FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27136

FusionGeneSummary for PIGK_TGFBR3

check button Fusion gene summary
Fusion gene informationFusion gene name: PIGK_TGFBR3
Fusion gene ID: 27136
HgeneTgene
Gene symbol

PIGK

TGFBR3

Gene ID

10026

7049

Gene namephosphatidylinositol glycan anchor biosynthesis class Ktransforming growth factor beta receptor 3
SynonymsGPI8BGCAN|betaglycan
Cytomap

1p31.1

1p22.1

Type of geneprotein-codingprotein-coding
DescriptionGPI-anchor transamidaseGPI transamidase subunitGPI8 homologPIG-Kphosphatidylinositol glycan, class Kphosphatidylinositol-glycan biosynthesis class K proteintransforming growth factor beta receptor type 3TGF-beta receptor type 3TGF-beta receptor type IIITGFR-3betaglycan proteoglycantransforming growth factor beta receptor III
Modification date2018052320180519
UniProtAcc

Q92643

Q03167

Ensembl transtripts involved in fusion geneENST00000370812, ENST00000445065, 
ENST00000370813, ENST00000359130, 
ENST00000478391, 
ENST00000212355, 
ENST00000370399, ENST00000525962, 
ENST00000468996, 
Fusion gene scores* DoF score5 X 5 X 5=1256 X 6 X 6=216
# samples 56
** MAII scorelog2(5/125*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/216*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PIGK [Title/Abstract] AND TGFBR3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTGFBR3

GO:0001837

epithelial to mesenchymal transition

18184661

TgeneTGFBR3

GO:0007179

transforming growth factor beta receptor signaling pathway

12958365

TgeneTGFBR3

GO:0030509

BMP signaling pathway

18184661

TgeneTGFBR3

GO:0032354

response to follicle-stimulating hormone

14557487

TgeneTGFBR3

GO:0034695

response to prostaglandin E

14557487

TgeneTGFBR3

GO:0034699

response to luteinizing hormone

14557487

TgeneTGFBR3

GO:0051271

negative regulation of cellular component movement

17999987

TgeneTGFBR3

GO:0060317

cardiac epithelial to mesenchymal transition

18184661


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-85-8582-01APIGKchr1

77587960

-TGFBR3chr1

92187701

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370812ENST00000212355PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000370812ENST00000370399PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000370812ENST00000525962PIGKchr1

77587960

-TGFBR3chr1

92187701

-
5CDS-intronENST00000370812ENST00000468996PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000445065ENST00000212355PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000445065ENST00000370399PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000445065ENST00000525962PIGKchr1

77587960

-TGFBR3chr1

92187701

-
5CDS-intronENST00000445065ENST00000468996PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000370813ENST00000212355PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000370813ENST00000370399PIGKchr1

77587960

-TGFBR3chr1

92187701

-
In-frameENST00000370813ENST00000525962PIGKchr1

77587960

-TGFBR3chr1

92187701

-
5CDS-intronENST00000370813ENST00000468996PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000359130ENST00000212355PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000359130ENST00000370399PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000359130ENST00000525962PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-intronENST00000359130ENST00000468996PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000478391ENST00000212355PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000478391ENST00000370399PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-3CDSENST00000478391ENST00000525962PIGKchr1

77587960

-TGFBR3chr1

92187701

-
intron-intronENST00000478391ENST00000468996PIGKchr1

77587960

-TGFBR3chr1

92187701

-

Top

FusionProtFeatures for PIGK_TGFBR3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIGK

Q92643

TGFBR3

Q03167

Mediates GPI anchoring in the endoplasmic reticulum, byreplacing a protein's C-terminal GPI attachment signal peptidewith a pre-assembled GPI. During this transamidation reaction, theGPI transamidase forms a carbonyl intermediate with the substrateprotein. Binds to TGF-beta. Could be involved in capturing andretaining TGF-beta for presentation to the signaling receptors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIGKchr1:77587960chr1:92187701ENST00000370812-1011311_321357396RegionNote=Essential for GPI attachment
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000212355-617455_730295852DomainZP
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000370399-718455_730295851DomainZP
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000525962-516455_730295852DomainZP
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000212355-617810_851295852Topological domainCytoplasmic
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000370399-718810_851295851Topological domainCytoplasmic
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000525962-516810_851295852Topological domainCytoplasmic
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000212355-617788_809295852TransmembraneHelical
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000370399-718788_809295851TransmembraneHelical
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000525962-516788_809295852TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIGKchr1:77587960chr1:92187701ENST00000370812-101128_367357396Topological domainLumenal
HgenePIGKchr1:77587960chr1:92187701ENST00000370812-1011389_395357396Topological domainCytoplasmic
HgenePIGKchr1:77587960chr1:92187701ENST00000370812-1011368_388357396TransmembraneHelical
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000212355-61721_787295852Topological domainExtracellular
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000370399-71821_787295851Topological domainExtracellular
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000525962-51621_787295852Topological domainExtracellular


Top

FusionGeneSequence for PIGK_TGFBR3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_914aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDM
ACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMND
LFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPN
SIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQN
PPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGM
DVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIV
VFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIEN
ICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTF
TKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIG

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_913aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDM
ACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMND
LFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPN
SIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEEMGDEEVHTIPPELRILLDPGALPALQNP
PIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMD
VTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVV
FNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENI
CPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFT
KPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGS

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_914aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDM
ACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITN
IELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMND
LFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPN
SIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQN
PPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGM
DVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIV
VFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIEN
ICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTF
TKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIG

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_820aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELA
DAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQV
CPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPNSIGF
GKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIR
GGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTL
LDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNC
SLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPK
DESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPL
AVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQS

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_819aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELA
DAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQV
CPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPNSIGF
GKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEEMGDEEVHTIPPELRILLDPGALPALQNPPIRG
GEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTLL
DPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCS
LQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKD
ESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLA
VIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQST

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_820aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELA
DAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQV
CPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLPVAQIIHQAPNSIGF
GKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNPPIR
GGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAVEKDSFQASGYSGMDVTL
LDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNC
SLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPK
DESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPL
AVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSPPASENSSAAHSIGSTQS

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_838aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGG
NGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEF
LEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYA
EQLPVAQIIHQAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPEL
RILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVA
VEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDM
DEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPY
SNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLD
ASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTS

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_837aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGG
NGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEF
LEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYA
EQLPVAQIIHQAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNEEMGDEEVHTIPPELR
ILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVAV
EKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDMD
EGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPYS
NPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDA
SIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTSP

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_838aa
MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGG
NGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEF
LEEINPASQTNMNDLFQVCPKSLCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYA
EQLPVAQIIHQAPNSIGFGKESERSMTMTKSIRDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPEL
RILLDPGALPALQNPPIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIVA
VEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWPDGYEDLESGDNGFPGDM
DEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVFSVPENGHVYVEVSVTKAEQELGFAIQTCFISPY
SNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMDKKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLD
ASIIWAMMQNKKTFTKPLAVIHHEAESKEKGPSMKEPNPISPPIFHGLDTLTVMGIAFAAFVIGALLTGALWYIYSHTGETAGRQQVPTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_2742nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACATCCCGATTCTGGTTTAATTATCGA
CATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATTGTCCTAATGCTTGCAGATGATATG
GCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTGTATGGAGATGATGTGGAAGTGGAT
TATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTT
TCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAAC
ATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCC
ATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCA
ATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGAC
CTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATA
ACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTAT
AAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAAC
AGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTG
AAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAAT
GCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAAC
CCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAA
GATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTG
GATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATG
GACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGG
CCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGAT
GGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTG
GTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATAC
AACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCT
GAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAAT
ATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTC
AGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAG
AAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTC
ACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATT
TTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATC
TATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGC

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_2739nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACATCCCGATTCTGGTTTAATTATCGA
CATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATTGTCCTAATGCTTGCAGATGATATG
GCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTGTATGGAGATGATGTGGAAGTGGAT
TATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTT
TCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAAC
ATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCC
ATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCA
ATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGAC
CTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATA
ACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTAT
AAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAAC
AGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTG
AAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAAT
GAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCG
CCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGAT
GGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGAT
ATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGAC
GTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCC
CGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGT
TATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTG
TTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAAC
ACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAA
CAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATT
TGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGC
TTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAG
TTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACT
AAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTC
CATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTAT
TCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGC

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_2742nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACATCCCGATTCTGGTTTAATTATCGA
CATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATTGTCCTAATGCTTGCAGATGATATG
GCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTGTATGGAGATGATGTGGAAGTGGAT
TATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTT
TCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAAC
ATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCC
ATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCA
ATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGAC
CTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATA
ACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTAT
AAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAAC
AGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTG
AAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAAT
GCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAAC
CCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAA
GATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTG
GATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATG
GACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGG
CCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGAT
GGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTG
GTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATAC
AACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCT
GAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAAT
ATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTC
AGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAG
AAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTC
ACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATT
TTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATC
TATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGC

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_2460nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGA
AGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCG
GATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGA
TTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCAT
CTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTA
TGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTT
GGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAG
ATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTT
GGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTG
GACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATG
GGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGG
GGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCT
CGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTG
TCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTG
TTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCA
GCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGAT
CTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGC
AGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTC
TTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTG
GGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAA
GATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTC
AAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAG
TGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTT
GCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTG
GACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACA
GGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGC

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_2457nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGA
AGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCG
GATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGA
TTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCAT
CTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTA
TGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTT
GGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAG
ATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTT
GGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTG
GACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGAGGAGATGGGA
GATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGA
GGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGG
CCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCT
GTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTG
GATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCC
CTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTG
GAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGC
CTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTT
TTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGA
TTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGAT
GAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAG
CCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGT
GTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCT
GTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGAC
ACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGG
GAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACG

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_2460nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGA
AGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCG
GATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGA
TTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCAT
CTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTA
TGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTT
GGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAG
ATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTT
GGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTG
GACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATG
GGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGG
GGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCT
CGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTG
TCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTG
TTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCA
GCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGAT
CTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGC
AGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTC
TTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTG
GGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAA
GATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTC
AAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAG
TGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTT
GCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTG
GACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACA
GGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGC

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_2514nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAACTGTGGAGAATTTTTTACGGGTATTAACT
GGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGA
AATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTAC
AATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGT
CAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTT
TTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACAT
CGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACT
ATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCT
GAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAA
TCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATG
GCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTA
CGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCT
TTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTG
TTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCT
GTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACA
CACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTG
ATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATG
GATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAG
GAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCA
GAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATAT
TCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTG
CACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAG
TGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGAC
GCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAA
GGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCC
TTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCC

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_2511nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAACTGTGGAGAATTTTTTACGGGTATTAACT
GGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGA
AATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTAC
AATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGT
CAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTT
TTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACAT
CGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACT
ATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCT
GAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAA
TCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATG
GCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGG
ATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTC
CCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTT
CCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTA
GAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACAC
TTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATA
CAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGAT
GAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAA
CAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAG
AATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCG
AACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCAC
TTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGT
GAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCC
TCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGT
CCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTT
GTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCG

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_2514nt
ATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTCGGCAGCGTGGCCGCTAGTCATATC
GAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAACTGTGGAGAATTTTTTACGGGTATTAACT
GGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGA
AATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTAC
AATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGT
CAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTT
TTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACAT
CGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACT
ATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCT
GAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAA
TCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATG
GCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTA
CGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCT
TTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTG
TTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCT
GTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACA
CACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTG
ATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATG
GATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAG
GAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCA
GAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATAT
TCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTG
CACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAG
TGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGAC
GCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAA
GGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCC
TTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_6160nt
GCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTC
GGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACA
TCCCGATTCTGGTTTAATTATCGACATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATT
GTCCTAATGCTTGCAGATGATATGGCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTG
TATGGAGATGATGTGGAAGTGGATTATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGT
ACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTT
CAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATT
ATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCA
CTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCA
GCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAG
AGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGAT
TCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCT
CAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATT
CCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGA
TTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCT
GGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGG
AGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAG
CCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTT
CAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCT
CCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTT
GGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCC
CTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAAC
ATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTAT
GTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATG
TCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAA
GCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGT
ACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCC
ATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAA
CCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTC
CTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAAC
AGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCA
ACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGT
TCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCT
TCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAAC
ACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAA
AGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTG
AGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGT
GTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCT
GATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTA
CAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGA
AATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACAT
TCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTC
CACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGT
CTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTC
TTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGC
TAAAATAAGCTCAGTGATACCTCCTTGTTAAAAAAAAAAAAAAAAAAAAAGAATGCCAGGGGGGAATTATCATGCTAAATTATTTTACTG
CTGAAGATAGCTTCATTGCAAATTATTCTTTTTCCAGAATTTCCCCCAAACAACTTAGAATTCCATAAGTAGAACAAGATAGATTCTACC
CCCAAAATATTCATAAGCAAATCCCACTGCCCTTAAAATAAGGAAGTTATGCCTGGTTGTCTGTGAATGGAACCTCAGTAGGTAATCCTG
ATGAAGCTTAAAACCTTAGGGCAGTGTCTACATGGGAAACAAGTATGTGGAAATTGACAATCATTTTTACCAAATCGTTGAGTAATAATA
TGACTTACCTGATAGATATACACATTCAATAAGGAACATTTTTTTTTTTCAATAAGGAACATTTTAACTAAAACATTACTTTAGGGCTGA
GATTTCCAGGCTATCTACATTGATCTACTGAAAAATTTCTAGATTTCCATATACAAACGAAGAAGACATGAGTTTAGAGAATTTTTTTCC
TTTAATTTTTTTTTAACAGAAGGGTATCAGAGTGGAGGACCTAGATTACGCTACCTGTGTTTGAAAATATTGCGCTTTGCCTAACCTTCG
GTGGAATGTATTGTTTCAGCATATTCTATGTATAAAAAAGTTTAAAGATGTCTTCAAAGAAGACTAGAGTCTTTAAGTCACTTATAGCTA
TATTTTACTACAAAATTTGTGTATAAAGATATATTTAAGTGTTTTAGATAAATTTAAGTTACTCCATATGAAATGTTTAATTTCAGCTAC
TGTGAATTCTTTCGATCAGTCCTTTGCTTTTTTAAAAAATCTTTTCCATCGTGTTAAAAAGAAAATTAGCTATTAGGAGATATTAAAAGA
TTGATGTCTTAGAAGGACAGGGTTAAAACCTTCTGTAATATATTTAAATATATATTTTTAAGAGAGATGCTACATTGCCAATGATTTTAT
AAATAATTTAAAATTAATTTACAAATTTATAGATGCAAACCAAAAGATCTTTTTAAAAGAGAGAGAGAGGAAAAAAATCACCTTTTATTT
GTTTGGGTCTCATTGTCAGAATTATTATTCAGATCAAGAAATCTGTGTCGATAAAACCTAATCTCATATTGGAGAGTGAATGTCGTTAAG
TATTTCTGAAATGTTTCTAAAAAATGAACATGAAAAAAATAAGGTATTTTCTCCCTAGCTTCTCATTACAGTATTTCTAATTGCTTCACA
CTTTACAGTTTTAATACAAAGTACAAGCTCTACTTTTATAACGTGTACTACAAGTTTCTTTAAAAGTATTGTTGTATTTCAGCTGAACTC
TTGTATCTGCAGTCTTTTGTTATTTCTGCAGGCTACACCCTTAATTTGCAGAGGCCATTTTGTTGTTTGTTTGATGCTGAAGCTGTTGTT
AAAATGCCCCAAACTCCAAGGCAGATTGTCTGTATAATACGCTATAGCTTTTCACCATGTGGTGTTTACCAGCTGTTACTCTGTATTTTA
AAAAGCCAGAGATTTCTTCTGTCTAAACTGTTTCTATAGCATTTTCTAAACAAAAAAAATGGTTTTTTTCTTTGCCTTGTAATAAGATTG
TAAATCCATTTCCTGCTTGTGTTCTTAGTGGGCATGATTGTGAGTGTGTGTGGGGTGCTCACACGCGTGCCAGTCTTTTTGTACTGTAAC
TACCTCATGGTTTGAATGATGATTGTACTGCTGGTTGTGTTAACAGAGCACATTTTGTTGGGTGAGTCCTATGTGATTTTTTTCATGTTT
GTTTTATCTGGGGGTTGTTCATGAAACTGACAGATGTTTTTCTAAAAAGGACTATTATCAGTTTCCAAATACAATACTTCTCTCTTCTGG
TTTTTCCTGAATGAGCCTGATTTTGTTGCTGGTTTTCATCATCTATGAGGGTAAAACGAGTACCCTTAAAATCCCTGTGGCCAGTTTGAA
CACCCCTGTTGTATTCTTTTCTCTGTTCAGTGTGTCAGCTATTTTGTGAAGATGCTTAGATGTATAGTTTTGATAACCACAGTTTTAAAT

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_4076nt
GCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTC
GGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACA
TCCCGATTCTGGTTTAATTATCGACATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATT
GTCCTAATGCTTGCAGATGATATGGCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTG
TATGGAGATGATGTGGAAGTGGATTATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGT
ACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTT
CAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATT
ATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCA
CTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCA
GCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAG
AGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGAT
TCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCT
CAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATT
CCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGA
TTTCATCTTCGGCTTGAAAATAATGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGT
GCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGA
GTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCA
GAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAG
GCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCT
CTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGG
GACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTG
TTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATC
ACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTT
GAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCT
CATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCT
GACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACG
AAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATG
ATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCA
AATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTG
ACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGC
AGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACC
CAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCC
CTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCT
GTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACA
TGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGG
GTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGG
CTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTC
CCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGAT
GACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAG
AAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAAT
TCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCA
TTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCAC
TCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTC
CAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTG
CCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGCTAA

>In-frame_PIGK_ENST00000370812_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_4075nt
GCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTCCTTC
GGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTGTGTACA
TCCCGATTCTGGTTTAATTATCGACATGTTGCAAATACCCTTTCTGTTTATAGAAGTGTCAAGAGGCTAGGTATTCCTGACAGTCACATT
GTCCTAATGCTTGCAGATGATATGGCCTGTAATCCTAGAAATCCCAAACCAGCTACAGTGTTTAGTCACAAGAATATGGAACTAAATGTG
TATGGAGATGATGTGGAAGTGGATTATAGAAGTTACGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGT
ACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTT
CAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATT
ATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCA
CTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCA
GCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAG
AGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGAT
TCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCT
CAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATT
CCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGA
TTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCT
GGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGG
AGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAG
CCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTT
CAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCT
CCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTT
GGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCC
CTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAAC
ATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTAT
GTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATG
TCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAA
GCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGT
ACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCC
ATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAA
CCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTC
CTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAAC
AGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCA
ACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGT
TCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCT
TCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAAC
ACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAA
AGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTG
AGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGT
GTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCT
GATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTA
CAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGA
AATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACAT
TCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTC
CACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGT
CTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTC
TTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGC

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_5882nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCG
GTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTC
TGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATAC
TTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCA
TCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCA
AACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCC
TAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAAT
CATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAAT
ACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAAC
CCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCT
TCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCT
GCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTG
GAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGA
GGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAG
TGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAA
TGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAG
TAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCAC
CCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTT
CAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGT
ATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTA
CACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACAT
GGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGAT
GGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCA
GAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCC
AATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGG
GGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGC
TGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCC
CAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGT
AAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACC
ACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCA
GTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAA
TAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTC
TAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTG
ATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCT
TATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATT
GAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGT
TATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTC
TCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAA
ATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTT
GGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTA
AATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGCTAAAATAA
GCTCAGTGATACCTCCTTGTTAAAAAAAAAAAAAAAAAAAAAGAATGCCAGGGGGGAATTATCATGCTAAATTATTTTACTGCTGAAGAT
AGCTTCATTGCAAATTATTCTTTTTCCAGAATTTCCCCCAAACAACTTAGAATTCCATAAGTAGAACAAGATAGATTCTACCCCCAAAAT
ATTCATAAGCAAATCCCACTGCCCTTAAAATAAGGAAGTTATGCCTGGTTGTCTGTGAATGGAACCTCAGTAGGTAATCCTGATGAAGCT
TAAAACCTTAGGGCAGTGTCTACATGGGAAACAAGTATGTGGAAATTGACAATCATTTTTACCAAATCGTTGAGTAATAATATGACTTAC
CTGATAGATATACACATTCAATAAGGAACATTTTTTTTTTTCAATAAGGAACATTTTAACTAAAACATTACTTTAGGGCTGAGATTTCCA
GGCTATCTACATTGATCTACTGAAAAATTTCTAGATTTCCATATACAAACGAAGAAGACATGAGTTTAGAGAATTTTTTTCCTTTAATTT
TTTTTTAACAGAAGGGTATCAGAGTGGAGGACCTAGATTACGCTACCTGTGTTTGAAAATATTGCGCTTTGCCTAACCTTCGGTGGAATG
TATTGTTTCAGCATATTCTATGTATAAAAAAGTTTAAAGATGTCTTCAAAGAAGACTAGAGTCTTTAAGTCACTTATAGCTATATTTTAC
TACAAAATTTGTGTATAAAGATATATTTAAGTGTTTTAGATAAATTTAAGTTACTCCATATGAAATGTTTAATTTCAGCTACTGTGAATT
CTTTCGATCAGTCCTTTGCTTTTTTAAAAAATCTTTTCCATCGTGTTAAAAAGAAAATTAGCTATTAGGAGATATTAAAAGATTGATGTC
TTAGAAGGACAGGGTTAAAACCTTCTGTAATATATTTAAATATATATTTTTAAGAGAGATGCTACATTGCCAATGATTTTATAAATAATT
TAAAATTAATTTACAAATTTATAGATGCAAACCAAAAGATCTTTTTAAAAGAGAGAGAGAGGAAAAAAATCACCTTTTATTTGTTTGGGT
CTCATTGTCAGAATTATTATTCAGATCAAGAAATCTGTGTCGATAAAACCTAATCTCATATTGGAGAGTGAATGTCGTTAAGTATTTCTG
AAATGTTTCTAAAAAATGAACATGAAAAAAATAAGGTATTTTCTCCCTAGCTTCTCATTACAGTATTTCTAATTGCTTCACACTTTACAG
TTTTAATACAAAGTACAAGCTCTACTTTTATAACGTGTACTACAAGTTTCTTTAAAAGTATTGTTGTATTTCAGCTGAACTCTTGTATCT
GCAGTCTTTTGTTATTTCTGCAGGCTACACCCTTAATTTGCAGAGGCCATTTTGTTGTTTGTTTGATGCTGAAGCTGTTGTTAAAATGCC
CCAAACTCCAAGGCAGATTGTCTGTATAATACGCTATAGCTTTTCACCATGTGGTGTTTACCAGCTGTTACTCTGTATTTTAAAAAGCCA
GAGATTTCTTCTGTCTAAACTGTTTCTATAGCATTTTCTAAACAAAAAAAATGGTTTTTTTCTTTGCCTTGTAATAAGATTGTAAATCCA
TTTCCTGCTTGTGTTCTTAGTGGGCATGATTGTGAGTGTGTGTGGGGTGCTCACACGCGTGCCAGTCTTTTTGTACTGTAACTACCTCAT
GGTTTGAATGATGATTGTACTGCTGGTTGTGTTAACAGAGCACATTTTGTTGGGTGAGTCCTATGTGATTTTTTTCATGTTTGTTTTATC
TGGGGGTTGTTCATGAAACTGACAGATGTTTTTCTAAAAAGGACTATTATCAGTTTCCAAATACAATACTTCTCTCTTCTGGTTTTTCCT
GAATGAGCCTGATTTTGTTGCTGGTTTTCATCATCTATGAGGGTAAAACGAGTACCCTTAAAATCCCTGTGGCCAGTTTGAACACCCCTG
TTGTATTCTTTTCTCTGTTCAGTGTGTCAGCTATTTTGTGAAGATGCTTAGATGTATAGTTTTGATAACCACAGTTTTAAATCTTTTATC

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_3798nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCG
GTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTC
TGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATAC
TTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCA
TCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCA
AACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCC
TAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAAT
CATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAAT
ACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAAC
CCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCT
TCGGCTTGAAAATAATGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCC
TGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAA
TGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGT
GCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGG
CTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGG
CTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAG
TGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCG
ACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAA
CATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATC
TGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACAC
CATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGA
TAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGA
GAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAA
TAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAAT
TTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGC
CTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGC
CCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCCCAG
CCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGTAAA
GACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACCACA
CTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCAGTT
TTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAATAG
CCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTCTAA
GCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTGATG
GGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCTTAT
CAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATTGAA
AATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGTTAT
AAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTCTCA
GTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAAATA
TGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTTGGT
TATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTAAAT
ATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGCTAAAATAAGCT

>In-frame_PIGK_ENST00000445065_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_3797nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGTAACTGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCG
GTCAAAACGTCTTCTTTCTGATGACAGAAGCAATATTCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTC
TGAAGAAATTACCAACATAGAACTCGCGGATGCTTTTGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATAC
TTGCCAAGGAGCATCCATGTATGAACGATTTTATTCTCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCA
TCAACCTGATCCTGCAATTGGAGTCCATCTTATGGATAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCA
AACTAATATGAATGACCTTTTTCAGGTATGTCCCAAAAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCC
TAAAAATGTACTGATAACTGATTTCTTTGGAAGTGTACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAAT
CATGGAAAGCAGCTATAAGGAAGACCAGATGGATGAGAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAAT
ACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGAGAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAAC
CCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGGCTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCT
TCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGAGGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCT
GCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTG
GAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGA
GGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAG
TGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAA
TGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAG
TAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCAC
CCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTT
CAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGT
ATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTA
CACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACAT
GGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGAT
GGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCA
GAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCC
AATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGG
GGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGC
TGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCC
CAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGT
AAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACC
ACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCA
GTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAA
TAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTC
TAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTG
ATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCT
TATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATT
GAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGT
TATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTC
TCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAA
ATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTT
GGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTA
AATATATCCCATATATTTAATATGTCAAAAAGGGCTTGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGCTAAAATAA

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000212355_chr1_92187701_-_5936nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAAC
TGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATAT
TCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTT
TGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTC
TCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGA
TAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAA
AAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGT
ACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGA
GAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGA
GAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGG
CTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGA
GGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGA
AGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAA
GGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAA
ATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCC
TACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGA
TGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTC
AGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCA
GCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGT
GCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGC
CATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATC
TGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGT
CTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCC
TCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGAT
CCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCT
AACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGAC
AGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTG
CTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGA
CCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGT
TGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGT
CTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATC
CATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCA
AAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTG
GATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGT
GTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACAC
CACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCC
CATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATT
TCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTAT
GCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAA
AAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACA
GTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCT
TGAGGTGAATTTCATTAAATGGAATAATATGATGCCACTTTGCAGCTAAAATAAGCTCAGTGATACCTCCTTGTTAAAAAAAAAAAAAAA
AAAAAAGAATGCCAGGGGGGAATTATCATGCTAAATTATTTTACTGCTGAAGATAGCTTCATTGCAAATTATTCTTTTTCCAGAATTTCC
CCCAAACAACTTAGAATTCCATAAGTAGAACAAGATAGATTCTACCCCCAAAATATTCATAAGCAAATCCCACTGCCCTTAAAATAAGGA
AGTTATGCCTGGTTGTCTGTGAATGGAACCTCAGTAGGTAATCCTGATGAAGCTTAAAACCTTAGGGCAGTGTCTACATGGGAAACAAGT
ATGTGGAAATTGACAATCATTTTTACCAAATCGTTGAGTAATAATATGACTTACCTGATAGATATACACATTCAATAAGGAACATTTTTT
TTTTTCAATAAGGAACATTTTAACTAAAACATTACTTTAGGGCTGAGATTTCCAGGCTATCTACATTGATCTACTGAAAAATTTCTAGAT
TTCCATATACAAACGAAGAAGACATGAGTTTAGAGAATTTTTTTCCTTTAATTTTTTTTTAACAGAAGGGTATCAGAGTGGAGGACCTAG
ATTACGCTACCTGTGTTTGAAAATATTGCGCTTTGCCTAACCTTCGGTGGAATGTATTGTTTCAGCATATTCTATGTATAAAAAAGTTTA
AAGATGTCTTCAAAGAAGACTAGAGTCTTTAAGTCACTTATAGCTATATTTTACTACAAAATTTGTGTATAAAGATATATTTAAGTGTTT
TAGATAAATTTAAGTTACTCCATATGAAATGTTTAATTTCAGCTACTGTGAATTCTTTCGATCAGTCCTTTGCTTTTTTAAAAAATCTTT
TCCATCGTGTTAAAAAGAAAATTAGCTATTAGGAGATATTAAAAGATTGATGTCTTAGAAGGACAGGGTTAAAACCTTCTGTAATATATT
TAAATATATATTTTTAAGAGAGATGCTACATTGCCAATGATTTTATAAATAATTTAAAATTAATTTACAAATTTATAGATGCAAACCAAA
AGATCTTTTTAAAAGAGAGAGAGAGGAAAAAAATCACCTTTTATTTGTTTGGGTCTCATTGTCAGAATTATTATTCAGATCAAGAAATCT
GTGTCGATAAAACCTAATCTCATATTGGAGAGTGAATGTCGTTAAGTATTTCTGAAATGTTTCTAAAAAATGAACATGAAAAAAATAAGG
TATTTTCTCCCTAGCTTCTCATTACAGTATTTCTAATTGCTTCACACTTTACAGTTTTAATACAAAGTACAAGCTCTACTTTTATAACGT
GTACTACAAGTTTCTTTAAAAGTATTGTTGTATTTCAGCTGAACTCTTGTATCTGCAGTCTTTTGTTATTTCTGCAGGCTACACCCTTAA
TTTGCAGAGGCCATTTTGTTGTTTGTTTGATGCTGAAGCTGTTGTTAAAATGCCCCAAACTCCAAGGCAGATTGTCTGTATAATACGCTA
TAGCTTTTCACCATGTGGTGTTTACCAGCTGTTACTCTGTATTTTAAAAAGCCAGAGATTTCTTCTGTCTAAACTGTTTCTATAGCATTT
TCTAAACAAAAAAAATGGTTTTTTTCTTTGCCTTGTAATAAGATTGTAAATCCATTTCCTGCTTGTGTTCTTAGTGGGCATGATTGTGAG
TGTGTGTGGGGTGCTCACACGCGTGCCAGTCTTTTTGTACTGTAACTACCTCATGGTTTGAATGATGATTGTACTGCTGGTTGTGTTAAC
AGAGCACATTTTGTTGGGTGAGTCCTATGTGATTTTTTTCATGTTTGTTTTATCTGGGGGTTGTTCATGAAACTGACAGATGTTTTTCTA
AAAAGGACTATTATCAGTTTCCAAATACAATACTTCTCTCTTCTGGTTTTTCCTGAATGAGCCTGATTTTGTTGCTGGTTTTCATCATCT
ATGAGGGTAAAACGAGTACCCTTAAAATCCCTGTGGCCAGTTTGAACACCCCTGTTGTATTCTTTTCTCTGTTCAGTGTGTCAGCTATTT

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000370399_chr1_92187701_-_3852nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAAC
TGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATAT
TCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTT
TGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTC
TCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGA
TAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAA
AAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGT
ACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGA
GAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGA
GAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGG
CTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGAGGAGATGGGAGATGAGGA
AGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGAAGG
CCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAAGGA
CCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAAATG
TGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCCTAC
CTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGATGG
TGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTCAGG
TGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCAGCA
GGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGTGCC
CTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGCCAT
CCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATCTGT
GAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGTCTT
CAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCCTCC
TGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGATCCA
CCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCTAAC
CGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGACAGC
AGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTGCTC
CAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGACCA
ATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGTTGT
ATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGTCTT
CTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATCCAT
AATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCAAAG
ATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTGGAT
GCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGTGTT
AAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACACCAC
TGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCCCAT
TCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATTTCT
ATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTATGCT
TTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAAAAA
CCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACAGTG
CTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCTTGA

>In-frame_PIGK_ENST00000370813_chr1_77587960_-_TGFBR3_ENST00000525962_chr1_92187701_-_3851nt
AGGTGCGGGAAGTCTGAAGCCGGTAAACATGGCCGTCACCGACAGCCTCAGCCGGGCTGCGACTGTCTTGGCAACTGTGTTGCTCTTGTC
CTTCGGCAGCGTGGCCGCTAGTCATATCGAGGATCAAGCAGAACAATTCTTTAGAAGTGGCCATACAAACAACTGGGCTGTTCTGGTAAC
TGTGGAGAATTTTTTACGGGTATTAACTGGGAGGATCCCACCTAGTACTCCTCGGTCAAAACGTCTTCTTTCTGATGACAGAAGCAATAT
TCTAATTTATATGACAGGGCATGGTGGAAATGGTTTCTTAAAATTTCAAGATTCTGAAGAAATTACCAACATAGAACTCGCGGATGCTTT
TGAACAAATGTGGCAGAAAAGACGCTACAATGAGCTACTGTTTATTATTGATACTTGCCAAGGAGCATCCATGTATGAACGATTTTATTC
TCCTAACATAATGGCTCTAGCTAGTAGTCAAGTGGGAGAAGATTCACTCTCGCATCAACCTGATCCTGCAATTGGAGTCCATCTTATGGA
TAGATACACATTTTATGTCTTGGAATTTTTGGAAGAAATTAACCCAGCTAGCCAAACTAATATGAATGACCTTTTTCAGGTATGTCCCAA
AAGTCTGTGTGTGTCTACTCCTGGACATCGCACTGATCTTTTTCAGAGGGATCCTAAAAATGTACTGATAACTGATTTCTTTGGAAGTGT
ACGGAAAGTGGAAATTACAACAGAGACTATTAAATTGCAACAGGATTCAGAAATCATGGAAAGCAGCTATAAGGAAGACCAGATGGATGA
GAAACTAATGGAACCTCTGAAATATGCTGAACAACTTCCTGTAGCTCAGATAATACACCAGGCTCCTAACAGTATTGGCTTTGGAAAAGA
GAGTGAAAGATCTATGACAATGACCAAATCAATAAGAGATGACATTCCTTCAACCCAAGGGAATCTGGTGAAGTGGGCTTTGGACAATGG
CTATAGTCCAATAACTTCATACACAATGGCTCCTGTGGCTAATAGATTTCATCTTCGGCTTGAAAATAATGCAGAGGAGATGGGAGATGA
GGAAGTCCACACTATTCCTCCTGAGCTACGGATCCTGCTGGACCCTGGTGCCCTGCCTGCCCTGCAGAACCCGCCCATCCGGGGAGGGGA
AGGCCAAAATGGAGGCCTTCCGTTTCCTTTCCCAGATATTTCCAGGAGAGTCTGGAATGAAGAGGGAGAAGATGGGCTCCCTCGGCCAAA
GGACCCTGTCATTCCCAGCATACAACTGTTTCCTGGTCTCAGAGAGCCAGAAGAGGTGCAAGGGAGCGTGGATATTGCCCTGTCTGTCAA
ATGTGACAATGAGAAGATGATCGTGGCTGTAGAAAAAGATTCTTTTCAGGCCAGTGGCTACTCGGGGATGGACGTCACCCTGTTGGATCC
TACCTGCAAGGCCAAGATGAATGGCACACACTTTGTTTTGGAGTCTCCTCTGAATGGCTGCGGTACTCGGCCCCGGTGGTCAGCCCTTGA
TGGTGTGGTCTACTATAACTCCATTGTGATACAGGTTCCAGCCCTTGGGGACAGTAGTGGTTGGCCAGATGGTTATGAAGATCTGGAGTC
AGGTGATAATGGATTTCCGGGAGATATGGATGAAGGAGATGCTTCCCTGTTCACCCGACCTGAAATCGTGGTGTTTAATTGCAGCCTTCA
GCAGGTGAGGAACCCCAGCAGCTTCCAGGAACAGCCCCACGGAAACATCACCTTCAACATGGAGCTATACAACACTGACCTCTTTTTGGT
GCCCTCCCAGGGCGTCTTCTCTGTGCCAGAGAATGGACACGTTTATGTTGAGGTATCTGTTACTAAGGCTGAACAAGAACTGGGATTTGC
CATCCAAACGTGCTTTATCTCTCCATATTCGAACCCTGATAGGATGTCTCATTACACCATTATTGAGAATATTTGTCCTAAAGATGAATC
TGTGAAATTCTACAGTCCCAAGAGAGTGCACTTTCCTATCCCGCAAGCTGACATGGATAAGAAGCGATTCAGCTTTGTCTTCAAGCCTGT
CTTCAACACCTCACTGCTCTTTCTACAGTGTGAGCTGACGCTGTGTACGAAGATGGAGAAGCACCCCCAGAAGTTGCCTAAGTGTGTGCC
TCCTGACGAAGCCTGCACCTCGCTGGACGCCTCGATAATCTGGGCCATGATGCAGAATAAGAAGACGTTCACTAAGCCCCTTGCTGTGAT
CCACCATGAAGCAGAATCTAAAGAAAAAGGTCCAAGCATGAAGGAACCAAATCCAATTTCTCCACCAATTTTCCATGGTCTGGACACCCT
AACCGTGATGGGCATTGCGTTTGCAGCCTTTGTGATCGGAGCACTCCTGACGGGGGCCTTGTGGTACATCTATTCTCACACAGGGGAGAC
AGCAGGAAGGCAGCAAGTCCCCACCTCCCCGCCAGCCTCGGAAAACAGCAGTGCTGCCCACAGCATCGGCAGCACGCAGAGCACGCCTTG
CTCCAGCAGCAGCACGGCCTAGCCCAACCCAGCCCAACCCGGCCCAACCCAGCCCAGCCCAGCTCAGCTCAGCTACTGCCAAGGGCAGGA
CCAATGGCTGAGCCTCGTGTCCAGACTCAGAGGGCTGGATTTTGGTTCCCTTGTAAAGACAGAGTGAATTTCAGTATAAAGATCACCCGT
TGTATTCACCCCACACCCAGGGCTAGTATAAACATGACCCTGGGCTTCTGTACCACACTAGAATTCATGTGAGAAAGCTAAAATGGTGGT
CTTCTCCACCAGCCCCTCACAGGCTTGGGGGTTTTCAATGTGAAACACATGCCAGTTTTTAAAATGCTGCTTTGTCCAGGTGAGAACATC
CATAATTTGGGGCCCTGAGTTTTACCCAGACTCAAGGAGTTGGTAAAGGGTTAATAGCCAGATAGTAGAACCAGTGAGGAGATGCGGCCA
AAGATTCTTTATATCTGAACCAAGATGTAAAACAAGAAATGCTTTGAGGCTTTCTAAGCGATCCTCCTGTCTAATTTGCACCTTTGTCTG
GATGCACACTTCTGACCTTGCTGCCACAACCTGTGGGGTCTGATGTGTCCCTTGATGGGTGCTGCCCTCAGGGACTGCACCCTGACAAGT
GTTAAGGCAACATTCCTTTCTTGTGCCCTGGGCCAAAACCAATGCTGATGACCTTATCAGCTTCCTGTTTCTTCCCATACTTGCATACAC
CACTGCAAAATGTCTTAATGCAAATTTTGTATTTCTTACAGGCCTACAGAAATTGAAAATGACCAAAATCAGGAACCACAGATTTGTGCC
CATTCCTAATATTTTGTTCTGCAAATTAATGTATAATTTGAGGTGAAATTCAGTTATAAAGTCAAGGACGAATTTGCACAGTGATATATT
TCTATGTGTATGCAAGTACAAGTATATAATATGTCACCTGGCACATTCATTTTCTCAGTTGAAGAAGAGAAAATTTGAAAATGTCCTTAT
GCTTTTAGAGTTGCAACTTAAGTATATTTGGTAGGGTGAGTGTTTCCACTCAAAATATGTCAACTTAAAAAAAAATAGGCCCTTTCATAA
AAACCAAACTGTAGCAAGATGCAAATGCATGGCAAATCCTGTCGGTCTCCAGTTGGTTATCTGAATAGTGTCACCAATTCCACCAAGACA
GTGCTGAGATTGGAAAAGGGCACTCATTTGGATTGCCTTACTTCTCTTGCCTTAAATATATCCCATATATTTAATATGTCAAAAAGGGCT


Top

FusionGenePPI for PIGK_TGFBR3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIGKPIGT, CANX, ULBP2, ALPP, GPAA1, PIGS, PIGU, FBXO6, B3GNT3, LYPD3, PRSS50, TCTN3TGFBR3TGFBR2, TGFB1, ELAVL1, NRP1, KLK11, ITM2B, ATP1B3, FGF1, GPR183, ATP1B4, PTCH1, SIAE, PIP5K1A, CAMKV, DEFA5, ST8SIA4, FAM19A4, DKKL1, CANT1, DEFA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000212355-617737_751295852TGF-beta ligand
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000370399-718737_751295851TGF-beta ligand
TgeneTGFBR3chr1:77587960chr1:92187701ENST00000525962-516737_751295852TGF-beta ligand


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIGK_TGFBR3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIGK_TGFBR3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource