT
AACCAATACATTTAAAATTGTACAGAACAAAAAAATAAAATCAAAGACTGATCTTGTACAGATATTAGTGTTACCAGCATTCATGTGGAA
ATCAAGAGCAAAGACAAAATAATGTTAAACAATTCTGTACCATAACATTTTCTGTAATGATACTGAAACTTAATGAATAAAAAAATTCCT

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000478722_chr14_67525366_+_2807nt
GGGACTCCGGCGAGAGCGACGCAAGGTCGGCTGCGGCGGCGGCCCGAGGGCGCCCGTGTGCCCAGTGCGCGGCGGGGACGGCCGCGAGCT
CGCTGGAGGGCTCCCCAGAATAATCCAGAAGTCGATTCCATCATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAA
CGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTACAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTG
GAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCTGAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTG
AAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAAGAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTA
GAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAAGCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACA
CTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAAAGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCG
CTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGAAGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTT
ATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATCATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATAT
GCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGATGGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATT
GGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATGCCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGT
GCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGGGAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAA
GCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATTAAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCA
GAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAAGTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTG
CTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGACAGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCC
ACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTACTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACA
TCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAGGTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTT
ATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATTGATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCG
GCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGGAAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGG
TTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCATCGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAG
AGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGCAGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTG
GAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGACGGCTATGATGGTCACCAGCAGGAGAAAGCTTTGATGCATGTCCACAT
ATCATTGACTGTATCCTGTAATATGCAACGGCACAGCTAGTTTTCCCGATTTGGATAAAAGTTGATCTGTATAGTCAACATCTTGAACTA
TATTTCAAATGAATTTAAATATCTTTTAAAGAAAAAAACACCTAAAAATAAATCTTAACAGAAAATTCTGTTCTGATTATATCAAGGCAA
ATTTTTCCTTTCTTGCAAATTGCTTTGTGTGTTCAATGCTAGGTCTGATAGCGATAGCTTTTAGTAGACAGCGGTAGGTGCCTGCAGAAC
TTGTGTTTTTCTCATCTTTAAAATACAACTACTTATGCTCTTAAATCAAGGCTGTCTGCTTATTTATACTAGCGTAGGCAACACTTGGAT
TTCCCTTCTTAGTATGCTTCATAACTGCTTTACAGAGAGCTTTTGCTTGTTCTTTCTCATGTATCTCGTGTTTATGTGCACAGTGCCAAA
AGAAGACTGACTGGGTGGAGGCTCTGCCTTGCCTCAAGAACCATCCCCTGCAGAGCATCCAGGGAGGTTTCTCGCCCCAATAGCCTCACG
GCACAGTACTCTTGGGCAGTAACTGGACACCTTTTATTTGAAGAAACAAACTGAAGAAAAAATGCTTCCTTAAGTGCTGACAGCCTTTTT
AACCAATACATTTAAAATTGTACAGAACAAAAAAATAAAATCAAAGACTGATCTTGTACAGATATTAGTGTTACCAGCATTCATGTGGAA
ATCAAGAGCAAAGACAAAATAATGTTAAACAATTCTGTACCATAACATTTTCTGTAATGATACTGAAACTTAATGAATAAAAAAATTCCT

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000543237_chr14_67525366_+_2027nt
GGGACTCCGGCGAGAGCGACGCAAGGTCGGCTGCGGCGGCGGCCCGAGGGCGCCCGTGTGCCCAGTGCGCGGCGGGGACGGCCGCGAGCT
CGCTGGAGGGCTCCCCAGAATAATCCAGAAGTCGATTCCATCATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAA
CGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTACAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTG
GAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCTGAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTG
AAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAAGAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTA
GAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAAGCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACA
CTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAAAGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCG
CTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGAAGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTT
ATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATCATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATAT
GCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGATGGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATT
GGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATGCCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGT
GCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGGGAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAA
GCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATTAAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCA
GAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAAGTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTG
CTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGACAGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCC
ACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTACTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACA
TCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAGGTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTT
ATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATTGATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCG
GCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGGAAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGG
TTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCATCGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAG
AGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGCAGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTG
GAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGACGGCTATGATGGTCACCAGCAGGAGAAAGCTTTGATGCATGTCCACAT

>In-frame_PLEKHH1_ENST00000329153_chr14_68028752_+_GPHN_ENST00000305960_chr14_67525366_+_2201nt
GGGACTCCGGCGAGAGCGACGCAAGGTCGGCTGCGGCGGCGGCCCGAGGGCGCCCGTGTGCCCAGTGCGCGGCGGGGACGGCCGCGAGCT
CGCTGGAGGGCTCCCCAGAATAATCCAGAAGTCGATTCCATCATGGCAGAACTCAAGGTGGAGGCGCCGGCCAGCGTAGACTGGCAGAAA
CGCTGCCTGACCCTGGAAACTCAGCTTTTCCGGTTCCGCCTACAGGCCAGCAAGATAAGGGAGCTGCTGGCTGACAAGATGCAGGAGCTG
GAGCAGAGGCTGCTGGAGGCAGAGCAGAGAGCAGAGAACGCTGAGACCCAGGTGGGTGTCATGGAAGAGAAGGTAAAACTATCCAATCTG
AAGAATGTGGACTCTGAGGGGAGCCTGCACCGGAAATACCAAGAATTGCTGAAAGCCATAAAGGGCAAAGATGAGCTCATCAGCCAGCTA
GAGGCTCAGCTGGAGAAGCAGAAGCAGATGAGGGCAGAGGAAGCAAAAACTGTTCAAGAAAAAGCTGCAAAGATCAAGGAATGGGTGACA
CTCAAGTTGGCAAAGCTTGAGATGGAGAATCAGCATCTGAAAAGCCATAATCAGCGCCTGGTGGAGCAGGTGGGATCCCTTCAAGATGCG
CTAGAAGGTCACAGTGCTGTCGATATCACCAAGGTGGCTAGAAGACATCGCATGTCTCCTTTTCCTCTGACATCTATGGACAAAGCCTTT
ATCACAGTCCTGGAGATGACTCCGGTGCTTGGGACAGAAATCATCAATTACCGAGATGGAATGGGGCGAGTCCTTGCTCAAGATGTATAT
GCAAAAGACAATTTACCCCCCTTCCCAGCATCAGTAAAAGATGGCTATGCTGTCCGAGCTGCTGATGGCCCAGGAGATCGTTTCATCATT
GGGGAATCCCAAGCTGGTGAACAGCCAACTCAGACAGTAATGCCAGGACAAGTCATGCGGGTTACAACAGGTGCTCCAATACCCTGCGGT
GCTGATGCAGTAGTACAAGTGGAAGATACCGAACTTATCAGGGAATCAGATGATGGCACTGAAGAACTTGAAGTGCGAATTCTGGTGCAA
GCTCGGCCAGGCCAAGATATCAGACCCATCGGCCATGACATTAAAAGAGGGGAATGTGTTTTGGCCAAAGGAACCCACATGGGCCCCTCA
GAGATTGGTCTTCTGGCAACTGTAGGTGTCACAGAGGTTGAAGTTAATAAGTTTCCAGTGGTTGCAGTCATGTCAACAGGGAATGAGCTG
CTAAATCCTGAAGATGACCTCTTACCAGGGAAGATTCGAGACAGCAATCGTTCAACTCTTCTAGCAACAATTCAGGAACATGGTTACCCC
ACGATCAACTTGGGTATTGTAGGAGACAACCCAGATGACTTACTCAATGCCTTGAATGAGGGTATCAGTCGTGCTGATGTCATCATCACA
TCAGGGGGTGTATCCATGGGGGAAAAGGACTATCTCAAGCAGGTGCTGGACATTGATCTTCATGCTCAGATCCATTTTGGCAGGGTTTTT
ATGAAACCAGGCTTGCCAACAACATTTGCAACTTTGGATATTGATGGTGTAAGAAAAATAATCTTTGCACTACCTGGGAATCCTGTATCG
GCTGTGGTCACCTGCAATCTCTTTGTTGTGCCTGCACTGAGGAAAATGCAGGGCATCTTGGATCCTCGGCCAACCATCATCAAAGCAAGG
TTATCATGTGATGTAAAACTTGATCCTCGTCCAGAATACCATCGGTGTATACTAACTTGGCATCACCAAGAACCACTACCTTGGGCACAG
AGTACAGGTAATCAAATGAGCAGCCGTCTGATGAGCATGCGCAGTGCCAATGGATTGTTGATGCTACCTCCAAAGACAGAACAGTACGTG
GAGCTCCACAAAGGCGAGGTGGTGGATGTCATGGTCATTGGACGGCTATGATGGTCACCAGCAGGAGAAAGCTTTGATGCATGTCCACAT
ATCATTGACTGTATCCTGTAATATGCAACGGCACAGCTAGTTTTCCCGATTTGGATAAAAGTTGATCTGTATAGTCAACATCTTGAACTA
TATTTCAAATGAATTTAAATATCTTTTAAAGAAAAAAACACCTAAAAATAAATCTTAACAGAAAATTCTGTTCTGATTATATCAAGGCAA


Top

FusionGenePPI for PLEKHH1_GPHN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PLEKHH1APBB1IP, LPXNGPHNARHGEF9, GLRB, MTOR, PFN1, OTUD4, PRPF4, PCK1, SPATS1, GPHN, KHDRBS1, ACADVL, BRCC3, MTA2, PAAF1, PPP4R1, ROCK2, SPTAN1, TSSK1B, ODF3L2, NTRK1, DYNLL1, CDCA5, TCF4, SENP3, VASP, ENAH, KLKB1, KMO, LGALS3BP, STS, DYNLL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneGPHNchr14:68028752chr14:67525366ENST00000315266+822140_316302737GABARAP
TgeneGPHNchr14:68028752chr14:67525366ENST00000478722+923140_316335770GABARAP


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PLEKHH1_GPHN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PLEKHH1_GPHN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePLEKHH1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneGPHNC0001973Alcoholic Intoxication, Chronic1CTD_human
TgeneGPHNC0236736Cocaine-Related Disorders1CTD_human
TgeneGPHNC1854990Molybdenum Cofactor Deficiency, Complementation Group C1ORPHANET;UNIPROT