FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27140

FusionGeneSummary for PIGN_CTNNA2

check button Fusion gene summary
Fusion gene informationFusion gene name: PIGN_CTNNA2
Fusion gene ID: 27140
HgeneTgene
Gene symbol

PIGN

CTNNA2

Gene ID

23556

1496

Gene namephosphatidylinositol glycan anchor biosynthesis class Ncatenin alpha 2
SynonymsMCAHS|MCAHS1|MCD4|MDC4|PIG-NCAP-R|CAPR|CT114|CTNR
Cytomap

18q21.33

2p12

Type of geneprotein-codingprotein-coding
DescriptionGPI ethanolamine phosphate transferase 1MCD4 homologphosphatidylinositol-glycan biosynthesis class N proteincatenin alpha-2alpha-N-cateninalpha-catenin-related proteincadherin-associated protein, relatedcancer/testis antigen 114catenin (cadherin-associated protein), alpha 2
Modification date2018052320180522
UniProtAcc

O95427

P26232

Ensembl transtripts involved in fusion geneENST00000357637, ENST00000400334, 
ENST00000593225, 
ENST00000466387, 
ENST00000496558, ENST00000361291, 
ENST00000402739, ENST00000540488, 
ENST00000541047, ENST00000343114, 
ENST00000496251, ENST00000409266, 
Fusion gene scores* DoF score4 X 4 X 3=4815 X 12 X 9=1620
# samples 415
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/1620*10)=-3.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PIGN [Title/Abstract] AND CTNNA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E9-A1N9-01APIGNchr18

59763081

-CTNNA2chr2

80874710

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000357637ENST00000466387PIGNchr18

59763081

-CTNNA2chr2

80874710

+
In-frameENST00000357637ENST00000496558PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000357637ENST00000361291PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000357637ENST00000402739PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000357637ENST00000540488PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000357637ENST00000541047PIGNchr18

59763081

-CTNNA2chr2

80874710

+
In-frameENST00000357637ENST00000343114PIGNchr18

59763081

-CTNNA2chr2

80874710

+
5CDS-intronENST00000357637ENST00000496251PIGNchr18

59763081

-CTNNA2chr2

80874710

+
5CDS-intronENST00000357637ENST00000409266PIGNchr18

59763081

-CTNNA2chr2

80874710

+
In-frameENST00000400334ENST00000466387PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000400334ENST00000496558PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000400334ENST00000361291PIGNchr18

59763081

-CTNNA2chr2

80874710

+
In-frameENST00000400334ENST00000402739PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000400334ENST00000540488PIGNchr18

59763081

-CTNNA2chr2

80874710

+
In-frameENST00000400334ENST00000541047PIGNchr18

59763081

-CTNNA2chr2

80874710

+
Frame-shitENST00000400334ENST00000343114PIGNchr18

59763081

-CTNNA2chr2

80874710

+
5CDS-intronENST00000400334ENST00000496251PIGNchr18

59763081

-CTNNA2chr2

80874710

+
5CDS-intronENST00000400334ENST00000409266PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000466387PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000496558PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000361291PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000402739PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000540488PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000541047PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-3CDSENST00000593225ENST00000343114PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-intronENST00000593225ENST00000496251PIGNchr18

59763081

-CTNNA2chr2

80874710

+
intron-intronENST00000593225ENST00000409266PIGNchr18

59763081

-CTNNA2chr2

80874710

+

Top

FusionProtFeatures for PIGN_CTNNA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIGN

O95427

CTNNA2

P26232

Ethanolamine phosphate transferase involved inglycosylphosphatidylinositol-anchor biosynthesis. Transfersethanolamine phosphate to the first alpha-1,4-linked mannose ofthe glycosylphosphatidylinositol precursor of GPI-anchor (Bysimilarity). May act as suppressor of replication stress andchromosome missegregation. {ECO:0000250,ECO:0000269|PubMed:23446422}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PIGN_CTNNA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000496558_chr2_80874710_+_822aa
MLLFFTLGLLIHFVFFASIFDITFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALYELDENGNSRAPFIRNIIMHEGSWGISHTRV
PTESRPGHVALIAGFTEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVTTTSTDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKEIVSMFNHFTGNDGKTTFIFTSDHGMTDWGS
HGAGHPSETLTPLVTWGAGIKTPQRVSAQQFDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDTLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSTIKHRKFDEVVSLCKELIHLALKGLSTTHTTDRFFLGVNVVIG
FVGWISTASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTTTVTGLLPLPIWTAVLREFQVIQDLVVSVLTTP
LSHFVGYLLAFTLGIEVLVLSFFYRTMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLL
SLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMTVVTSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGWTVPHRLSRQLKT__MLLSSR_KHPMWPQPNTRRSMGQQLSTHLLCLGR_RLQRRSPL_REKSLKNSRHEFDEVLRRNTFRLY

>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000343114_chr2_80874710_+_822aa
MLLFFTLGLLIHFVFFASIFDITFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALYELDENGNSRAPFIRNIIMHEGSWGISHTRV
PTESRPGHVALIAGFTEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVTTTSTDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKEIVSMFNHFTGNDGKTTFIFTSDHGMTDWGS
HGAGHPSETLTPLVTWGAGIKTPQRVSAQQFDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDTLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSTIKHRKFDEVVSLCKELIHLALKGLSTTHTTDRFFLGVNVVIG
FVGWISTASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTTTVTGLLPLPIWTAVLREFQVIQDLVVSVLTTP
LSHFVGYLLAFTLGIEVLVLSFFYRTMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLL
SLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMTVVTSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGWTVPHRLSRQLKT__MLLSSR_KHPMWPQPNTRRSMGQQLSTHLLCLGR_RLQRRSPL_REKSLKNSRHEFDEVLRRNTFRLY

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000466387_chr2_80874710_+_822aa
MLLFFTLGLLIHFVFFASIFDITFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALYELDENGNSRAPFIRNIIMHEGSWGISHTRV
PTESRPGHVALIAGFTEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVTTTSTDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKEIVSMFNHFTGNDGKTTFIFTSDHGMTDWGS
HGAGHPSETLTPLVTWGAGIKTPQRVSAQQFDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDTLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSTIKHRKFDEVVSLCKELIHLALKGLSTTHTTDRFFLGVNVVIG
FVGWISTASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTTTVTGLLPLPIWTAVLREFQVIQDLVVSVLTTP
LSHFVGYLLAFTLGIEVLVLSFFYRTMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLL
SLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMTVVTSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGWTVPHRLSRQLKT__MLLSSR_KHPMWPQPNTRRSMGQQLSTHLLCLGR_RLQRRSPL_REKSLKNSRHEFDEVLRRNTFRLY

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000402739_chr2_80874710_+_822aa
MLLFFTLGLLIHFVFFASIFDITFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALYELDENGNSRAPFIRNIIMHEGSWGISHTRV
PTESRPGHVALIAGFTEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVTTTSTDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKEIVSMFNHFTGNDGKTTFIFTSDHGMTDWGS
HGAGHPSETLTPLVTWGAGIKTPQRVSAQQFDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDTLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSTIKHRKFDEVVSLCKELIHLALKGLSTTHTTDRFFLGVNVVIG
FVGWISTASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTTTVTGLLPLPIWTAVLREFQVIQDLVVSVLTTP
LSHFVGYLLAFTLGIEVLVLSFFYRTMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLL
SLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMTVVTSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGWTVPHRLSRQLKT__MLLSSR_KHPMWPQPNTRRSMGQQLSTHLLCLGR_RLQRRSPL_REKSLKNSRHEFDEVLRRNTFRLY

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000541047_chr2_80874710_+_822aa
MLLFFTLGLLIHFVFFASIFDITFTSPLVHGMTPQFTPLPPPARRLVLFVADGLRADALYELDENGNSRAPFIRNIIMHEGSWGISHTRV
PTESRPGHVALIAGFTEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVTTTSTDAKREDFGAQDATKLDTWVFD
NVKDFFHHARNNQSLFSKINEEKIVFFLHLLGIDTNGHAHRPSSRDYKHNIKKVDDGVKEIVSMFNHFTGNDGKTTFIFTSDHGMTDWGS
HGAGHPSETLTPLVTWGAGIKTPQRVSAQQFDDAFLKEWRLENWKRLDVNQADIAPLMTSLIGVPFPLNSVGILPVDTLNNTDLFKAESM
FTNAVQILEQFKVKMTQKKEVTLPFLFTPFKLLSDSKQFNILRKARSTIKHRKFDEVVSLCKELIHLALKGLSTTHTTDRFFLGVNVVIG
FVGWISTASLLIIKSHSNLIKGVSKEVKKPSHLLPCSFVAIGILVAFFLLIQACPWTTTVTGLLPLPIWTAVLREFQVIQDLVVSVLTTP
LSHFVGYLLAFTLGIEVLVLSFFYRTMLTAGLTAFAAWPFLTRLWTRAKMTSLSWTFFSLLLAVFPLMPVVGRKPDISLVMGAGLLVLLL
SLCVVTSLMKRKDSFIKEELLVHLLQVLSTVLSMTVVTSTQSSLLRKQGLPLMNQIISWATLASSLVVPLLSSPVLFQRLFSILLSLMST
YLLLSTGWTVPHRLSRQLKT__MLLSSR_KHPMWPQPNTRRSMGQQLSTHLLCLGR_RLQRRSPL_REKSLKNSRHEFDEVLRRNTFRLY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000496558_chr2_80874710_+_2468nt
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCAT
GGAATGACTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTG
CCAACAGAATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGT
GGAGACCACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTA
TTAGGAATAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCC
CATGGGGCTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCC
CTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTT
AAACTGCTTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGT
TTTGTGGGATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTA
TATGGTTTGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCT
GGACTTACTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTA
TCCCTGTGTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCA
ACATTAGCCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAG
CATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTAC

>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000343114_chr2_80874710_+_2468nt
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCAT
GGAATGACTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTG
CCAACAGAATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGT
GGAGACCACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTA
TTAGGAATAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCC
CATGGGGCTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCC
CTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTT
AAACTGCTTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGT
TTTGTGGGATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTA
TATGGTTTGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCT
GGACTTACTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTA
TCCCTGTGTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCA
ACATTAGCCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAG
CATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTAC

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000466387_chr2_80874710_+_2468nt
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCAT
GGAATGACTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTG
CCAACAGAATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGT
GGAGACCACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTA
TTAGGAATAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCC
CATGGGGCTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCC
CTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTT
AAACTGCTTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGT
TTTGTGGGATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTA
TATGGTTTGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCT
GGACTTACTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTA
TCCCTGTGTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCA
ACATTAGCCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAG
CATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTAC

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000402739_chr2_80874710_+_2468nt
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCAT
GGAATGACTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTG
CCAACAGAATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGT
GGAGACCACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTA
TTAGGAATAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCC
CATGGGGCTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCC
CTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTT
AAACTGCTTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGT
TTTGTGGGATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTA
TATGGTTTGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCT
GGACTTACTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTA
TCCCTGTGTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCA
ACATTAGCCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAG
CATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTAC

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000541047_chr2_80874710_+_2468nt
ATGCTGCTGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCAT
GGAATGACTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTAC
GAATTAGATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTG
CCAACAGAATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCT
GTAGAGTTTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGT
GGAGACCACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGAT
AATGTTAAGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTA
TTAGGAATAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAA
ATCGTGTCTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCC
CATGGGGCTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAA
TTTGATGATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCC
CTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATG
TTTACAAATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTT
AAACTGCTTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTT
TGCAAGGAGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGT
TTTGTGGGATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCA
AGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTA
TATGGTTTGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCT
CTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCT
GGACTTACTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTG
CTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTA
TCCCTGTGTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACA
GTGCTCTCCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCA
ACATTAGCCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACC
TACCTACTTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAG
CATCCTATGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAG
AGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000496558_chr2_80874710_+_3792nt
AGGTATTGGGGGCGTTCCGGAATTGAGGGGTGGTTGTAGTGGTGGCTTAGGAATACCCTCCCGGCTATCGCTTCAGTGGGTAGAGGGGAC
CACTGCCCGAGAGCTTTAATGGAGCTGGGTCCTGCCTTCGCGCTGAGGAGCCCTCGTTTTCGAGATCAGGCCTGACCGGGATAAGCTCCA
GAAACAGTATTATGTCTCAGTCCTGTGCAAAGTGAGATGAGCTGTAGCCTTTGGAGACCTATAATTTTGAACATAGATGTTCCTTAAAAG
CTAAATCTTTTTGAACAGATGATGATAAACCTGGAAGAGATTCACCAACAATAGCAAATTACACACTGGCTTGGAAAGTACTCCCATGTT
CCGTTTGATCTTGGCAATTTAATGCTGTTCTTGAAGACTAATTAGTTACACTGGATATGCTGCTGTTCTTTACTTTGGGATTGCTTATAC
ATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCATGGAATGACTCCTCAGTTTACACCATTGCCTCCTC
CAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTACGAATTAGATGAAAATGGAAACTCTAGAGCACCGT
TTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTGCCAACAGAATCTCGGCCAGGTCATGTAGCTCTGA
TAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCTGTAGAGTTTGATTCTCTTTTTAATGAAAGTAAAT
ACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACCACGTTTATACATATAGTTATGATGCTA
AAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGATAATGTTAAGGACTTCTTTCATCATGCCAGAAACA
ACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAATAGATACAAACGGACATGCTCATCGAC
CATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAAATCGTGTCTATGTTTAACCACTTCTATGGAAATG
ATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCCCATGGGGCTGGTCATCCTTCAGAGACTTTAACTC
CTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAATTTGATGATGCATTTTTGAAAGAGTGGAGATTGG
AGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCCCTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGG
GAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATGTTTACAAATGCAGTACAGATTCTTGAACAGTTCA
AGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTTAAACTGCTTTCTGATTCCAAACAGTTCAACATTT
TAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTTTGCAAGGAGCTAATTCATCTTGCATTGAAAGGAT
TGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGGGATGGATATCTTATGCCTCTTTGTTGA
TCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCAAGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTG
GCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTATATGGTTTGTTGCCACTGCCAATATGGTATGCGG
TTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCTCTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTA
CCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTACTGCCTTTGCAGCTTGGCCATTTCTCA
CTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTGCTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAG
GTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGTGTGTTGTAACATCTCTCATGAAAAGAA
AAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACAGTGCTCTCCATGTATGTTGTGTATAGCACTCAGA
GTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCAACATTAGCCTCTTCCTTGGTTGTGCCACTACTGA
GTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACCTACCTACTTCTAAGCACAGGCTGGACAGTGCCAC
ATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGT
CTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGA
AGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTT
CTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCA
GCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTA
GCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCAT
TGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTT
GGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAG
CCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGA
AATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCC
CCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTT
TCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACG
TGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACAC

>In-frame_PIGN_ENST00000357637_chr18_59763081_-_CTNNA2_ENST00000343114_chr2_80874710_+_3792nt
AGGTATTGGGGGCGTTCCGGAATTGAGGGGTGGTTGTAGTGGTGGCTTAGGAATACCCTCCCGGCTATCGCTTCAGTGGGTAGAGGGGAC
CACTGCCCGAGAGCTTTAATGGAGCTGGGTCCTGCCTTCGCGCTGAGGAGCCCTCGTTTTCGAGATCAGGCCTGACCGGGATAAGCTCCA
GAAACAGTATTATGTCTCAGTCCTGTGCAAAGTGAGATGAGCTGTAGCCTTTGGAGACCTATAATTTTGAACATAGATGTTCCTTAAAAG
CTAAATCTTTTTGAACAGATGATGATAAACCTGGAAGAGATTCACCAACAATAGCAAATTACACACTGGCTTGGAAAGTACTCCCATGTT
CCGTTTGATCTTGGCAATTTAATGCTGTTCTTGAAGACTAATTAGTTACACTGGATATGCTGCTGTTCTTTACTTTGGGATTGCTTATAC
ATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCATGGAATGACTCCTCAGTTTACACCATTGCCTCCTC
CAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTACGAATTAGATGAAAATGGAAACTCTAGAGCACCGT
TTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTGCCAACAGAATCTCGGCCAGGTCATGTAGCTCTGA
TAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCTGTAGAGTTTGATTCTCTTTTTAATGAAAGTAAAT
ACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACCACGTTTATACATATAGTTATGATGCTA
AAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGATAATGTTAAGGACTTCTTTCATCATGCCAGAAACA
ACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAATAGATACAAACGGACATGCTCATCGAC
CATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAAATCGTGTCTATGTTTAACCACTTCTATGGAAATG
ATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCCCATGGGGCTGGTCATCCTTCAGAGACTTTAACTC
CTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAATTTGATGATGCATTTTTGAAAGAGTGGAGATTGG
AGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCCCTTATTGGAGTTCCCTTTCCTCTTAACTCAGTGG
GAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATGTTTACAAATGCAGTACAGATTCTTGAACAGTTCA
AGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTTAAACTGCTTTCTGATTCCAAACAGTTCAACATTT
TAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTTTGCAAGGAGCTAATTCATCTTGCATTGAAAGGAT
TGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGGGATGGATATCTTATGCCTCTTTGTTGA
TCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCAAGCCATCTCCTGCCTTGTAGTTTTGTAGCTATTG
GCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTATATGGTTTGTTGCCACTGCCAATATGGTATGCGG
TTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCTCTGAGCCATTTTGTTGGGTACCTGTTAGCCTTTA
CCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTACTGCCTTTGCAGCTTGGCCATTTCTCA
CTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTGCTCCTGGCAGTGTTCCCACTGATGCCGGTTGTAG
GTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGTGTGTTGTAACATCTCTCATGAAAAGAA
AAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACAGTGCTCTCCATGTATGTTGTGTATAGCACTCAGA
GTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCAACATTAGCCTCTTCCTTGGTTGTGCCACTACTGA
GTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACCTACCTACTTCTAAGCACAGGCTGGACAGTGCCAC
ATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTATGTGGCCTCAACCAAATACCAGAAGGT
CTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAAGCCCCTTGTGAAGAGAGAAAAGCCTGA
AGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTTAAGTGAATTCAAAGCAATGGATTCCTT
CTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTAATTCCATTTTTGTATGCATACCTGCCA
GCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGATGAGATCAATACTACTGATCCATCTGTA
GCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTCTCATAAAATTGGGCACAGAGTTCGCAT
TGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAACTCTAATGCATGCAAGAATCATTAGGTT
GGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGCTTCTGTTTCAGTGCAAAAATGTACTAG
CCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGATATTATGTCGATTTTTAACTGAGGGGA
AATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTGCCATTACTAGTGATCATGTTTTTTTCC
CCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGAAGCACAATACGGTGACCAATCTTGCTT
TCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGAATATTAGAGGGAAGGAAACTGACAACG
TGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGTATTCACTAACTAACTCAAAATAAACAC

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000466387_chr2_80874710_+_3728nt
AGCAGCGGCCGGGCAGGTATTGGGGGCGTTCCGGAATTGAGGGGTGGTTGTAGTGGTGGCTTAGGAATACCCTCCCGGCTATCGCTTCAG
TGGGTAGAGGGGACCACTGCCCGAGAGCTTTAATGGAGCTGGGTCCTGCCTTCGCGCTGAGGAGCCCTCGTTTTCGAGATCAGGCCTGAC
CGGGATAAGCTCCAGAAACAGTATTATGTCTCAGTCCTGTGCAAAGTGAGATGAGCTGTAGCCTTTGGAGACCTATAATTTTGAACATAG
ATGTTCCTTAAAAGCTAAATCTTTTTGAACAGATGATGATAAACCTGGAAGCTGTTCTTGAAGACTAATTAGTTACACTGGATATGCTGC
TGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCATGGAATGA
CTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTACGAATTAG
ATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTGCCAACAG
AATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCTGTAGAGT
TTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACC
ACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGATAATGTTA
AGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAA
TAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAAATCGTGT
CTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCCCATGGGG
CTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAATTTGATG
ATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCCCTTATTG
GAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATGTTTACAA
ATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTTAAACTGC
TTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTTTGCAAGG
AGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGG
GATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCAAGCCATC
TCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTATATGGTT
TGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCTCTGAGCC
ATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTA
CTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTGCTCCTGG
CAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGT
GTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACAGTGCTCT
CCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCAACATTAG
CCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACCTACCTAC
TTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTA
TGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAA
GCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTT
AAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTA
ATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGAT
GAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTC
TCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAAC
TCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGC
TTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGA
TATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTG
CCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGA
AGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGA
ATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGT

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000402739_chr2_80874710_+_3638nt
AGCAGCGGCCGGGCAGGTATTGGGGGCGTTCCGGAATTGAGGGGTGGTTGTAGTGGTGGCTTAGGAATACCCTCCCGGCTATCGCTTCAG
TGGGTAGAGGGGACCACTGCCCGAGAGCTTTAATGGAGCTGGGTCCTGCCTTCGCGCTGAGGAGCCCTCGTTTTCGAGATCAGGCCTGAC
CGGGATAAGCTCCAGAAACAGTATTATGTCTCAGTCCTGTGCAAAGTGAGATGAGCTGTAGCCTTTGGAGACCTATAATTTTGAACATAG
ATGTTCCTTAAAAGCTAAATCTTTTTGAACAGATGATGATAAACCTGGAAGCTGTTCTTGAAGACTAATTAGTTACACTGGATATGCTGC
TGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCATGGAATGA
CTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTACGAATTAG
ATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTGCCAACAG
AATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCTGTAGAGT
TTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACC
ACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGATAATGTTA
AGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAA
TAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAAATCGTGT
CTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCCCATGGGG
CTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAATTTGATG
ATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCCCTTATTG
GAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATGTTTACAA
ATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTTAAACTGC
TTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTTTGCAAGG
AGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGG
GATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCAAGCCATC
TCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTATATGGTT
TGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCTCTGAGCC
ATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTA
CTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTGCTCCTGG
CAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGT
GTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACAGTGCTCT
CCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCAACATTAG
CCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACCTACCTAC
TTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTA
TGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAA
GCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTT
AAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTA
ATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGAT
GAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTC
TCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAAC
TCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGC
TTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGA
TATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTG
CCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGA
AGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGA

>In-frame_PIGN_ENST00000400334_chr18_59763081_-_CTNNA2_ENST00000541047_chr2_80874710_+_3728nt
AGCAGCGGCCGGGCAGGTATTGGGGGCGTTCCGGAATTGAGGGGTGGTTGTAGTGGTGGCTTAGGAATACCCTCCCGGCTATCGCTTCAG
TGGGTAGAGGGGACCACTGCCCGAGAGCTTTAATGGAGCTGGGTCCTGCCTTCGCGCTGAGGAGCCCTCGTTTTCGAGATCAGGCCTGAC
CGGGATAAGCTCCAGAAACAGTATTATGTCTCAGTCCTGTGCAAAGTGAGATGAGCTGTAGCCTTTGGAGACCTATAATTTTGAACATAG
ATGTTCCTTAAAAGCTAAATCTTTTTGAACAGATGATGATAAACCTGGAAGCTGTTCTTGAAGACTAATTAGTTACACTGGATATGCTGC
TGTTCTTTACTTTGGGATTGCTTATACATTTTGTGTTCTTCGCCTCCATCTTTGACATTTATTTTACATCTCCTTTGGTTCATGGAATGA
CTCCTCAGTTTACACCATTGCCTCCTCCAGCGAGAAGATTAGTGTTGTTTGTTGCTGATGGCCTTCGAGCAGATGCACTTTACGAATTAG
ATGAAAATGGAAACTCTAGAGCACCGTTTATTAGGAATATCATAATGCATGAAGGCAGCTGGGGCATATCTCATACACGTGTGCCAACAG
AATCTCGGCCAGGTCATGTAGCTCTGATAGCTGGGTTTTATGAAGATGTCAGTGCAGTTGCCAAAGGATGGAAGGAAAATCCTGTAGAGT
TTGATTCTCTTTTTAATGAAAGTAAATACACATGGAGCTGGGGAAGCCCAGATATCCTGCCTATGTTTGCCAAAGGTGCTAGTGGAGACC
ACGTTTATACATATAGTTATGATGCTAAAAGAGAGGATTTTGGTGCTCAAGATGCAACAAAACTGGATACGTGGGTTTTTGATAATGTTA
AGGACTTCTTTCATCATGCCAGAAACAACCAGTCTTTGTTTTCTAAAATAAATGAAGAGAAAATAGTTTTTTTCTTACATTTATTAGGAA
TAGATACAAACGGACATGCTCATCGACCATCCTCGAGAGACTACAAGCACAATATTAAAAAAGTTGATGATGGAGTTAAAGAAATCGTGT
CTATGTTTAACCACTTCTATGGAAATGATGGGAAAACAACATTTATCTTTACCTCTGACCATGGAATGACAGACTGGGGTTCCCATGGGG
CTGGTCATCCTTCAGAGACTTTAACTCCTTTAGTCACTTGGGGAGCTGGAATCAAGTATCCCCAAAGAGTATCAGCTCAGCAATTTGATG
ATGCATTTTTGAAAGAGTGGAGATTGGAGAATTGGAAGAGGCTAGATGTCAATCAGGCTGATATTGCACCATTGATGACTTCCCTTATTG
GAGTTCCCTTTCCTCTTAACTCAGTGGGAATCCTTCCTGTGGATTATCTTAACAACACTGATCTCTTCAAAGCAGAGAGCATGTTTACAA
ATGCAGTACAGATTCTTGAACAGTTCAAGGTGAAAATGACTCAGAAGAAAGAAGTTACTTTACCATTTTTGTTTACACCATTTAAACTGC
TTTCTGATTCCAAACAGTTCAACATTTTAAGAAAAGCAAGATCTTATATAAAACACAGAAAGTTTGATGAAGTGGTCTCCCTTTGCAAGG
AGCTAATTCATCTTGCATTGAAAGGATTGTCCTATTATCACACATATGACAGATTCTTTTTGGGCGTCAATGTTGTTATTGGTTTTGTGG
GATGGATATCTTATGCCTCTTTGTTGATCATCAAGTCTCATTCCAACCTTATAAAAGGTGTTAGTAAAGAAGTGAAGAAACCAAGCCATC
TCCTGCCTTGTAGTTTTGTAGCTATTGGCATTTTAGTAGCATTTTTTCTGCTGATTCAAGCCTGTCCCTGGACATATTATGTATATGGTT
TGTTGCCACTGCCAATATGGTATGCGGTTCTAAGAGAATTTCAAGTTATTCAGGACCTTGTTGTATCAGTGTTGACCTATCCTCTGAGCC
ATTTTGTTGGGTACCTGTTAGCCTTTACCCTGGGAATTGAAGTATTAGTTCTCAGTTTTTTCTACCGCTATATGCTTACCGCTGGACTTA
CTGCCTTTGCAGCTTGGCCATTTCTCACTCGGCTGTGGACTCGAGCAAAGATGACCTCACTGAGTTGGACTTTCTTCTCTTTGCTCCTGG
CAGTGTTCCCACTGATGCCGGTTGTAGGTCGAAAGCCAGACATCTCTCTAGTGATGGGTGCAGGCTTGCTGGTTCTTCTGTTATCCCTGT
GTGTTGTAACATCTCTCATGAAAAGAAAAGATAGCTTTATAAAGGAAGAGCTATTGGTACATCTGTTACAGGTGCTGAGCACAGTGCTCT
CCATGTATGTTGTGTATAGCACTCAGAGTAGTCTACTCAGGAAGCAAGGACTGCCTCTCATGAATCAAATTATTAGCTGGGCAACATTAG
CCTCTTCCTTGGTTGTGCCACTACTGAGTTCTCCAGTTCTCTTTCAGCGATTGTTCAGCATACTTCTTTCATTGATGTCAACCTACCTAC
TTCTAAGCACAGGCTGGACAGTGCCACATCGCTTATCCAGGCAGCTAAAAACCTGATGAATGCTGTTGTCCTCACGGTGAAAGCATCCTA
TGTGGCCTCAACCAAATACCAGAAGGTCTATGGGACAGCAGCTGTCAACTCACCTGTTGTGTCTTGGAAGATGAAGGCTCCAGAGAAGAA
GCCCCTTGTGAAGAGAGAAAAGCCTGAAGAATTCCAGACACGAGTTCGACGAGGTTCTCAGAAGAAACACATTTCGCCTGTACAGGCTTT
AAGTGAATTCAAAGCAATGGATTCCTTCTAGGACGATAGGTTTTAACAAGAAAGCTTTTTCTTTCTTTTCTTTCTTTCTTTTTCTTTTTA
ATTCCATTTTTGTATGCATACCTGCCAGCTCGTATGCCTCTGGCATGGGGAAATTAAGGGAACAGTGTCTGTTTGCATGTAAGATGAGAT
GAGATCAATACTACTGATCCATCTGTAGCCTGGGAAGGAGACAGGACATTCCTGTACTAAGGTGGCACAGAGCTGTCCTTTGCAACATTC
TCATAAAATTGGGCACAGAGTTCGCATTGGCGCAATATTTATGGGAGTGGGAGGGATGGGGAAAATAAACTTAACTCTACAAAAGCAAAC
TCTAATGCATGCAAGAATCATTAGGTTGGCAGGTATATGCATAAGTGAAAAATCTGGAAGTGTAATGGTAGAACATAAAACTTGTATTGC
TTCTGTTTCAGTGCAAAAATGTACTAGCCAATACGCTTAAGTGTGTGGCCCATGAATTGAACAATTTAACCTTGAAGTCTATATCCGTGA
TATTATGTCGATTTTTAACTGAGGGGAAATTAACTAGTCCAGCCTAAAATGCTTCTTTTAATCTGCATTCTGTTTCCTCTTCTAGTTGTG
CCATTACTAGTGATCATGTTTTTTTCCCCCCTTTAATGAAAACAATAAACATCTATTTGAGACAATTAAAATCCTTCTGGGGGCACTGGA
AGCACAATACGGTGACCAATCTTGCTTTCATTTTTTTTTCTTTTTAATTTGAACCATGATTTTGCTAGAAATAGAAGGCCCAGTGGTGGA
ATATTAGAGGGAAGGAAACTGACAACGTGTGAAAGTTAGAGGCAAATACATAGGTGTAGCTTGGAGTGCTGGTATCTAATATACCATTGT


Top

FusionGenePPI for PIGN_CTNNA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIGNUNC93B1, ELAVL1, FJX1, SHMT2, MOV10, NXF1, TXNDC15, PTEN, SPPL2B, YIPF3, ATP2B2, VIPR2, GPR21, TMEM63A, PTGIR, FPR2CTNNA2PAN2, PPP2R1A, FBXW11, CD27, UTP3, SAPCD1, CTNNB1, JUP, NTRK1, SDHAF2, GAN, MCM2, EGFR, CDH1, CDH8, CDH5, CTNNBIP1, DUSP22, FBXL5, CIR1, G3BP1, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIGN_CTNNA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIGN_CTNNA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIGNC3279775MULTIPLE CONGENITAL ANOMALIES-HYPOTONIA-SEIZURES SYNDROME 11ORPHANET;UNIPROT
TgeneCTNNA2C0001973Alcoholic Intoxication, Chronic1PSYGENET
TgeneCTNNA2C0036341Schizophrenia1PSYGENET
TgeneCTNNA2C0038356Stomach Neoplasms1CTD_human