FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27099

FusionGeneSummary for PICALM_ME3

check button Fusion gene summary
Fusion gene informationFusion gene name: PICALM_ME3
Fusion gene ID: 27099
HgeneTgene
Gene symbol

PICALM

ME3

Gene ID

8301

10873

Gene namephosphatidylinositol binding clathrin assembly proteinmalic enzyme 3
SynonymsCALM|CLTH|LAPNADP-ME
Cytomap

11q14.2

11q14.2

Type of geneprotein-codingprotein-coding
Descriptionphosphatidylinositol-binding clathrin assembly proteinclathrin assembly lymphoid myeloid leukemia proteinNADP-dependent malic enzyme, mitochondrialmalate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))malic enzyme 3, NADP(+)-dependent, mitochondrialmalic enzyme, NADP+-dependent, mitochondrialmitochondrial NADP(+)-dependent malic enzyme 3pyruvic-m
Modification date2018052320180523
UniProtAcc

Q13492

Q16798

Ensembl transtripts involved in fusion geneENST00000532317, ENST00000526033, 
ENST00000393346, ENST00000528398, 
ENST00000356360, ENST00000528411, 
ENST00000393324, ENST00000359636, 
ENST00000543262, ENST00000323418, 
ENST00000525957, 
Fusion gene scores* DoF score10 X 10 X 5=5005 X 4 X 4=80
# samples 156
** MAII scorelog2(15/500*10)=-1.73696559416621
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/80*10)=-0.415037499278844
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PICALM [Title/Abstract] AND ME3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePICALM

GO:0006898

receptor-mediated endocytosis

10436022

HgenePICALM

GO:0032880

regulation of protein localization

10436022

HgenePICALM

GO:0045893

positive regulation of transcription, DNA-templated

11425879

HgenePICALM

GO:0048261

negative regulation of receptor-mediated endocytosis

10436022

TgeneME3

GO:0006090

pyruvate metabolic process

7818469

TgeneME3

GO:0006108

malate metabolic process

7818469

TgeneME3

GO:0055114

oxidation-reduction process

7818469


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-VG-A8LO-01APICALMchr11

85707869

-ME3chr11

86198482

-
TCGALDOVTCGA-20-0987-01APICALMchr11

85779693

-ME3chr11

86270865

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000532317ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000532317ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000532317ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000532317ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
5CDS-5UTRENST00000532317ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000526033ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000526033ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000526033ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000526033ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
5CDS-5UTRENST00000526033ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000393346ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000393346ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000393346ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000393346ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
5CDS-5UTRENST00000393346ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000528398ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000528398ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000528398ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000528398ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
5CDS-5UTRENST00000528398ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000356360ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000356360ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000356360ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
Frame-shitENST00000356360ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
5CDS-5UTRENST00000356360ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
intron-3CDSENST00000528411ENST00000393324PICALMchr11

85707869

-ME3chr11

86198482

-
intron-3CDSENST00000528411ENST00000359636PICALMchr11

85707869

-ME3chr11

86198482

-
intron-3CDSENST00000528411ENST00000543262PICALMchr11

85707869

-ME3chr11

86198482

-
intron-3CDSENST00000528411ENST00000323418PICALMchr11

85707869

-ME3chr11

86198482

-
intron-5UTRENST00000528411ENST00000525957PICALMchr11

85707869

-ME3chr11

86198482

-
In-frameENST00000532317ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000532317ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000532317ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000532317ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
5CDS-intronENST00000532317ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000526033ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000526033ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000526033ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000526033ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
5CDS-intronENST00000526033ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000393346ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000393346ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000393346ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000393346ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
5CDS-intronENST00000393346ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-
intron-3CDSENST00000528398ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
intron-3CDSENST00000528398ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
intron-3CDSENST00000528398ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
intron-3CDSENST00000528398ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
intron-intronENST00000528398ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000356360ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000356360ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000356360ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
In-frameENST00000356360ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
5CDS-intronENST00000356360ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-
5UTR-3CDSENST00000528411ENST00000393324PICALMchr11

85779693

-ME3chr11

86270865

-
5UTR-3CDSENST00000528411ENST00000359636PICALMchr11

85779693

-ME3chr11

86270865

-
5UTR-3CDSENST00000528411ENST00000543262PICALMchr11

85779693

-ME3chr11

86270865

-
5UTR-3CDSENST00000528411ENST00000323418PICALMchr11

85779693

-ME3chr11

86270865

-
5UTR-intronENST00000528411ENST00000525957PICALMchr11

85779693

-ME3chr11

86270865

-

Top

FusionProtFeatures for PICALM_ME3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PICALM

Q13492

ME3

Q16798

Assembly protein recruiting clathrin and adapter proteincomplex 2 (AP2) to cell membranes at sites of coated-pit formationand clathrin-vesicle assembly. May be required to determine theamount of membrane to be recycled, possibly by regulating the sizeof the clathrin cage. Involved in AP2-dependent clathrin-mediatedendocytosis at the neuromuscular junction.{ECO:0000269|PubMed:10436022}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePICALMchr11:85779693chr11:86270865ENST00000356360-11914_14543633DomainENTH
HgenePICALMchr11:85779693chr11:86270865ENST00000393346-12014_14543653DomainENTH
HgenePICALMchr11:85779693chr11:86270865ENST00000526033-12014_14543646DomainENTH
HgenePICALMchr11:85779693chr11:86270865ENST00000528398-11914_145-62552DomainENTH
HgenePICALMchr11:85779693chr11:86270865ENST00000532317-12014_14543611DomainENTH


Top

FusionGeneSequence for PICALM_ME3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_43aa

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_43aa

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_43aa

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_587aa
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDWDGLYP_RKAAAWNPRPNPALLSEPGRPAPPNHEILRAAAE_PGQVH
HSHDTPRPEREALLPSADFGRGEVHANRVHAYRGAGLSALWPDFPQAPWTVHHHS_QRSSCNNAEFLARRQT_GRGGD_WGAHPGPGRPG
LLRHGHPCGQAGPVHGMRRGEPAAVPPCAAGRRHQQ_GAAQRPSVHRPETPARAREGIR_LAG_VHAGCDRQVWNKLPHPI_RLRQCQCL
PPAQQIP_QVLHVQ__HPRHSLRCCGRDLGCSANHQEQAFQSRVCFPRCRRGSTGHCPPPCHGPRERRCTEGRGHKKDLDGGL_RAHCQG
EEPPEP_KGDVCPRPS_SQLPGGGGEAGEAHSHHRCCCHRRSLHGADSEGHGLLPRAPTHLCPEQPHQQGRVHG_EVLPGHRGPRDFCQW
KSF_ECDSGRWQDLHSWAGKQCLRVPRGGTGSHRRRDPAHPR_DLPPDSRANCPGSL_AASVPGETLPTTQHHPRRVFENCHQSSRLRVQ

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_43aa


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_130nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_130nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_130nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_1762nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_130nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_2212nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAAT
CCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGA
CAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAAT
CGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAA
AGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGG
AGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCC
TGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGC
ATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGC
CAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGG
GATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGC
CCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCAT
TGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCT
GGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCG
CCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTT
TGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGG
GGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTC
TGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTA
CGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGA
CTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAG
ATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCT

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_2212nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAAT
CCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGA
CAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAAT
CGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAA
AGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGG
AGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCC
TGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGC
ATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGC
CAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGG
GATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGC
CCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCAT
TGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCT
GGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCG
CCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTT
TGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGG
GGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTC
TGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTA
CGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGA
CTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAG
ATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCT

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_2210nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAAT
CCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGA
CAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAAT
CGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAA
AGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGG
AGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCC
TGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGC
ATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGC
CAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGG
GATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGC
CCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCAT
TGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCT
GGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCG
CCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTT
TGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGG
GGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTC
TGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTA
CGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGA
CTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAG
ATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCT

>In-frame_PICALM_ENST00000532317_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_1189nt
CTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAGGCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCC
GCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTG
GGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGA
GCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGC
AAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCA
CGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAA
GTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGT
GTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGG
TCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGA
CCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGT
GCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATA
CGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAA
TGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGATGACTTCTCCAGAGGCCCAAAGAGGTC

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_2250nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGG
ATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGA
ATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTAC
CGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTC
CGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCC
GTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTAC
ACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTG
TACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGA
ATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAAT
GATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTT
GTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCC
ACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGAC
CATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACG
GAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCT
GAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTC
ATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATC
TTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGA
GACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAG
GCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAG
ACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAG
TGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGAGGAGATGCCAAGGCATACAGTGAATAAAAGCCTTGTCTCTGAA

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_2250nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGG
ATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGA
ATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTAC
CGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTC
CGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCC
GTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTAC
ACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTG
TACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGA
ATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAAT
GATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTT
GTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCC
ACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGAC
CATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACG
GAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCT
GAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTC
ATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATC
TTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGA
GACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAG
GCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAG
ACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAG
TGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGAGGAGATGCCAAGGCATACAGTGAATAAAAGCCTTGTCTCTGAA

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_2248nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGG
ATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGA
ATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTAC
CGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTC
CGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCC
GTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTAC
ACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTG
TACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGA
ATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAAT
GATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTT
GTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCC
ACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGAC
CATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACG
GAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCT
GAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTC
ATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATC
TTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGA
GACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAG
GCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAG
ACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAG

>In-frame_PICALM_ENST00000526033_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_1227nt
GGAGCCTGGCGCCGCCATTTTCCTGCAGCTGCCTGTTCCTCTTACCCTGCCCGGCTCCAGCTGACCCGGGAAGGGGTGGGCTGAACTGAG
GCGGGGGCAAGGGAGTGCCCGACATCTTGTCCGACTCCGCGGGTGACACGAGCCGGTTCTCTCTGGACTGGTGGCAGCGCGCGGCCCCGA
ACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTCTTGGGGGTCCCA
GTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGC
ACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTATG
GCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATC
ATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGA
GTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGC
AGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTG
GTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACG
GCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTAC
ATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATA
AATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGAT

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_2082nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTC
CAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAG
AAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTAT
GGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGAC
AATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAG
CTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTC
AGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACA
GACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTAC
TGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCC
AATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCG
AAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATG
TTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCA
GGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCC
GAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGAT
GGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATC
CCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTC
AGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCT
AAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCC
ATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCA
AAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGAGGAGATGCCAAGGCATACAGTGAATAAAAGC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_2082nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTC
CAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAG
AAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTAT
GGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGAC
AATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAG
CTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTC
AGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACA
GACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTAC
TGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCC
AATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCG
AAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATG
TTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCA
GGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCC
GAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGAT
GGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATC
CCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTC
AGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCT
AAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCC
ATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCA
AAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGAGGAGATGCCAAGGCATACAGTGAATAAAAGC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_2080nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTC
CAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAG
AAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTAT
GGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGAC
AATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAG
CTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTC
AGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACA
GACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTAC
TGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGCTGCTCTGCGAATCACCAAGAACAAGCTTTCC
AATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCTTGTCATGGCCCTAGAGAAAGAAGGTGTACCG
AAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGGGAGGAGCCACCTGAACCATGAAAAGGAGATG
TTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCCCACAGCCATCATAGGTGTTGCTGCCATCGCA
GGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCATCTTTGCCCTGAGCAACCCCACCAGCAAGGCC
GAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGGAAGTCCTTTTAAGAGTGTGACTCTGGAAGAT
GGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACTGGGAGTCATCGCCGGCGGGATCCGGCACATC
CCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCATCTGTCCCAGGGGAGACTCTACCCACCACTC
AGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAAACACAACCTGGCTTCCTACTACCCAGAGCCT
AAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTACACTGGACAGCTACACTTGGCCCAAGGAAGCC
ATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCCAGAGTAACACCCACAATATAAATGGGTTCCA
AAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGAGGAGATGCCAAGGCATACAGTGAATAAAAGC

>In-frame_PICALM_ENST00000393346_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_1059nt
GCGCGGCCCCGAACCGCGCCCCAGGCCGGCAGGCGGGGAAGGAGCCGGTGGGGGTAGGGGGTGCGGTGGGGGGTGGGGACCCTCCGGCTC
TTGGGGGTCCCAGTCCCCGCCGGCTGCTGAGCGGGTGGGGTGGTGGAGGAGCTGCAGAGATGTCCGGCCAGAGCCTGACGGACCGAATCA
CTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGC
ACCTGGACTATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAG
CTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCATTCTCATGACACTCCAAGACCGGAACGAGAAG
CTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCCTACCGTGGGGCTGGCCTGTCAGCACTATGGC
CTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGCAACAATGCTGAATTCTTGGCCAGAAGACAAT
ATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTGCTACGGCATGGGCATCCCTGTGGGCAAGCTG
GCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGACGTCGGCACCAACAATGAGGAGCTGCTCAGA
GACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTTGCTGGATGAGTTCATGCAGGCTGTGACAGAC
AAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCGCCTGCTCAACAAATACCGTAACAAGTACTGC

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000393324_chr11_86270865_-_1933nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC
ACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCC
AGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGA

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000359636_chr11_86270865_-_1933nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC
ACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCC
AGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGA

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000543262_chr11_86270865_-_1931nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTGGGATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCT
AATCCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACAT
CATTCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACAC
GCCTACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCT
TGCAACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGG
CTGCTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCT
GGACGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGA
CTTGCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTT
CCGCCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGGCACAGCCTCCGTTGCTGTGGCAGGGATCTTGGC
TGCTCTGCGAATCACCAAGAACAAGCTTTCCAATCACGTGTTTGTTTTCCAAGGTGCAGGCGAGGCAGCTATGGGCATTGCCCACCTCCT
TGTCATGGCCCTAGAGAAAGAAGGTGTACCGAAGGCAGAGGCCACAAGAAAGATCTGGATGGTGGACTCTAAAGGGCTCATTGTCAAGGG
GAGGAGCCACCTGAACCATGAAAAGGAGATGTTTGCCCAAGACCATCCTGAAGTCAACTCCCTGGAGGAGGTGGTGAGGCTGGTGAAGCC
CACAGCCATCATAGGTGTTGCTGCCATCGCAGGAGCCTTCACGGAGCAGATTCTGAGGGACATGGCCTCCTTCCACGAGCGCCCTATCAT
CTTTGCCCTGAGCAACCCCACCAGCAAGGCCGAGTGCACGGCTGAGAAGTGCTACCGGGTCACCGAGGGCCGAGGGATTTTTGCCAGTGG
AAGTCCTTTTAAGAGTGTGACTCTGGAAGATGGCAAGACCTTCATTCCTGGGCAGGGAAACAATGCTTACGTGTTCCCCGGGGTGGCACT
GGGAGTCATCGCCGGCGGGATCCGGCACATCCCAGATGAGATCTTCCTCCTGACAGCAGAGCAAATTGCCCAGGAAGTCTCTGAGCAGCA
TCTGTCCCAGGGGAGACTCTACCCACCACTCAGCACCATCCGAGACGTGTCTTTGAGAATTGCCATCAAAGTTCTCGACTACGCGTACAA
ACACAACCTGGCTTCCTACTACCCAGAGCCTAAGGACAAGGAGGCTTTTGTAAGATCCCTGGTCTACACTCCAGACTATGACTCCTTTAC
ACTGGACAGCTACACTTGGCCCAAGGAAGCCATGAATGTTCAGACGGTCTGAGGCAGTCTCAGAGGCTAGTATGGGGCTAGATGAAGCCC
AGAGTAACACCCACAATATAAATGGGTTCCAAAATGGCCCAAGTGAATCCTTGTCGCTGTGTTTTTTCTTTTAAACTTTCTGGTGTGAGA

>In-frame_PICALM_ENST00000356360_chr11_85779693_-_ME3_ENST00000323418_chr11_86270865_-_910nt
ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCAAGACAGTATGCAAGGCCACG
ACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTATGGCCTTTACCCTTGAAGAAAGGCTGCAGCTTGGAATCCACGGCCTAAT
CCCGCCCTGCTTTCTGAGCCAGGACGTCCAGCTCCTCCGAATCATGAGATATTACGAGCGGCAGCAGAGTGACCTGGACAAGTACATCAT
TCTCATGACACTCCAAGACCGGAACGAGAAGCTCTTCTACCGAGTGCTGACTTCGGACGTGGAGAAGTTCATGCCAATCGTGTACACGCC
TACCGTGGGGCTGGCCTGTCAGCACTATGGCCTGACTTTCCGCAGGCCCCGTGGACTGTTCATCACCATTCATGACAAAGGTCATCTTGC
AACAATGCTGAATTCTTGGCCAGAAGACAATATTAAGGCCGTGGTGGTGACTGATGGGGAGCGCATCCTGGGCCTGGGAGACCTGGGCTG
CTACGGCATGGGCATCCCTGTGGGCAAGCTGGCCCTGTACACGGCATGCGGAGGGGTGAACCCGCAGCAGTGCCTCCCTGTGCTGCTGGA
CGTCGGCACCAACAATGAGGAGCTGCTCAGAGACCCTCTGTACATCGGCCTGAAACACCAGCGCGTGCACGGGAAGGCATACGATGACTT
GCTGGATGAGTTCATGCAGGCTGTGACAGACAAGTTTGGAATAAATTGCCTCATCCAATTTGAAGACTTCGCCAATGCCAATGCCTTCCG
CCTGCTCAACAAATACCGTAACAAGTACTGCATGTTCAATGATGACATCCAAGATGACTTCTCCAGAGGCCCAAAGAGGTCACAACTTTT


Top

FusionGenePPI for PICALM_ME3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PICALMPLCG1, CLTC, ITSN1, AP2A1, HIP1R, LAMTOR3, EEF1A1, SEC24D, DNM2, EGFR, FLOT1, SEC24C, ATP6V1E1, ILF3, HNRNPDL, SH3GLB2, ABCC2, ATP6V1F, CD55, SIRT1, FN1, VCAM1, ITGA4, PELI2, KLHL20, SLC25A41, ITLN1, ATF6B, SLC25A32, SOX2, FAM64A, CYP1A1, HNRNPA1, UNK, NTRK1, C14orf166, CARS, CPPED1, HNRNPD, ILVBL, ITGB1, LPP, PAPOLA, DDX1, EWSR1, FERMT2, FUS, ILK, NPLOC4, PFKM, PTPRF, VCL, PXN, STXBP1, TRIM25, UNC13D, XPO1, AP2B1, AP2M1, CLTA, CLTB, DAB2, EPS15, GAK, MYO6, PIK3C2A, SEC13, CLTCL1, CAPZA2, DBN1, MYH9, LIMA1, GTSE1, ANLN, MYO19, MYO18A, CLINT1, SEC16A, TNRC6A, BMP2K, MICAL3, DENND1A, WNK1, PRRC2B, STON2, FCHO2, MCM2, SNW1, CDC5L, SMURF1, CDH1, STAMBPL1, RALBP1, SNRNP27, DLSTME3RHOU


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgenePICALMchr11:85779693chr11:86270865ENST00000356360-119221_29443633PIMREG
HgenePICALMchr11:85779693chr11:86270865ENST00000393346-120221_29443653PIMREG
HgenePICALMchr11:85779693chr11:86270865ENST00000526033-120221_29443646PIMREG
HgenePICALMchr11:85779693chr11:86270865ENST00000528398-119221_294-62552PIMREG
HgenePICALMchr11:85779693chr11:86270865ENST00000532317-120221_29443611PIMREG


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PICALM_ME3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PICALM_ME3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePICALMC0002395Alzheimer's Disease2CTD_human