FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27206

FusionGeneSummary for PIK3R1_NDUFB7

check button Fusion gene summary
Fusion gene informationFusion gene name: PIK3R1_NDUFB7
Fusion gene ID: 27206
HgeneTgene
Gene symbol

PIK3R1

NDUFB7

Gene ID

5295

4713

Gene namephosphoinositide-3-kinase regulatory subunit 1NADH:ubiquinone oxidoreductase subunit B7
SynonymsAGM7|GRB1|IMD36|p85|p85-ALPHAB18|CI-B18
Cytomap

5q13.1

19p13.12

Type of geneprotein-codingprotein-coding
Descriptionphosphatidylinositol 3-kinase regulatory subunit alphaPI3-kinase subunit p85-alphaPI3K regulatory subunit alphaphosphatidylinositol 3-kinase 85 kDa regulatory subunit alphaphosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha)phNADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDaNADH-ubiquinone oxidoreductase B18 subunitcell adhesion protein SQM1complex I B18 subunitcomplex I-B18
Modification date2018052320180522
UniProtAcc

P27986

P17568

Ensembl transtripts involved in fusion geneENST00000521381, ENST00000521657, 
ENST00000517643, ENST00000274335, 
ENST00000396611, ENST00000320694, 
ENST00000336483, ENST00000523872, 
ENST00000215565, 
Fusion gene scores* DoF score5 X 3 X 5=754 X 2 X 4=32
# samples 54
** MAII scorelog2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PIK3R1 [Title/Abstract] AND NDUFB7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIK3R1

GO:0014065

phosphatidylinositol 3-kinase signaling

7782332

HgenePIK3R1

GO:0034976

response to endoplasmic reticulum stress

20348923

HgenePIK3R1

GO:0042307

positive regulation of protein import into nucleus

20348923

HgenePIK3R1

GO:0048009

insulin-like growth factor receptor signaling pathway

7782332

HgenePIK3R1

GO:0050821

protein stabilization

20348923

HgenePIK3R1

GO:0060396

growth hormone receptor signaling pathway

7782332


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-B6-A1KF-01APIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000521381ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
In-frameENST00000521657ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
intron-3CDSENST00000517643ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
In-frameENST00000274335ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
In-frameENST00000396611ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
intron-3CDSENST00000320694ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
intron-3CDSENST00000336483ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-
intron-3CDSENST00000523872ENST00000215565PIK3R1chr5

67576834

+NDUFB7chr19

14677745

-

Top

FusionProtFeatures for PIK3R1_NDUFB7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIK3R1

P27986

NDUFB7

P17568

Accessory subunit of the mitochondrial membranerespiratory chain NADH dehydrogenase (Complex I), that is believednot to be involved in catalysis. Complex I functions in thetransfer of electrons from NADH to the respiratory chain. Theimmediate electron acceptor for the enzyme is believed to beubiquinone. {ECO:0000269|PubMed:27626371}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIK3R1chr5:67576834chr19:14677745ENST00000274335+615113_301305725DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000274335+6153_79305725DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000396611+615113_301305733DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000396611+6153_79305733DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521381+716113_301305725DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521381+7163_79305725DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521657+716113_301305725DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521657+7163_79305725DomainSH3
TgeneNDUFB7chr5:67576834chr19:14677745ENST00000215565-0356_9837138DomainCHCH
TgeneNDUFB7chr5:67576834chr19:14677745ENST00000215565-0359_6937138MotifCx9C motif 1
TgeneNDUFB7chr5:67576834chr19:14677745ENST00000215565-0380_9037138MotifCx9C motif 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIK3R1chr5:67576834chr19:14677745ENST00000274335+615333_428305725DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000274335+615624_718305725DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000320694+110113_301-123425DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000320694+110333_428-123425DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000320694+1103_79-123425DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000320694+110624_718-123425DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000336483+110113_301-31455DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000336483+110333_428-31455DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000336483+1103_79-31455DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000336483+110624_718-31455DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000396611+615333_428305733DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000396611+615624_718305733DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521381+716333_428305725DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521381+716624_718305725DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521657+716333_428305725DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000521657+716624_718305725DomainSH2 2
HgenePIK3R1chr5:67576834chr19:14677745ENST00000523872+19113_301-78362DomainRho-GAP
HgenePIK3R1chr5:67576834chr19:14677745ENST00000523872+19333_428-78362DomainSH2 1
HgenePIK3R1chr5:67576834chr19:14677745ENST00000523872+193_79-78362DomainSH3
HgenePIK3R1chr5:67576834chr19:14677745ENST00000523872+19624_718-78362DomainSH2 2


Top

FusionGeneSequence for PIK3R1_NDUFB7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIK3R1_ENST00000521381_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_406aa
MSAEGYQYRALTDTKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGTNETTGERGDFPGTYVETIGRKKISPPTPKPR
PPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRTLLDLPNPVIPAAVYSEMISLAPEVQSSEETIQLLKKLIRSPSIPHQTWLTLQTLLKHFFKLSQTSSKNLLNARVLSEIFSP
MLFRFSAASSDNTENLIKVIEILISTEWNERQPAPEMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEH

>In-frame_PIK3R1_ENST00000521657_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_406aa
MSAEGYQYRALTDTKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGTNETTGERGDFPGTYVETIGRKKISPPTPKPR
PPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRTLLDLPNPVIPAAVYSEMISLAPEVQSSEETIQLLKKLIRSPSIPHQTWLTLQTLLKHFFKLSQTSSKNLLNARVLSEIFSP
MLFRFSAASSDNTENLIKVIEILISTEWNERQPAPEMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEH

>In-frame_PIK3R1_ENST00000274335_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_406aa
MSAEGYQYRALTDTKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGTNETTGERGDFPGTYVETIGRKKISPPTPKPR
PPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRTLLDLPNPVIPAAVYSEMISLAPEVQSSEETIQLLKKLIRSPSIPHQTWLTLQTLLKHFFKLSQTSSKNLLNARVLSEIFSP
MLFRFSAASSDNTENLIKVIEILISTEWNERQPAPEMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEH

>In-frame_PIK3R1_ENST00000396611_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_406aa
MSAEGYQYRALTDTKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGTNETTGERGDFPGTYVETIGRKKISPPTPKPR
PPRPLPVAPGSSKTEADVEQQALTLPDLAEQFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSNLAELRQLLDCDTPSVDLEMIDVH
VLADAFKRTLLDLPNPVIPAAVYSEMISLAPEVQSSEETIQLLKKLIRSPSIPHQTWLTLQTLLKHFFKLSQTSSKNLLNARVLSEIFSP
MLFRFSAASSDNTENLIKVIEILISTEWNERQPAPEMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIK3R1_ENST00000521381_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1218nt
ATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTG
ACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAAT
GAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGG
CCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAG
CAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATAC
AGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCAC
GTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCT
CCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTT
CAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCT
ATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAA
CGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCAC
CTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCAC
CGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTG

>In-frame_PIK3R1_ENST00000521657_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1218nt
ATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTG
ACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAAT
GAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGG
CCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAG
CAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATAC
AGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCAC
GTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCT
CCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTT
CAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCT
ATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAA
CGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCAC
CTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCAC
CGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTG

>In-frame_PIK3R1_ENST00000274335_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1218nt
ATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTG
ACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAAT
GAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGG
CCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAG
CAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATAC
AGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCAC
GTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCT
CCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTT
CAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCT
ATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAA
CGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCAC
CTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCAC
CGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTG

>In-frame_PIK3R1_ENST00000396611_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1218nt
ATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTG
ACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAAT
GAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGG
CCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAG
CAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATAC
AGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCAC
GTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCT
CCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTT
CAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCT
ATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAA
CGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCAC
CTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCAC
CGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIK3R1_ENST00000521381_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1889nt
GCGCCGGGCGCTGGAGCTGCGGGCGCACGGAGAGGAGTCGCCAGCAGCTGGAGCGGAGTTGGAGGAAGCAGCGGCAGCGGCGAGGGCGGC
AGGCTAGCTGTCGGAGACGGCAAGCACGGATCGGGCACGGCCGGCGGGTCGCAGCCGGGCTGGAGGCCGGTCGGAACCGAGCGGGCAGGA
GGCCACCGCTGCAGCGCGGGCCCCGCAGAGGAAGGAAGCCGGCGGGCGGGGTGAAGCTCGTGTGTGGAGTGCCACGGTACAATCAGACGA
CAGATGGACAGTGTGACAAAAGTGTCAGAAAGGATTGGGCCTCGCTGTGAGAGTCAGCCTGGATTCAAAGTGTTGACAAGTTGCTGAAAA
GGAAGCCAGTGAGAGGACTGTGGCACGCAGAGGAAGTGGAGCCCTGTCTTCGGTCACACCATTGATGGAGGACAGATGGACAGCCGTATG
GCCAGTCACCTCTCCTCTTAAACCTTTGGAGAGTGGTCCTTTGTCCTCTGCTGGACACATAATAGGAATTCTAACACATTCTCTGAATTC
ACTTTTCATAAAAACGTAAAATCAGACTGCTCTGTACAACCAGGCTCAACTGTTGCATGGTAGCAGATTTGCAAACATGAGTGCTGAGGG
GTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTGACTGTGAATAAAGG
GTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAATGAAACCACAGGGGA
AAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGGCCACCTCGGCCTCT
TCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAGCAGTTTGCCCCTCC
TGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATACAGAACACAGAGCTC
CAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCACGTTTTGGCTGACGC
TTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCTCCAGAAGTACAAAG
CTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTTCAGTATTTGTTAAA
ACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCTATGCTTTTCAGATT
CTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAACGACAGCCTGCACC
AGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCACCTCATCCGGCTGCT
CAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCACCGCGACTATGTGAT
GCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTGGCCAAAGGCCAGGG

>In-frame_PIK3R1_ENST00000521657_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1837nt
AGTTGGAGGAAGCAGCGGCAGCGGCGAGGGCGGCAGGCTAGCTGTCGGAGACGGCAAGCACGGATCGGGCACGGCCGGCGGGTCGCAGCC
GGGCTGGAGGCCGGTCGGAACCGAGCGGGCAGGAGGCCACCGCTGCAGCGCGGGCCCCGCAGAGGAAGGAAGCCGGCGGGCGGGGTAGGT
GAAGCTCGTGTGTGGAGTGCCACGGTACAATCAGACGACAGATGGACAGTGTGACAAAAGTGTCAGAAAGGATTGGGCCTCGCTGTGAGA
GTCAGCCTGGATTCAAAGTGTTGACAAGTTGCTGAAAAGGAAGCCAGTGAGAGGACTGTGGCACGCAGAGGAAGTGGAGCCCTGTCTTCG
GTCACACCATTGATGGAGGACAGATGGACAGCCGTATGGCCAGTCACCTCTCCTCTTAAACCTTTGGAGAGTGGTCCTTTGTCCTCTGCT
GGACACATAATAGGAATTCTAACACATTCTCTGAATTCACTTTTCATAAAAACGTAAAATCAGACTGCTCTGTACAACCAGGCTCAACTG
TTGCATGGTAGCAGATTTGCAAACATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAGGAAAGAGAAGAAGATATT
GACTTGCACTTGGGTGACATATTGACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAGGAAGCCAGGCCTGAAGAA
ATTGGCTGGTTAAATGGCTATAATGAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATATATTGGAAGGAAAAAAATC
TCGCCTCCCACACCAAAGCCCCGGCCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCAGATGTTGAACAACAAGCT
TTGACTCTCCCGGATCTTGCAGAGCAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTGGAAGCCATTGAAAAGAAA
GGTCTGGAATGTTCAACTCTATACAGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGATTGTGATACACCCTCCGTG
GACTTGGAAATGATCGATGTGCACGTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCTGTCATTCCAGCAGCCGTT
TACAGTGAAATGATTTCTTTAGCTCCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTTATTAGGTCGCCTAGCATA
CCTCATCAGTATTGGCTTACGCTTCAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAAAATCTGTTGAATGCAAGA
GTACTCTCTGAAATTTTCAGCCCTATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTCATAAAAGTTATAGAAATT
TTAATCTCAACTGAATGGAATGAACGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGACGCGCAGCTGAGGCTCCAG
CTGCGGGACTACTGCGCCCACCACCTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTGGCCTGCAAGCAGGAGCGG
CACGACTGGGACTACTGCGAGCACCGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTGCTCCAGCGGAAGAAGCGG
CGGGAGAAGAAGGCGGCAGAGTTGGCCAAAGGCCAGGGACCCGGGGAAGTGGACCCCAAGGTGGCCCTGTAGGGGGTGCACCCCCCACCC

>In-frame_PIK3R1_ENST00000274335_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1315nt
TACAACCAGGCTCAACTGTTGCATGGTAGCAGATTTGCAAACATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAG
GAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTGACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAG
GAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAATGAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATAT
ATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGGCCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCA
GATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAGCAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTG
GAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATACAGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGAT
TGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCACGTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCT
GTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCTCCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTT
ATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTTCAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAA
AATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCTATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTC
ATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAACGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGAC
GCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCACCTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTG
GCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCACCGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTG
CTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTGGCCAAAGGCCAGGGACCCGGGGAAGTGGACCCCAAGGTGGCCCTGTAG

>In-frame_PIK3R1_ENST00000396611_chr5_67576834_+_NDUFB7_ENST00000215565_chr19_14677745_-_1315nt
TACAACCAGGCTCAACTGTTGCATGGTAGCAGATTTGCAAACATGAGTGCTGAGGGGTACCAGTACAGAGCGCTGTATGATTATAAAAAG
GAAAGAGAAGAAGATATTGACTTGCACTTGGGTGACATATTGACTGTGAATAAAGGGTCCTTAGTAGCTCTTGGATTCAGTGATGGACAG
GAAGCCAGGCCTGAAGAAATTGGCTGGTTAAATGGCTATAATGAAACCACAGGGGAAAGGGGGGACTTTCCGGGAACTTACGTAGAATAT
ATTGGAAGGAAAAAAATCTCGCCTCCCACACCAAAGCCCCGGCCACCTCGGCCTCTTCCTGTTGCACCAGGTTCTTCGAAAACTGAAGCA
GATGTTGAACAACAAGCTTTGACTCTCCCGGATCTTGCAGAGCAGTTTGCCCCTCCTGACATTGCCCCGCCTCTTCTTATCAAGCTCGTG
GAAGCCATTGAAAAGAAAGGTCTGGAATGTTCAACTCTATACAGAACACAGAGCTCCAGCAACCTGGCAGAATTACGACAGCTTCTTGAT
TGTGATACACCCTCCGTGGACTTGGAAATGATCGATGTGCACGTTTTGGCTGACGCTTTCAAACGCTATCTCCTGGACTTACCAAATCCT
GTCATTCCAGCAGCCGTTTACAGTGAAATGATTTCTTTAGCTCCAGAAGTACAAAGCTCCGAAGAATATATTCAGCTATTGAAGAAGCTT
ATTAGGTCGCCTAGCATACCTCATCAGTATTGGCTTACGCTTCAGTATTTGTTAAAACATTTCTTCAAGCTCTCTCAAACCTCCAGCAAA
AATCTGTTGAATGCAAGAGTACTCTCTGAAATTTTCAGCCCTATGCTTTTCAGATTCTCAGCAGCCAGCTCTGATAATACTGAAAACCTC
ATAAAAGTTATAGAAATTTTAATCTCAACTGAATGGAATGAACGACAGCCTGCACCAGAGATGGTGGCCACACAGCAGGAGATGATGGAC
GCGCAGCTGAGGCTCCAGCTGCGGGACTACTGCGCCCACCACCTCATCCGGCTGCTCAAGTGCAAGCGTGACAGCTTCCCCAACTTCCTG
GCCTGCAAGCAGGAGCGGCACGACTGGGACTACTGCGAGCACCGCGACTATGTGATGCGCATGAAGGAGTTTGAGCGGGAGCGGAGGCTG
CTCCAGCGGAAGAAGCGGCGGGAGAAGAAGGCGGCAGAGTTGGCCAAAGGCCAGGGACCCGGGGAAGTGGACCCCAAGGTGGCCCTGTAG


Top

FusionGenePPI for PIK3R1_NDUFB7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIK3R1LCP2, CTNNB1, SRC, ABL1, FYN, LCK, PIK3R1, SHC1, GNAQ, WAS, IRS2, FCGR2A, VAV1, GAB1, IRS1, PIK3CA, RRAS2, KIT, AXL, DOK1, EPOR, KHDRBS1, CBLB, IL1R1, EZR, BCAR1, CD28, LAT, PIK3CD, GRB2, ERBB3, PTPN6, CD3E, EPHA2, ARHGAP17, ARAF, IFNAR1, TYRO3, ARHGAP32, CSF2RA, NFKBIA, GAB2, TUBA1B, TGFBR1, TGFBR2, HRAS, PTK2, AGAP2, PECAM1, CBL, CRKL, CD7, ARHGAP1, FES, SH3KBP1, PTPN11, INPP5D, PIK3CB, ADAM12, IL6ST, HCST, ESR1, SHB, NTRK2, SYN1, PDGFRB, LTK, FGFR2, NPM1, SOCS6, PXK, YWHAG, EGFR, ADAMTS2, CXCL2, CYP4A11, TTR, HDAC3, ITSN1, SYNM, RAB5A, ERBB2, CRK, NCK1, CSF1R, SYK, ZAP70, FLT3, PDGFRA, CUL3, GRB10, BRCA1, JAK2, ALK, SELPLG, TNIP1, CMIP, INPPL1, PIK3R2, EP300, HTT, MED28, ABI1, APPL1, TNFRSF1A, FBXL2, TLR3, DAB2IP, MAP3K5, DLX2, GSPT1, HOXA1, CCL14, CD40, ALOX5, EPN1, IRS4, NCL, ZDHHC17, SQSTM1, SIRT1, EFNB2, CD244, VSIG4, PRMT2, PTGER3, PCBP1, NTRK1, CLNK, SH2D2A, SOCS1, STAT3, TNS4, FER, PDE4D, TMEM17, CHAF1A, NYAP2, FASLG, FGFR1, IGF1R, PLCG2, SOS1, PXN, RXRA, FLT1, RASD2, DNM2, CD247, KBTBD2, WEE1, VHL, MAPT, AKT1, GNB1, ACTA1, BCR, PTPRK, FLRT1, PIK3R3, DEFA5, RNF19B, SNX32, NLGN3, HAVCR2, IL20RA, PROM1, NYAP1, MYO16, FAS, NISCH, PTTG1, WDR26NDUFB7NDUFA2, NDUFB10, UQCRQ, MPV17, TOMM7, CD55, ZMPSTE24, HSPA1L, LAMTOR3, ICT1, CAPN1, MAK, CKAP4, MLKL, NDUFA8, ATP5F1, ATP6V0D1, COX4I1, NDUFA10, ATP1B3, VDAC3, NDUFB9, PHB2, UQCRC2, NDUFA12, NDUFS3, NDUFS5, NDUFA9, RAB5C, RAB7A, GOLT1B, MMGT1, NDUFA4, NDUFB11, NDUFS6, NDUFB5, NDUFS7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIK3R1_NDUFB7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePIK3R1P27986DB01064IsoprenalinePhosphatidylinositol 3-kinase regulatory subunit alphasmall moleculeapproved|investigational

Top

RelatedDiseases for PIK3R1_NDUFB7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIK3R1C0001973Alcoholic Intoxication, Chronic2PSYGENET
HgenePIK3R1C0878684SHORT syndrome2ORPHANET;UNIPROT
HgenePIK3R1C0006413Burkitt Lymphoma1CTD_human
HgenePIK3R1C0021655Insulin Resistance1CTD_human
HgenePIK3R1C0024667Animal Mammary Neoplasms1CTD_human
HgenePIK3R1C0024668Mammary Neoplasms, Experimental1CTD_human
TgeneNDUFB7C0019202Hepatolenticular Degeneration1CTD_human