FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27389

FusionGeneSummary for PKM_TRPV3

check button Fusion gene summary
Fusion gene informationFusion gene name: PKM_TRPV3
Fusion gene ID: 27389
HgeneTgene
Gene symbol

PKM

TRPV3

Gene ID

5315

162514

Gene namepyruvate kinase M1/2transient receptor potential cation channel subfamily V member 3
SynonymsCTHBP|HEL-S-30|OIP3|PK3|PKM2|TCB|THBP1FNEPPK2|OLMS|VRL3
Cytomap

15q23

17p13.2

Type of geneprotein-codingprotein-coding
Descriptionpyruvate kinase PKMOIP-3OPA-interacting protein 3PK, muscle typecytosolic thyroid hormone-binding proteinepididymis secretory protein Li 30p58pyruvate kinase 2/3pyruvate kinase isozymes M1/M2pyruvate kinase muscle isozymepyruvate kinase, muscletransient receptor potential cation channel subfamily V member 3VRL-3vanilloid receptor-like 3vanilloid receptor-related osmotically activated channel protein
Modification date2018052720180527
UniProtAcc

P14618

Q8NET8

Ensembl transtripts involved in fusion geneENST00000319622, ENST00000565184, 
ENST00000389093, ENST00000335181, 
ENST00000568883, ENST00000449901, 
ENST00000565154, ENST00000568459, 
ENST00000301365, ENST00000576742, 
ENST00000572519, 
Fusion gene scores* DoF score17 X 21 X 3=10711 X 1 X 1=1
# samples 211
** MAII scorelog2(21/1071*10)=-2.35049724708413
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: PKM [Title/Abstract] AND TRPV3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePKM

GO:0012501

programmed cell death

17308100


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A18V-01APKMchr15

72502014

-TRPV3chr17

3439007

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000319622ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000319622ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000319622ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565184ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565184ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565184ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000389093ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000389093ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000389093ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000335181ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000335181ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000335181ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
intron-3CDSENST00000568883ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
intron-3CDSENST00000568883ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
intron-3CDSENST00000568883ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
In-frameENST00000449901ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
In-frameENST00000449901ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
In-frameENST00000449901ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565154ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565154ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000565154ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000568459ENST00000301365PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000568459ENST00000576742PKMchr15

72502014

-TRPV3chr17

3439007

-
Frame-shitENST00000568459ENST00000572519PKMchr15

72502014

-TRPV3chr17

3439007

-

Top

FusionProtFeatures for PKM_TRPV3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PKM

P14618

TRPV3

Q8NET8

Putative receptor-activated non-selective calciumpermeant cation channel. It is activated by innocuous (warm)temperatures and shows an increased response at noxioustemperatures greater than 39 degrees Celsius. Activation exhibitsan outward rectification. May associate with TRPV1 and maymodulate its activity. Is a negative regulator of hair growth andcycling: TRPV3-coupled signaling suppresses keratinocyteproliferation in hair follicles and induces apoptosis andpremature hair follicle regression (catagen).{ECO:0000269|PubMed:12077604, ECO:0000269|PubMed:12077606,ECO:0000269|PubMed:21593771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PKM_TRPV3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000301365_chr17_3439007_-_751aa
MSPEAQPQRTKGPQQPCRSPIVKPGLPSFRPSSCTQPWLTHSWSTCAAWTLIHHPSQPGTLASSVPLYHAETIKNVRTATESFASDPILY
RPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGQTALNI
AIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNILHALVTVAEDFK
TQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDN
SVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVL
IWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQK
VILHDVLKFLFVYIVFLLGFGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLITYVILTFVLLLN
MLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTAD

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000576742_chr17_3439007_-_750aa
MSPEAQPQRTKGPQQPCRSPIVKPGLPSFRPSSCTQPWLTHSWSTCAAWTLIHHPSQPGTLASSVPLYHAETIKNVRTATESFASDPILY
RPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGQTALNI
AIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNILHALVTVAEDFK
TQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDN
SVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVL
IWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQK
VILHDVLKFLFVYIVFLLGFGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLITYVILTFVLLLN
MLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDF

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000572519_chr17_3439007_-_725aa
MSPEAQPQRTKGPQQPCRSPIVKPGLPSFRPSSCTQPWLTHSWSTCAAWTLIHHPSQPGTLASSVPLYHAETIKNVRTATESFASDPILY
RPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGQTALNI
AIERRQGDIAALLIAAGADVNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNILHALVTVAEDFK
TQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYILSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDN
SVLEITVYNTNIDNRHEMLTLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMGWLQLLGRMFVL
IWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLYLFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQK
VILHDVLKFLFVYIVFLLGFGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLITYVILTFVLLLN
MLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTGT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000301365_chr17_3439007_-_2253nt
ATGTCACCGGAAGCCCAACCCCAGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGA
CCCAGCAGCTGCACGCAGCCATGGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACA
CTGGCATCATCTGTACCATTGTACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTAC
CGGCCCGTTGCTGTGGCTCTAGACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAG
AAGGGAGCCACTCTCAAAATCACGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGC
AAGGTGGTGGAAGTGGGCAGCAAGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATC
GCCATCGAGCGGCGGCAGGGGGACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAAC
CCCAAGTACCAACACGAAGGCTTCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTG
ATGGAGCACGAGCAGACGGACATCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAG
ACGCAGAATGACTTTGTGAAGCGCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGC
CTCACGCCGCTGCAGCTGGCCGCCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGG
AGCCTGTCCAGGAAGTTCACCGACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAAC
TCAGTGCTGGAAATCACTGTCTACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATG
AAGTGGAAGAAGTTTGCCAAGCACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTAC
CGCCCCCGGGAGGAGGAGGCCATCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTC
ATCTGGGCCATGTGCATCTCTGTGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGG
TTCCACTTTGTCTTTTTTATCCAAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTC
GTGCTGGCCATGGCCCTGGGCTGGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAG
GTCATTTTGCATGATGTTCTGAAGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAG
TGTCCCAAAGACAACAAGGACTGCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGAC
CTGAACATCCAGCAGAACTCCAAGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAAC
ATGCTCATTGCTCTGATGGGCGAGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTG
GAGTTTGAGAAAATGTTACCAGAATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGT
TTGCGGATCAATGAGGTGAAGTGGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGCAGAT
TTCAACAAAATCCAAGATTCTTCCAGGAACAACAGCAAAACCACTCTCAATGCATTTGAAGAAGTCGAGGAATTCCCGGAAACCTCGGTG

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000576742_chr17_3439007_-_2250nt
ATGTCACCGGAAGCCCAACCCCAGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGA
CCCAGCAGCTGCACGCAGCCATGGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACA
CTGGCATCATCTGTACCATTGTACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTAC
CGGCCCGTTGCTGTGGCTCTAGACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAG
AAGGGAGCCACTCTCAAAATCACGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGC
AAGGTGGTGGAAGTGGGCAGCAAGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATC
GCCATCGAGCGGCGGCAGGGGGACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAAC
CCCAAGTACCAACACGAAGGCTTCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTG
ATGGAGCACGAGCAGACGGACATCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAG
ACGCAGAATGACTTTGTGAAGCGCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGC
CTCACGCCGCTGCAGCTGGCCGCCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGG
AGCCTGTCCAGGAAGTTCACCGACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAAC
TCAGTGCTGGAAATCACTGTCTACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATG
AAGTGGAAGAAGTTTGCCAAGCACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTAC
CGCCCCCGGGAGGAGGAGGCCATCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTC
ATCTGGGCCATGTGCATCTCTGTGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGG
TTCCACTTTGTCTTTTTTATCCAAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTC
GTGCTGGCCATGGCCCTGGGCTGGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAG
GTCATTTTGCATGATGTTCTGAAGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAG
TGTCCCAAAGACAACAAGGACTGCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGAC
CTGAACATCCAGCAGAACTCCAAGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAAC
ATGCTCATTGCTCTGATGGGCGAGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTG
GAGTTTGAGAAAATGTTACCAGAATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGT
TTGCGGATCAATGAGGTGAAGTGGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGATTTC
AACAAAATCCAAGATTCTTCCAGGAACAACAGCAAAACCACTCTCAATGCATTTGAAGAAGTCGAGGAATTCCCGGAAACCTCGGTGTAG

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000572519_chr17_3439007_-_2175nt
ATGTCACCGGAAGCCCAACCCCAGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGA
CCCAGCAGCTGCACGCAGCCATGGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACA
CTGGCATCATCTGTACCATTGTACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTAC
CGGCCCGTTGCTGTGGCTCTAGACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAG
AAGGGAGCCACTCTCAAAATCACGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGC
AAGGTGGTGGAAGTGGGCAGCAAGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATC
GCCATCGAGCGGCGGCAGGGGGACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAAC
CCCAAGTACCAACACGAAGGCTTCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTG
ATGGAGCACGAGCAGACGGACATCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAG
ACGCAGAATGACTTTGTGAAGCGCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGC
CTCACGCCGCTGCAGCTGGCCGCCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGG
AGCCTGTCCAGGAAGTTCACCGACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAAC
TCAGTGCTGGAAATCACTGTCTACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATG
AAGTGGAAGAAGTTTGCCAAGCACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTAC
CGCCCCCGGGAGGAGGAGGCCATCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTC
ATCTGGGCCATGTGCATCTCTGTGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGG
TTCCACTTTGTCTTTTTTATCCAAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTC
GTGCTGGCCATGGCCCTGGGCTGGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAG
GTCATTTTGCATGATGTTCTGAAGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAG
TGTCCCAAAGACAACAAGGACTGCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGAC
CTGAACATCCAGCAGAACTCCAAGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAAC
ATGCTCATTGCTCTGATGGGCGAGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTG
GAGTTTGAGAAAATGTTACCAGAATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGT
TTGCGGATCAATGAGGTGAAGTGGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGGTACT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000301365_chr17_3439007_-_3138nt
GCACAGCAGCTGCACGCGCCGTGGCTCCGGATCTCTTCGTCTTTGCAGCGTAGCCCGAGTCGGTCAGCGCCGGAGCTCTCCAGGGCACAC
CGTATTCAGCTCTGAGCGGTCTTTGCTAGTGAGGCCAAGGAGCCACCCTGAGCCAAAAGGGGAGCATTATGTCACCGGAAGCCCAACCCC
AGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGACCCAGCAGCTGCACGCAGCCAT
GGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACACTGGCATCATCTGTACCATTGT
ACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTACCGGCCCGTTGCTGTGGCTCTAG
ACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAGAAGGGAGCCACTCTCAAAATCA
CGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGCAAGGTGGTGGAAGTGGGCAGCA
AGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATCGCCATCGAGCGGCGGCAGGGGG
ACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAACCCCAAGTACCAACACGAAGGCT
TCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTGATGGAGCACGAGCAGACGGACA
TCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAGACGCAGAATGACTTTGTGAAGC
GCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGCCTCACGCCGCTGCAGCTGGCCG
CCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGGAGCCTGTCCAGGAAGTTCACCG
ACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAACTCAGTGCTGGAAATCACTGTCT
ACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATGAAGTGGAAGAAGTTTGCCAAGC
ACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTACCGCCCCCGGGAGGAGGAGGCCA
TCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTCATCTGGGCCATGTGCATCTCTG
TGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGGTTCCACTTTGTCTTTTTTATCC
AAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTCGTGCTGGCCATGGCCCTGGGCT
GGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAGGTCATTTTGCATGATGTTCTGA
AGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAGTGTCCCAAAGACAACAAGGACT
GCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGACCTGAACATCCAGCAGAACTCCA
AGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAACATGCTCATTGCTCTGATGGGCG
AGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTGGAGTTTGAGAAAATGTTACCAG
AATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGTTTGCGGATCAATGAGGTGAAGT
GGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGCAGATTTCAACAAAATCCAAGATTCTT
CCAGGAACAACAGCAAAACCACTCTCAATGCATTTGAAGAAGTCGAGGAATTCCCGGAAACCTCGGTGTAGAAGCGGAACCCAGAGCTGG
TGTGCGCGTGCGCTGTCTGGCGCTGCAGGCGGAGTCACCGACTCTGTGCAGAGAGGCTTTGAGGGATGGTGGAGTCCGGCTCTGCTGGCC
TAGAAGCAGAGTGCACCCTCGTGCTCAGTGCTCAGTGGGTGTCTGAACTGAGGGGCAGTTGTCAATTTGTCTGAGTGGGAAACATCCTGG
ATTTTGTTACTTGGCAAACAGCTGGTGTAAACCTACAGCCAGCAGCAGTCTGGAGCCTGGGAGCCTCCTGAAGTCCCGGGTGAAGCCTCT
GGTTTTACCAATTGCAGGTCGGCTTGGCTGGGAGAGATGGATGGCGGGAAAGGGGCAGCAGTCTTGAGGAGCAGGGAGAGGAGTCTTTCC
TCCTGCCAGCTTCCCCCGTCAGCCCCAACCCCAGCCCACACATTGTACCATCTCTTCTGCTGTGACTGGGTTGCCTGAATTTGTGGGAGA
CCCGTGATCCCATCCCAGAGTGTGCGGGGGACGGAGGTAAGCTGGATATCCTGGGGGAGGAGGGGAATGCGCTCTGGAAACACCCTTCCG
GAACCCTTCGGGGAAAAGGAGACCATCCTTGGAGTGAACGTCCCCTGACACCCCAAGGTTCAAACTGTCTCAAGCTGAGAGATGTTTTTA

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000576742_chr17_3439007_-_2479nt
GCACAGCAGCTGCACGCGCCGTGGCTCCGGATCTCTTCGTCTTTGCAGCGTAGCCCGAGTCGGTCAGCGCCGGAGCTCTCCAGGGCACAC
CGTATTCAGCTCTGAGCGGTCTTTGCTAGTGAGGCCAAGGAGCCACCCTGAGCCAAAAGGGGAGCATTATGTCACCGGAAGCCCAACCCC
AGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGACCCAGCAGCTGCACGCAGCCAT
GGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACACTGGCATCATCTGTACCATTGT
ACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTACCGGCCCGTTGCTGTGGCTCTAG
ACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAGAAGGGAGCCACTCTCAAAATCA
CGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGCAAGGTGGTGGAAGTGGGCAGCA
AGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATCGCCATCGAGCGGCGGCAGGGGG
ACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAACCCCAAGTACCAACACGAAGGCT
TCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTGATGGAGCACGAGCAGACGGACA
TCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAGACGCAGAATGACTTTGTGAAGC
GCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGCCTCACGCCGCTGCAGCTGGCCG
CCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGGAGCCTGTCCAGGAAGTTCACCG
ACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAACTCAGTGCTGGAAATCACTGTCT
ACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATGAAGTGGAAGAAGTTTGCCAAGC
ACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTACCGCCCCCGGGAGGAGGAGGCCA
TCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTCATCTGGGCCATGTGCATCTCTG
TGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGGTTCCACTTTGTCTTTTTTATCC
AAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTCGTGCTGGCCATGGCCCTGGGCT
GGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAGGTCATTTTGCATGATGTTCTGA
AGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAGTGTCCCAAAGACAACAAGGACT
GCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGACCTGAACATCCAGCAGAACTCCA
AGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAACATGCTCATTGCTCTGATGGGCG
AGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTGGAGTTTGAGAAAATGTTACCAG
AATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGTTTGCGGATCAATGAGGTGAAGT
GGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGATTTCAACAAAATCCAAGATTCTTCCA
GGAACAACAGCAAAACCACTCTCAATGCATTTGAAGAAGTCGAGGAATTCCCGGAAACCTCGGTGTAGAAGCGGAACCCAGAGCTGGTGT

>In-frame_PKM_ENST00000449901_chr15_72502014_-_TRPV3_ENST00000572519_chr17_3439007_-_2840nt
GCACAGCAGCTGCACGCGCCGTGGCTCCGGATCTCTTCGTCTTTGCAGCGTAGCCCGAGTCGGTCAGCGCCGGAGCTCTCCAGGGCACAC
CGTATTCAGCTCTGAGCGGTCTTTGCTAGTGAGGCCAAGGAGCCACCCTGAGCCAAAAGGGGAGCATTATGTCACCGGAAGCCCAACCCC
AGAGAACCAAAGGACCTCAGCAGCCATGTCGAAGCCCCATAGTGAAGCCGGGACTGCCTTCATTCAGACCCAGCAGCTGCACGCAGCCAT
GGCTGACACATTCCTGGAGCACATGTGCCGCCTGGACATTGATTCACCACCCATCACAGCCCGGAACACTGGCATCATCTGTACCATTGT
ACCATGCGGAGACCATCAAGAATGTGCGCACAGCCACGGAAAGCTTTGCTTCTGACCCCATCCTCTACCGGCCCGTTGCTGTGGCTCTAG
ACACTAAAGGACCTGAGATCCGAACTGGGCTCATCAAGGGCAGCGGCACTGCAGAGGTGGAGCTGAAGAAGGGAGCCACTCTCAAAATCA
CGCTGGATAACGCCTACATGGAAAAGTGTGACGAGAACATCCTGTGGCTGGACTACAAGAACATCTGCAAGGTGGTGGAAGTGGGCAGCA
AGATCTACGTGGATGATGGGCTTATTTCTCTCCAGGTGAAGCAGAAAGGGCAGACGGCGCTGAACATCGCCATCGAGCGGCGGCAGGGGG
ACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGACGTCAACGCGCACGCCAAGGGGGCCTTCTTCAACCCCAAGTACCAACACGAAGGCT
TCTACTTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTGCTGATGGAGCACGAGCAGACGGACA
TCACCTCGCGGGACTCACGAGGCAACAACATCCTTCACGCCCTGGTGACCGTGGCCGAGGACTTCAAGACGCAGAATGACTTTGTGAAGC
GCATGTACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGATGGCCTCACGCCGCTGCAGCTGGCCG
CCAAGATGGGCAAGGCGGAGATCCTGAAGTACATCCTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGGAGCCTGTCCAGGAAGTTCACCG
ACTGGGCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGACAACTCAGTGCTGGAAATCACTGTCT
ACAACACCAACATCGACAACCGGCATGAGATGCTGACCCTGGAGCCGCTGCACACGCTGCTGCATATGAAGTGGAAGAAGTTTGCCAAGC
ACATGTTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTACTACCGCCCCCGGGAGGAGGAGGCCA
TCCCGCACCCCTTGGCCCTGACGCACAAGATGGGGTGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTCATCTGGGCCATGTGCATCTCTG
TGAAAGAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCCTGGTTCCACTTTGTCTTTTTTATCC
AAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTACTTGTTTGCCTACAAAGAGTACCTCGCCTGCCTCGTGCTGGCCATGGCCCTGGGCT
GGGCGAACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAGAAGGTCATTTTGCATGATGTTCTGA
AGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGATTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAGTGTCCCAAAGACAACAAGGACT
GCAGCTCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGTGACCTGAACATCCAGCAGAACTCCA
AGTATCCCATTCTCTTTCTGTTCCTGCTCATCACCTATGTCATCCTCACCTTTGTTCTCCTCCTCAACATGCTCATTGCTCTGATGGGCG
AGACTGTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATCTTGGAGTTTGAGAAAATGTTACCAG
AATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTGTGCAAAGTGGCCGAGGATGATTTCCGACTGTGTTTGCGGATCAATGAGGTGAAGT
GGACTGAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGGTACTGTCGCTGTGAGGTGACATGGTG
TCCGCTCCTGTCTCAGACCATGTAACCTTGGGCAGATCAAGTCTAAGGGTCCTGACTTTCCCCATCTGTCAAATGGGAGGGTTGAATGGA
AATGCTTCTTAGGTCTCTTCCAGCTCTGACTTTTAGAACCCTAGTTGGCACAACTTTTAAAATGGCGTAGCCCTAAGCCATAGAAACACA
TCATGCAGGCCGGGCGCGGTGGCTCGTGCCTGTAATCCCAGCACTTTGGGAGGACGAGTCGGGTGAATCACCTGAGGTCAGGAGTTTGAG
ACCAGCCTGGCCAACATGGTGACACCTTGTCTCTACTAAAGATACAAAAATTAGCCGAACGTGGTGGCAGGTGCCTATAATCCCAGCTAC
TCGAGAGGCTGAGTCAGGAGAATTGCTTGAACCTGGGAGGTGGAGGTTGCAGTGAGCTGAGATCACACCACTGCACTGCAGCCTGGGTGA


Top

FusionGenePPI for PKM_TRPV3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PKMTRIM63, BANF1, MGMT, HERC1, H2AFX, RNF185, UCHL5, HDAC5, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5, PSMA3, RAP1B, GRB7, RPP14, TK1, CDKN1A, CDK4, NAGK, SMN1, RCC1, PIN1, ANXA7, NDRG1, ARRB1, ARRB2, ISG15, TERF1, TINF2, CUL3, CUL5, CUL2, CDK2, CUL1, COPS5, SHBG, MYOC, PML, APP, ENO3, GAPDH, FUBP1, PCBP1, TKT, PRDX2, PRDX6, IKBKAP, HIF1A, EGLN1, EGLN3, EP300, VCP, TRAF3IP1, HSP90AA1, HSP90AB1, FN1, ATF2, IQCB1, ITGA4, MPG, PAN2, CD81, IGSF8, NPM1, MAPK7, HDAC6, LMO7, RELA, PAX8, RAF1, EXOSC5, MDM2, NLK, YWHAQ, FBXO6, ACAT2, ANP32A, CBS, EIF4A3, NPLOC4, PDLIM5, CAPZA2, CTPS1, IPO11, PPP1CA, PLIN3, RAD23B, SRP14, TWF2, UBA2, STAU1, HUWE1, FUS, POLE2, NXT2, LNX1, CUL7, OBSL1, CCDC8, EZH2, SUZ12, SUMO1, CDK16, HNRNPA1, AGL, AKR1A1, ALDH5A1, ALDOA, AMDHD2, ASS1, BAX, DAZAP1, DNAJA3, EEF1D, FAM49B, FH, GNG12, HNRNPD, HNRNPK, HSPB1, LYPLA2, ME1, NANS, PFKM, PGK1, C9orf64, CFL1, EEF1A1, EEF1A2, LDHA, LDHAL6A, LDHB, PAICS, PFKL, PFKP, PPID, RAB10, RAC1, RPN1, SLC3A2, TRAP1, TUBA4A, TUBB, UFM1, NTRK1, PTEN, EWSR1, PPME1, CCDC88A, ARAF, TRIM35, FGFR1, ETS1, USP7, CRY1, DDB2, EPM2A, MCM2, MCM5, CDC37, U2AF2, CDC25A, CTNNB1, CDC73, WWP2, ZNF746, CDH1, CYP1A1, SNRNP27, DDX19B, PAPLN, MYL2, AURKB, MAPK1, KPNA1, TRIM25, BRCA1TRPV3AKAP5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PKM_TRPV3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePKMP14618DB11638ArtenimolPyruvate kinase PKMsmall moleculeapproved|investigational

Top

RelatedDiseases for PKM_TRPV3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePKMC0027626Neoplasm Invasiveness2CTD_human
HgenePKMC0024667Animal Mammary Neoplasms1CTD_human
HgenePKMC0024668Mammary Neoplasms, Experimental1CTD_human
HgenePKMC0029456Osteoporosis1CTD_human
HgenePKMC2239176Liver carcinoma1CTD_human
TgeneTRPV3C2609071Olmsted syndrome2ORPHANET;UNIPROT
TgeneTRPV3C4225339PALMOPLANTAR KERATODERMA, NONEPIDERMOLYTIC, FOCAL 21ORPHANET;UNIPROT