FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27220

FusionGeneSummary for PIK3R4_ASTE1

check button Fusion gene summary
Fusion gene informationFusion gene name: PIK3R4_ASTE1
Fusion gene ID: 27220
HgeneTgene
Gene symbol

PIK3R4

ASTE1

Gene ID

30849

28990

Gene namephosphoinositide-3-kinase regulatory subunit 4asteroid homolog 1
SynonymsVPS15|p150HT001
Cytomap

3q22.1

3q22.1

Type of geneprotein-codingprotein-coding
Descriptionphosphoinositide 3-kinase regulatory subunit 4PI3-kinase p150 subunitPI3-kinase regulatory subunit 4phosphatidylinositol 3-kinase-associated p150phosphoinositide 3-kinase adaptor proteinphosphoinositide-3-kinase, regulatory subunit 4, p150protein asteroid homolog 1
Modification date2018052320180519
UniProtAcc

Q99570

Q2TB18

Ensembl transtripts involved in fusion geneENST00000356763, ENST00000512677, 
ENST00000514044, ENST00000264992, 
Fusion gene scores* DoF score3 X 3 X 3=271 X 1 X 1=1
# samples 31
** MAII scorelog2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: PIK3R4 [Title/Abstract] AND ASTE1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIK3R4

GO:0043552

positive regulation of phosphatidylinositol 3-kinase activity

21062745


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-CG-4443-01APIK3R4chr3

130447307

-ASTE1chr3

130735183

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356763ENST00000514044PIK3R4chr3

130447307

-ASTE1chr3

130735183

-
In-frameENST00000356763ENST00000264992PIK3R4chr3

130447307

-ASTE1chr3

130735183

-
intron-3CDSENST00000512677ENST00000514044PIK3R4chr3

130447307

-ASTE1chr3

130735183

-
intron-3CDSENST00000512677ENST00000264992PIK3R4chr3

130447307

-ASTE1chr3

130735183

-

Top

FusionProtFeatures for PIK3R4_ASTE1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIK3R4

Q99570

ASTE1

Q2TB18

Regulatory subunit of the PI3K complex that mediatesformation of phosphatidylinositol 3-phosphate; different complexforms are believed to play a role in multiple membrane traffickingpathways: PI3KC3-C1 is involved in initiation of autophagosomesand PI3KC3-C2 in maturation of autophagosomes and endocytosis.Involved in regulation of degradative endocytic trafficking andcytokinesis, probably in the context of PI3KC3-C2(PubMed:20643123). {ECO:0000269|PubMed:20643123}. Possible role in EGF receptor signaling. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-62026_3246021359DomainProtein kinase
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-62032_406021359Nucleotide bindingATP
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620413_4506021359RepeatNote=HEAT 1
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620458_4956021359RepeatNote=HEAT 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620781_7846021359Compositional biasNote=Poly-Glu
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620974_9776021359Compositional biasNote=Poly-Pro
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201040_10796021359RepeatNote=WD 2
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201093_11346021359RepeatNote=WD 3
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201139_11786021359RepeatNote=WD 4
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201182_12236021359RepeatNote=WD 5
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201237_12786021359RepeatNote=WD 6
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-6201327_13586021359RepeatNote=WD 7
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620572_6106021359RepeatNote=HEAT 3
HgenePIK3R4chr3:130447307chr3:130735183ENST00000356763-620991_10306021359RepeatNote=WD 1


Top

FusionGeneSequence for PIK3R4_ASTE1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000514044_chr3_130735183_-_803aa
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLNSAQNCLPFQKA
SEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNG
HFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKE
VPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGKEELQEDGAKMLYAEFQRVKAQTRLGT
RLDLDTAHIFCQWQSCLQMGMYLNQLLSTPLPEPDLTRPSAFNTLNEDIWTHTKYGGTLHVSRLYSGSLVHGLCQQLLASTSVESLLSIC

>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000264992_chr3_130735183_-_778aa
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLNSAQNCLPFQKA
SEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNG
HFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKE
VPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGKEELQEDGAKMLYAEFQRVKAQTRLGT
RLDLDTAHIFCQWQSCLQMGMYLNQLLSTPLPEPDLTRLYSGSLVHGLCQQLLASTSVESLLSICPEAKQLYEYLFNATRSYAPAEIFLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000514044_chr3_130735183_-_2409nt
ATGGGAAATCAGCTTGCTGGCATTGCTCCCTCCCAGATCCTTTCTGTAGAGAGTTATTTTTCAGATATTCATGACTTTGAATATGATAAA
AGCCTGGGGAGTACTCGGTTTTTTAAAGTTGCTCGAGCCAAGCACCGAGAAGGCCTGGTCGTTGTGAAGGTTTTTGCAATTCAGGATCCC
ACATTGCCTTTAACCAGCTATAAACAAGAGCTGGAGGAACTGAAAATCAGGCTTAATTCTGCACAGAATTGTCTACCTTTCCAGAAAGCA
TCAGAAAAAGCATCTGAGAAAGCAGCTATGCTCTTTAGGCAGTATGTGCGAGACAATCTCTATGATCGCATCAGTACCCGTCCATTCTTG
AATAACATTGAGAAGCGCTGGATTGCTTTCCAGATCCTGACAGCTGTGGACCAAGCACACAAATCTGGAGTTCGTCATGGGGACATCAAG
ACTGAGAATGTGATGGTCACCAGTTGGAATTGGGTTCTTCTAACTGATTTTGCCAGTTTTAAGCCCACTTATCTTCCAGAAGACAACCCG
GCAGATTTCAATTATTTCTTTGACACATCACGGAGGAGAACTTGCTATATTGCTCCTGAACGTTTTGTTGATGGTGGGATGTTTGCCACT
GAGTTAGAATATATGAGAGATCCTTCAACTCCGCTTGTAGACTTAAATAGCAATCAGAGAACAAGAGGAGAGTTGAAGAGAGCAATGGAC
ATCTTTTCAGCAGGTTGTGTGATAGCTGAGCTTTTTACAGAAGGTGTACCATTATTTGATCTCTCTCAACTTTTGGCTTATAGAAATGGA
CATTTTTTCCCTGAACAAGTGCTAAATAAAATTGAAGATCACAGTATCAGAGAATTGGTAACTCAGATGATTCACCGTGAGCCAGATAAA
CGTTTAGAGGCAGAAGATTACTTAAAACAGCAGCGTGGCAATGCCTTTCCTGAAATATTTTACACTTTTCTTCAGCCCTACATGGCCCAG
TTTGCCAAGGAAACGTTTCTTTCTGCAGATGAGCGTATTCTGGTTATACGGAAGGATTTGGGCAACATTATTCACAATCTCTGTGGACAT
GATCTGCCAGAAAAAGCCGAAGGAGAGCCTAAGGAAAATGGGCTGGTTATCTTGGTATCTGTTATAACATCCTGCCTACAGACCCTTAAA
TACTGTGATTCCAAACTAGCTGCTTTGGAACTGATTCTTCATTTGGCTCCAAGATTAAGTGTTGAAATCCTTTTGGATCGTATTACTCCA
TATCTTTTGCATTTCAGCAATGACTCTGTTCCTAGGGTGAGGGCTGAAGCCTTGAGGACGTTGACCAAAGTTCTTGCTCTCGTCAAAGAG
GTTCCTCGTAATGATATCAATATTTATCCGGAATACATTCTGCCAGGCATAGCCCACTTAGCCCAAGATGATGCTACTATCGTTAGACTA
GCCTATGCTGAAAACATAGCTCTGCTGGCAGAAACAGCTCTGAGATTCCTGGAATTAGTACAGTTAAAAAATCTTAATATGGAAAATGAC
CCCAATAATGAAGAAATAGATGAGGTTACACATCCAAATGGAAATTATGACACAGAGCTCCAAGCCTTACATGAAATGGTCCAGCAGAAA
GTTGTTACTTTGCTAAGTGACCCTGAAAATATTGTAAAACAAACCTTGATGGAAAATGGAATAACACGGCTGTGTGTATTCTTTGGACGT
CAGAAAGCCAACGATGTTTTGTTGTCCCACATGATTACTTTCCTAAATGATAAGAATGATTGGCATCTACGTGGAGCATTTTTTGATAGT
ATAGTTGGTAAGGAAGAGCTGCAGGAAGATGGTGCTAAGATGTTGTATGCAGAGTTCCAAAGAGTGAAGGCGCAGACACGGCTGGGCACA
AGACTGGACTTAGACACAGCTCACATCTTCTGTCAGTGGCAGTCCTGTCTCCAGATGGGGATGTATCTCAACCAGCTGCTGTCCACTCCT
CTCCCAGAGCCAGACCTAACTCGCCCCAGTGCCTTCAATACTTTGAATGAGGATATATGGACGCATACAAAATATGGTGGGACTTTACAT
GTTTCAAGACTGTACAGTGGAAGCCTGGTGCACGGACTATGCCAGCAACTGCTAGCATCGACCTCTGTAGAAAGTCTCCTGAGCATATGT
CCTGAGGCTAAGCAACTTTATGAATATCTATTCAATGCCACAAGGTCATATGCCCCCGCTGAAATATTCCTACCAAAAGGTAGATCAAAT
TCAAAAAAAAAAAGGCAGAAGAAACAGAATACCAGCTGTTCTAAGAACAGAGGGAGAACCACTGCACACACCAAGTGTTGGTATGAGGGA

>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000264992_chr3_130735183_-_2334nt
ATGGGAAATCAGCTTGCTGGCATTGCTCCCTCCCAGATCCTTTCTGTAGAGAGTTATTTTTCAGATATTCATGACTTTGAATATGATAAA
AGCCTGGGGAGTACTCGGTTTTTTAAAGTTGCTCGAGCCAAGCACCGAGAAGGCCTGGTCGTTGTGAAGGTTTTTGCAATTCAGGATCCC
ACATTGCCTTTAACCAGCTATAAACAAGAGCTGGAGGAACTGAAAATCAGGCTTAATTCTGCACAGAATTGTCTACCTTTCCAGAAAGCA
TCAGAAAAAGCATCTGAGAAAGCAGCTATGCTCTTTAGGCAGTATGTGCGAGACAATCTCTATGATCGCATCAGTACCCGTCCATTCTTG
AATAACATTGAGAAGCGCTGGATTGCTTTCCAGATCCTGACAGCTGTGGACCAAGCACACAAATCTGGAGTTCGTCATGGGGACATCAAG
ACTGAGAATGTGATGGTCACCAGTTGGAATTGGGTTCTTCTAACTGATTTTGCCAGTTTTAAGCCCACTTATCTTCCAGAAGACAACCCG
GCAGATTTCAATTATTTCTTTGACACATCACGGAGGAGAACTTGCTATATTGCTCCTGAACGTTTTGTTGATGGTGGGATGTTTGCCACT
GAGTTAGAATATATGAGAGATCCTTCAACTCCGCTTGTAGACTTAAATAGCAATCAGAGAACAAGAGGAGAGTTGAAGAGAGCAATGGAC
ATCTTTTCAGCAGGTTGTGTGATAGCTGAGCTTTTTACAGAAGGTGTACCATTATTTGATCTCTCTCAACTTTTGGCTTATAGAAATGGA
CATTTTTTCCCTGAACAAGTGCTAAATAAAATTGAAGATCACAGTATCAGAGAATTGGTAACTCAGATGATTCACCGTGAGCCAGATAAA
CGTTTAGAGGCAGAAGATTACTTAAAACAGCAGCGTGGCAATGCCTTTCCTGAAATATTTTACACTTTTCTTCAGCCCTACATGGCCCAG
TTTGCCAAGGAAACGTTTCTTTCTGCAGATGAGCGTATTCTGGTTATACGGAAGGATTTGGGCAACATTATTCACAATCTCTGTGGACAT
GATCTGCCAGAAAAAGCCGAAGGAGAGCCTAAGGAAAATGGGCTGGTTATCTTGGTATCTGTTATAACATCCTGCCTACAGACCCTTAAA
TACTGTGATTCCAAACTAGCTGCTTTGGAACTGATTCTTCATTTGGCTCCAAGATTAAGTGTTGAAATCCTTTTGGATCGTATTACTCCA
TATCTTTTGCATTTCAGCAATGACTCTGTTCCTAGGGTGAGGGCTGAAGCCTTGAGGACGTTGACCAAAGTTCTTGCTCTCGTCAAAGAG
GTTCCTCGTAATGATATCAATATTTATCCGGAATACATTCTGCCAGGCATAGCCCACTTAGCCCAAGATGATGCTACTATCGTTAGACTA
GCCTATGCTGAAAACATAGCTCTGCTGGCAGAAACAGCTCTGAGATTCCTGGAATTAGTACAGTTAAAAAATCTTAATATGGAAAATGAC
CCCAATAATGAAGAAATAGATGAGGTTACACATCCAAATGGAAATTATGACACAGAGCTCCAAGCCTTACATGAAATGGTCCAGCAGAAA
GTTGTTACTTTGCTAAGTGACCCTGAAAATATTGTAAAACAAACCTTGATGGAAAATGGAATAACACGGCTGTGTGTATTCTTTGGACGT
CAGAAAGCCAACGATGTTTTGTTGTCCCACATGATTACTTTCCTAAATGATAAGAATGATTGGCATCTACGTGGAGCATTTTTTGATAGT
ATAGTTGGTAAGGAAGAGCTGCAGGAAGATGGTGCTAAGATGTTGTATGCAGAGTTCCAAAGAGTGAAGGCGCAGACACGGCTGGGCACA
AGACTGGACTTAGACACAGCTCACATCTTCTGTCAGTGGCAGTCCTGTCTCCAGATGGGGATGTATCTCAACCAGCTGCTGTCCACTCCT
CTCCCAGAGCCAGACCTAACTCGACTGTACAGTGGAAGCCTGGTGCACGGACTATGCCAGCAACTGCTAGCATCGACCTCTGTAGAAAGT
CTCCTGAGCATATGTCCTGAGGCTAAGCAACTTTATGAATATCTATTCAATGCCACAAGGTCATATGCCCCCGCTGAAATATTCCTACCA
AAAGGTAGATCAAATTCAAAAAAAAAAAGGCAGAAGAAACAGAATACCAGCTGTTCTAAGAACAGAGGGAGAACCACTGCACACACCAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000514044_chr3_130735183_-_3149nt
GAGGTCAGACCGGTTGCTTTCCCGGGAGTTCGGCGTTTGCTGGGGCTGCAGCAGCTGAAGTGTAGTGTTTTCTTGGGACTGGCGGTCTGC
ACTTCTCTCCCGGGTTCCATCTCCCCCCGCCCGGTGGTGAGGCCCTCGAGGAGGGCTCGGACGGGTGTAGCGATCCGCGCTAGAGGAAGA
CGAGGCCCGGGAACGCATGTCCCCCAGGGCAGGTTAGGGGGCTGGAGGGGTCAAATCCCGGGGTACTTGTGGAGACTCTTTAGCGTGGCT
TCTTCTCTCTGCTGAGACCCCGAGAGCTTTCCCAGTTCTCCTCCCAGGACCACCGGGGTTCCTGAAGATCGGGACTTTTCTGCGCCCCTC
CACCAACAGCCCATCTCCTGTCTATGAAGAAAGACCCTTCGTAGAAACAACTTCCCCGCTGCTGACGCGTTTTCCCGTCCCGTCCCCGAA
GTAGTCTACTATGACCTCGTTGTGAGCCTCTGAACGATTTTGACACTTTCCCGAGGCCTAGGGTATTATATCCTAACCTTACTAAAGACC
ACAGAGGTGCTTGCCATTATGGGAAATCAGCTTGCTGGCATTGCTCCCTCCCAGATCCTTTCTGTAGAGAGTTATTTTTCAGATATTCAT
GACTTTGAATATGATAAAAGCCTGGGGAGTACTCGGTTTTTTAAAGTTGCTCGAGCCAAGCACCGAGAAGGCCTGGTCGTTGTGAAGGTT
TTTGCAATTCAGGATCCCACATTGCCTTTAACCAGCTATAAACAAGAGCTGGAGGAACTGAAAATCAGGCTTAATTCTGCACAGAATTGT
CTACCTTTCCAGAAAGCATCAGAAAAAGCATCTGAGAAAGCAGCTATGCTCTTTAGGCAGTATGTGCGAGACAATCTCTATGATCGCATC
AGTACCCGTCCATTCTTGAATAACATTGAGAAGCGCTGGATTGCTTTCCAGATCCTGACAGCTGTGGACCAAGCACACAAATCTGGAGTT
CGTCATGGGGACATCAAGACTGAGAATGTGATGGTCACCAGTTGGAATTGGGTTCTTCTAACTGATTTTGCCAGTTTTAAGCCCACTTAT
CTTCCAGAAGACAACCCGGCAGATTTCAATTATTTCTTTGACACATCACGGAGGAGAACTTGCTATATTGCTCCTGAACGTTTTGTTGAT
GGTGGGATGTTTGCCACTGAGTTAGAATATATGAGAGATCCTTCAACTCCGCTTGTAGACTTAAATAGCAATCAGAGAACAAGAGGAGAG
TTGAAGAGAGCAATGGACATCTTTTCAGCAGGTTGTGTGATAGCTGAGCTTTTTACAGAAGGTGTACCATTATTTGATCTCTCTCAACTT
TTGGCTTATAGAAATGGACATTTTTTCCCTGAACAAGTGCTAAATAAAATTGAAGATCACAGTATCAGAGAATTGGTAACTCAGATGATT
CACCGTGAGCCAGATAAACGTTTAGAGGCAGAAGATTACTTAAAACAGCAGCGTGGCAATGCCTTTCCTGAAATATTTTACACTTTTCTT
CAGCCCTACATGGCCCAGTTTGCCAAGGAAACGTTTCTTTCTGCAGATGAGCGTATTCTGGTTATACGGAAGGATTTGGGCAACATTATT
CACAATCTCTGTGGACATGATCTGCCAGAAAAAGCCGAAGGAGAGCCTAAGGAAAATGGGCTGGTTATCTTGGTATCTGTTATAACATCC
TGCCTACAGACCCTTAAATACTGTGATTCCAAACTAGCTGCTTTGGAACTGATTCTTCATTTGGCTCCAAGATTAAGTGTTGAAATCCTT
TTGGATCGTATTACTCCATATCTTTTGCATTTCAGCAATGACTCTGTTCCTAGGGTGAGGGCTGAAGCCTTGAGGACGTTGACCAAAGTT
CTTGCTCTCGTCAAAGAGGTTCCTCGTAATGATATCAATATTTATCCGGAATACATTCTGCCAGGCATAGCCCACTTAGCCCAAGATGAT
GCTACTATCGTTAGACTAGCCTATGCTGAAAACATAGCTCTGCTGGCAGAAACAGCTCTGAGATTCCTGGAATTAGTACAGTTAAAAAAT
CTTAATATGGAAAATGACCCCAATAATGAAGAAATAGATGAGGTTACACATCCAAATGGAAATTATGACACAGAGCTCCAAGCCTTACAT
GAAATGGTCCAGCAGAAAGTTGTTACTTTGCTAAGTGACCCTGAAAATATTGTAAAACAAACCTTGATGGAAAATGGAATAACACGGCTG
TGTGTATTCTTTGGACGTCAGAAAGCCAACGATGTTTTGTTGTCCCACATGATTACTTTCCTAAATGATAAGAATGATTGGCATCTACGT
GGAGCATTTTTTGATAGTATAGTTGGTAAGGAAGAGCTGCAGGAAGATGGTGCTAAGATGTTGTATGCAGAGTTCCAAAGAGTGAAGGCG
CAGACACGGCTGGGCACAAGACTGGACTTAGACACAGCTCACATCTTCTGTCAGTGGCAGTCCTGTCTCCAGATGGGGATGTATCTCAAC
CAGCTGCTGTCCACTCCTCTCCCAGAGCCAGACCTAACTCGCCCCAGTGCCTTCAATACTTTGAATGAGGATATATGGACGCATACAAAA
TATGGTGGGACTTTACATGTTTCAAGACTGTACAGTGGAAGCCTGGTGCACGGACTATGCCAGCAACTGCTAGCATCGACCTCTGTAGAA
AGTCTCCTGAGCATATGTCCTGAGGCTAAGCAACTTTATGAATATCTATTCAATGCCACAAGGTCATATGCCCCCGCTGAAATATTCCTA
CCAAAAGGTAGATCAAATTCAAAAAAAAAAAGGCAGAAGAAACAGAATACCAGCTGTTCTAAGAACAGAGGGAGAACCACTGCACACACC
AAGTGTTGGTATGAGGGAAACAACCGGTTTGGGTTGTTAATGGTTGAAAACTTAGAGGAACATAGTGAGGCCTCCAACATTGAATAAAAC
TCAGTTTGCATCAAACTAGATGTATTTAATATAATCCTTACTTAAAATTCTTCCGTTACCACCCTTGAAACAATTAGCTTTTTCTTTAGG

>In-frame_PIK3R4_ENST00000356763_chr3_130447307_-_ASTE1_ENST00000264992_chr3_130735183_-_3074nt
GAGGTCAGACCGGTTGCTTTCCCGGGAGTTCGGCGTTTGCTGGGGCTGCAGCAGCTGAAGTGTAGTGTTTTCTTGGGACTGGCGGTCTGC
ACTTCTCTCCCGGGTTCCATCTCCCCCCGCCCGGTGGTGAGGCCCTCGAGGAGGGCTCGGACGGGTGTAGCGATCCGCGCTAGAGGAAGA
CGAGGCCCGGGAACGCATGTCCCCCAGGGCAGGTTAGGGGGCTGGAGGGGTCAAATCCCGGGGTACTTGTGGAGACTCTTTAGCGTGGCT
TCTTCTCTCTGCTGAGACCCCGAGAGCTTTCCCAGTTCTCCTCCCAGGACCACCGGGGTTCCTGAAGATCGGGACTTTTCTGCGCCCCTC
CACCAACAGCCCATCTCCTGTCTATGAAGAAAGACCCTTCGTAGAAACAACTTCCCCGCTGCTGACGCGTTTTCCCGTCCCGTCCCCGAA
GTAGTCTACTATGACCTCGTTGTGAGCCTCTGAACGATTTTGACACTTTCCCGAGGCCTAGGGTATTATATCCTAACCTTACTAAAGACC
ACAGAGGTGCTTGCCATTATGGGAAATCAGCTTGCTGGCATTGCTCCCTCCCAGATCCTTTCTGTAGAGAGTTATTTTTCAGATATTCAT
GACTTTGAATATGATAAAAGCCTGGGGAGTACTCGGTTTTTTAAAGTTGCTCGAGCCAAGCACCGAGAAGGCCTGGTCGTTGTGAAGGTT
TTTGCAATTCAGGATCCCACATTGCCTTTAACCAGCTATAAACAAGAGCTGGAGGAACTGAAAATCAGGCTTAATTCTGCACAGAATTGT
CTACCTTTCCAGAAAGCATCAGAAAAAGCATCTGAGAAAGCAGCTATGCTCTTTAGGCAGTATGTGCGAGACAATCTCTATGATCGCATC
AGTACCCGTCCATTCTTGAATAACATTGAGAAGCGCTGGATTGCTTTCCAGATCCTGACAGCTGTGGACCAAGCACACAAATCTGGAGTT
CGTCATGGGGACATCAAGACTGAGAATGTGATGGTCACCAGTTGGAATTGGGTTCTTCTAACTGATTTTGCCAGTTTTAAGCCCACTTAT
CTTCCAGAAGACAACCCGGCAGATTTCAATTATTTCTTTGACACATCACGGAGGAGAACTTGCTATATTGCTCCTGAACGTTTTGTTGAT
GGTGGGATGTTTGCCACTGAGTTAGAATATATGAGAGATCCTTCAACTCCGCTTGTAGACTTAAATAGCAATCAGAGAACAAGAGGAGAG
TTGAAGAGAGCAATGGACATCTTTTCAGCAGGTTGTGTGATAGCTGAGCTTTTTACAGAAGGTGTACCATTATTTGATCTCTCTCAACTT
TTGGCTTATAGAAATGGACATTTTTTCCCTGAACAAGTGCTAAATAAAATTGAAGATCACAGTATCAGAGAATTGGTAACTCAGATGATT
CACCGTGAGCCAGATAAACGTTTAGAGGCAGAAGATTACTTAAAACAGCAGCGTGGCAATGCCTTTCCTGAAATATTTTACACTTTTCTT
CAGCCCTACATGGCCCAGTTTGCCAAGGAAACGTTTCTTTCTGCAGATGAGCGTATTCTGGTTATACGGAAGGATTTGGGCAACATTATT
CACAATCTCTGTGGACATGATCTGCCAGAAAAAGCCGAAGGAGAGCCTAAGGAAAATGGGCTGGTTATCTTGGTATCTGTTATAACATCC
TGCCTACAGACCCTTAAATACTGTGATTCCAAACTAGCTGCTTTGGAACTGATTCTTCATTTGGCTCCAAGATTAAGTGTTGAAATCCTT
TTGGATCGTATTACTCCATATCTTTTGCATTTCAGCAATGACTCTGTTCCTAGGGTGAGGGCTGAAGCCTTGAGGACGTTGACCAAAGTT
CTTGCTCTCGTCAAAGAGGTTCCTCGTAATGATATCAATATTTATCCGGAATACATTCTGCCAGGCATAGCCCACTTAGCCCAAGATGAT
GCTACTATCGTTAGACTAGCCTATGCTGAAAACATAGCTCTGCTGGCAGAAACAGCTCTGAGATTCCTGGAATTAGTACAGTTAAAAAAT
CTTAATATGGAAAATGACCCCAATAATGAAGAAATAGATGAGGTTACACATCCAAATGGAAATTATGACACAGAGCTCCAAGCCTTACAT
GAAATGGTCCAGCAGAAAGTTGTTACTTTGCTAAGTGACCCTGAAAATATTGTAAAACAAACCTTGATGGAAAATGGAATAACACGGCTG
TGTGTATTCTTTGGACGTCAGAAAGCCAACGATGTTTTGTTGTCCCACATGATTACTTTCCTAAATGATAAGAATGATTGGCATCTACGT
GGAGCATTTTTTGATAGTATAGTTGGTAAGGAAGAGCTGCAGGAAGATGGTGCTAAGATGTTGTATGCAGAGTTCCAAAGAGTGAAGGCG
CAGACACGGCTGGGCACAAGACTGGACTTAGACACAGCTCACATCTTCTGTCAGTGGCAGTCCTGTCTCCAGATGGGGATGTATCTCAAC
CAGCTGCTGTCCACTCCTCTCCCAGAGCCAGACCTAACTCGACTGTACAGTGGAAGCCTGGTGCACGGACTATGCCAGCAACTGCTAGCA
TCGACCTCTGTAGAAAGTCTCCTGAGCATATGTCCTGAGGCTAAGCAACTTTATGAATATCTATTCAATGCCACAAGGTCATATGCCCCC
GCTGAAATATTCCTACCAAAAGGTAGATCAAATTCAAAAAAAAAAAGGCAGAAGAAACAGAATACCAGCTGTTCTAAGAACAGAGGGAGA
ACCACTGCACACACCAAGTGTTGGTATGAGGGAAACAACCGGTTTGGGTTGTTAATGGTTGAAAACTTAGAGGAACATAGTGAGGCCTCC
AACATTGAATAAAACTCAGTTTGCATCAAACTAGATGTATTTAATATAATCCTTACTTAAAATTCTTCCGTTACCACCCTTGAAACAATT
AGCTTTTTCTTTAGGACTGACCTGTTAGGGGATAAACATCACAATAATCTGAATTCCAAGTTATTTTGTATTTTGTTTTTAATAAATACA


Top

FusionGenePPI for PIK3R4_ASTE1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIK3R4BECN1, ATG14, MAP1LC3C, PIK3C3, UVRAG, YWHAB, KRIT1, YWHAE, KIAA0226, MOV10, NXF1, NRBF2, JADE2, NTRK1, XPO1, XRCC3, FGFR1OP, PARD6A, SNW1, DVL2, KIAA0226LASTE1HECW2, XRCC4, CDC42, CDK2, MYH11, KIF20B, ZWINT, GOLT1B, GAR1, TMEM248, NABP1, USP47, EPS8L2, ZNF692


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIK3R4_ASTE1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIK3R4_ASTE1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource