FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27077

FusionGeneSummary for PIAS1_ZNF609

check button Fusion gene summary
Fusion gene informationFusion gene name: PIAS1_ZNF609
Fusion gene ID: 27077
HgeneTgene
Gene symbol

PIAS1

ZNF609

Gene ID

8554

23060

Gene nameprotein inhibitor of activated STAT 1zinc finger protein 609
SynonymsDDXBP1|GBP|GU/RH-II|ZMIZ3-
Cytomap

15q23

15q22.31

Type of geneprotein-codingprotein-coding
DescriptionE3 SUMO-protein ligase PIAS1AR interacting proteinDEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1DEAD/H box-binding protein 1E3 SUMO-protein transferase PIAS1RNA helicase II-binding proteingu-binding proteinprotein inhibitor of activated STAT przinc finger protein 609
Modification date2018052220180519
UniProtAcc

O75925

O15014

Ensembl transtripts involved in fusion geneENST00000249636, ENST00000545237, 
ENST00000567417, 
ENST00000326648, 
ENST00000416172, ENST00000559364, 
Fusion gene scores* DoF score5 X 3 X 4=607 X 9 X 3=189
# samples 510
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/189*10)=-0.918386234446348
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PIAS1 [Title/Abstract] AND ZNF609 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIAS1

GO:0016925

protein sumoylation

18579533

HgenePIAS1

GO:0033235

positive regulation of protein sumoylation

17696781|21965678

TgeneZNF609

GO:2000291

regulation of myoblast proliferation

28344082


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-J9-A8CL-01APIAS1chr15

68346688

+ZNF609chr15

64970315

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000249636ENST00000326648PIAS1chr15

68346688

+ZNF609chr15

64970315

+
5CDS-intronENST00000249636ENST00000416172PIAS1chr15

68346688

+ZNF609chr15

64970315

+
5CDS-intronENST00000249636ENST00000559364PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-3CDSENST00000545237ENST00000326648PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-intronENST00000545237ENST00000416172PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-intronENST00000545237ENST00000559364PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-3CDSENST00000567417ENST00000326648PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-intronENST00000567417ENST00000416172PIAS1chr15

68346688

+ZNF609chr15

64970315

+
intron-intronENST00000567417ENST00000559364PIAS1chr15

68346688

+ZNF609chr15

64970315

+

Top

FusionProtFeatures for PIAS1_ZNF609


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIAS1

O75925

ZNF609

O15014

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway, the p53 pathway and the steroidhormone signaling pathway. In vitro, binds A/T-rich DNA. Theeffects of this transcriptional coregulation, transactivation orsilencing, may vary depending upon the biological context.Together with PRMT1, may repress STAT1 transcriptional activity,in the late phase of interferon gamma (IFN-gamma) signaling.Sumoylates PML (at'Lys-65' and 'Lys-160') and PML-RAR and promotestheir ubiquitin-mediated degradation. PIAS1-mediated sumoylationof PML promotes its interaction with CSNK2A1/CK2 which in turnpromotes PML phosphorylation and degradation (By similarity).Enhances the sumoylation of MTA1 and may participate in itsparalog-selective sumoylation. Plays a dynamic role inadipogenesis by promoting the SUMOylation and degradation of CEBPB(By similarity). {ECO:0000250|UniProtKB:O88907,ECO:0000269|PubMed:14500712, ECO:0000269|PubMed:19136629,ECO:0000269|PubMed:21965678}. Transcription factor, which activates RAG1, and possiblyRAG2, transcription. Through the regulation of RAG1/2 expression,may regulate thymocyte maturation. Along with NIPBL and themultiprotein complex Integrator, promotes cortical neuronmigration during brain development by regulating the transcriptionof crucial genes in this process. Preferentially binds promoterscontaining paused RNA polymerase II. Up-regulates the expressionof SEMA3A, NRP1, PLXND1 and GABBR2 genes, among others.{ECO:0000250|UniProtKB:Q8BZ47}. Isoform 2: Involved in the regulation of myoblastproliferation during myogenesis. {ECO:0000269|PubMed:28344082}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZNF609chr15:68346688chr15:64970315ENST00000326648+391333_133611342578Compositional biasNote=Poly-Gly
TgeneZNF609chr15:68346688chr15:64970315ENST00000326648+391366_137111342578Compositional biasNote=Poly-His

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114577_6348652Compositional biasNote=Ser-rich
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+11411_458652DomainSAP
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114124_2888652DomainPINIT
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+11419_238652MotifNote=LXXLL motif
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114368_3808652MotifNuclear localization signal
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+11456_648652MotifNuclear localization signal
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114462_4738652RegionSUMO1-binding
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114520_6158652RegionNote=4 X 4 AA repeats of N-T-S-L
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114520_5238652RepeatNote=1
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114557_5608652RepeatNote=2
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114598_6018652RepeatNote=3%3B approximate
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114612_6158652RepeatNote=4%3B approximate
HgenePIAS1chr15:68346688chr15:64970315ENST00000249636+114320_3978652Zinc fingerSP-RING-type
TgeneZNF609chr15:68346688chr15:64970315ENST00000326648+39725_73511342578Compositional biasNote=Poly-Lys
TgeneZNF609chr15:68346688chr15:64970315ENST00000326648+39952_95511342578Compositional biasNote=Poly-Ser
TgeneZNF609chr15:68346688chr15:64970315ENST00000326648+39495_52011342578Zinc fingerC2H2-type


Top

FusionGeneSequence for PIAS1_ZNF609


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_ZNF609_ENST00000326648_chr15_64970315_+_286aa
MADSAELKEAEPRMWTTVTPAKYSDIKSEDERWKEERDRKLKEERSRSKDSVPKEDGKESTSSDCKLPTSEESRLGSKEPRPSVHVPVSS
PLTQHQSYIPYMHGTSYSQSYDPNHPSYRSMPAVMMQNYPGSYLPSSYSFSPTGSKVSGGEDADKARASPSVTCKSSSESKALDILQQHA
SHYKSKSPTISDKTSQERDRGGCGVVGGGGSCSSVGGASGGERSVDRPRTSPSQRLMSTHHHHHHLGYSLLPAQYNLPTAAGLSSTAIVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_ZNF609_ENST00000326648_chr15_64970315_+_858nt
ATGGCGGACAGTGCGGAACTAAAGGAGGCAGAGCCCCGGATGTGGACATATGTTTATCCTGCCAAGTACTCAGACATCAAGTCAGAGGAT
GAGCGGTGGAAGGAGGAGCGGGACCGCAAATTGAAGGAGGAAAGGAGTCGGAGTAAGGACTCTGTCCCCAAGGAAGATGGGAAGGAAAGC
ACAAGTAGTGACTGCAAGCTGCCCACGTCAGAGGAGTCTCGCCTTGGGAGCAAGGAGCCCCGGCCAAGTGTCCATGTGCCTGTGTCCTCC
CCACTTACCCAGCACCAGTCCTACATCCCCTACATGCACGGCTATTCCTACAGTCAGTCCTACGACCCCAACCACCCCAGCTACCGGAGC
ATGCCTGCTGTGATGATGCAGAACTACCCAGGTTCCTACCTGCCTTCCAGCTACTCTTTTTCCCCATATGGCAGCAAGGTCTCAGGTGGT
GAAGATGCTGACAAGGCACGAGCCAGCCCCAGTGTGACTTGTAAATCCAGCTCAGAGTCCAAAGCCCTGGACATCTTGCAGCAGCATGCC
AGTCACTACAAGAGCAAGTCTCCCACGATAAGTGATAAAACTTCTCAGGAGAGAGATCGAGGAGGCTGTGGGGTGGTTGGGGGTGGTGGC
AGCTGTAGCAGCGTCGGGGGAGCAAGTGGGGGTGAACGGAGTGTTGACCGGCCCCGCACCTCTCCTTCCCAGCGCCTGATGTCCACACAC
CACCACCACCACCACTTGGGGTACTCATTGCTCCCAGCACAGTACAACTTACCCTATGCAGCAGGGCTTTCTTCTACAGCCATTGTTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_ZNF609_ENST00000326648_chr15_64970315_+_5385nt
GGGGCTTCGAGCGCCCTGAGCGGGGCGGAGGCTAGAGGCGGGCTGGGAAGGTGGAGGGGCGGGCCGGGGCGGGGCCAGGCCGGCTAGAGG
GGCGGGTCTAGCGGCGGCCCCCGGCGAAGTTCACTGCGCTTGCGCTGACAGACGCAAGATGGCGGACAGTGCGGAACTAAAGGAGGCAGA
GCCCCGGATGTGGACATATGTTTATCCTGCCAAGTACTCAGACATCAAGTCAGAGGATGAGCGGTGGAAGGAGGAGCGGGACCGCAAATT
GAAGGAGGAAAGGAGTCGGAGTAAGGACTCTGTCCCCAAGGAAGATGGGAAGGAAAGCACAAGTAGTGACTGCAAGCTGCCCACGTCAGA
GGAGTCTCGCCTTGGGAGCAAGGAGCCCCGGCCAAGTGTCCATGTGCCTGTGTCCTCCCCACTTACCCAGCACCAGTCCTACATCCCCTA
CATGCACGGCTATTCCTACAGTCAGTCCTACGACCCCAACCACCCCAGCTACCGGAGCATGCCTGCTGTGATGATGCAGAACTACCCAGG
TTCCTACCTGCCTTCCAGCTACTCTTTTTCCCCATATGGCAGCAAGGTCTCAGGTGGTGAAGATGCTGACAAGGCACGAGCCAGCCCCAG
TGTGACTTGTAAATCCAGCTCAGAGTCCAAAGCCCTGGACATCTTGCAGCAGCATGCCAGTCACTACAAGAGCAAGTCTCCCACGATAAG
TGATAAAACTTCTCAGGAGAGAGATCGAGGAGGCTGTGGGGTGGTTGGGGGTGGTGGCAGCTGTAGCAGCGTCGGGGGAGCAAGTGGGGG
TGAACGGAGTGTTGACCGGCCCCGCACCTCTCCTTCCCAGCGCCTGATGTCCACACACCACCACCACCACCACTTGGGGTACTCATTGCT
CCCAGCACAGTACAACTTACCCTATGCAGCAGGGCTTTCTTCTACAGCCATTGTTGCCAGCCAACAAGGCTCAACTCCCTCACTCTACCC
ACCCCCCAGGAGGTGAGAATGACACCAAGTGCCCGGATAAAGTCAGCTTCACGGGCCCGGACTGGCTTACCCAAGGAGGTGCTGAAGGTG
CCGTTTAGACATCAGTTAAATGGTGTTGATCATCCTGTTTGCCGTTTCCACCATGACTGAAGGCAGACCCTTGGCTATCTCACCTCCACC
AGACCTCCGGACTACCTGACCCTACCTCTTCCTCAGGAGCTGGAGAGCTGGTACTTAGCAAAAATATTTATTCTCTCAGCCACAGTTATG
ACTATTGTGGCCTCTGTGGAGATGAAGGCACGGGAAGCAACCAGGGGAACATGGCCTCAGCCCAGAGAAGCCACTGCTCTGTTCCCCAAG
CCCTTGGTCTGCTGCTGGAGCAGTACCAGCCCCCCCGCCCACCAGGGAGGGACCCCCACCCCCAAGCACTGGGTAAGGTCTGAAGACAGC
ACAGCAGCCATACCCCTCACCATCATTACCACCATCACCAGATTCTGCATCTCCCTAGTGCTTTGCACCCTGGGAATTGGCAGCATGTGG
AGGAACTAGAATCTCAGGAAAGAAATTGGGGGTTGTTTTCTACATAATTGTGAAAACAAGGTCTTCAAATGTGGAGACTTCTCCCCATTT
ACATGAGCACATATAAACGCTCACAACCTAGCCTGGAAAGGAAGACCAAGGCATCTGCCCCAACATGGCCTTGAGCTGCCTGTGAGGCAG
GGGGCAGGGGTTCCAACACCAGCACAGGGCTCCCCAGGGACACTGGGAGCAAGCTGGTGCTGGAGCATGAATGACGTCTGTGAAGTAGAA
CCTGCGTCCCCACTAAGTCCTGCTGCTTCTTATTCCCCAACTCCTTGCCCTTTTCCCTTCCCTCCTAACCCCTTGGTGCCTTTCCCAGGG
GGATCCCCACACTGGTCTTGCCTCTTCTTTTCCACTGCTTGGCTCTTAAGCCTCAGGCAGATAAACTAGTATTCCCCCCAGCTTGGGGAA
CCTTGGAGTCTGCCAGGTCACCTTAGGGCAAGGCCCAGAAGGCAGCCCCTGGGAGCACCCAGCAGTTCTTGGAGATGTCCTGTCATCTAG
CCATCTGATATCTTCCTCATTTGAGGCCACAGATATATACAGCCCAATTCCTCTGTCTACAAGTACATGATTTTATATAGCTCAGTCTAT
AACCTCCATGTGGGCCAATATAAGCTGTGTTTCTTGGTAACACATATTTTGTTTGAGGGGCCACTGGCCATGGGAGGTTATTTGTTCCTT
AGACCCTGGAATAACACATCCAAGCCATTACTTATTAGAGTCTCAGAATGTACTCAGTGGAGCTGTGCTTTGAGGCAGCCAACATTTCTC
TGCTCTCCTTAGAAATGCAGTCTCCCAATGGAAGCTTTATACTCTTTGTACTGGGAAAGTGAGGATGATTTGGTAGCTTTATTGGGGTCA
TGTCTTCCCCAAGGTGTGGGGAGCTTAGCTTACTTGGCTTTTGAGGTATCATCCCTCTGTTCTCCCCTCCTATCTTTCCATGACCCTCTG
GATTGAGAGAGAGAGATAAAGACTGACAGACACCAGTGTAGGCTGGAAAAGGGAGTGTGTGACCAGAGTGCCAAAAGTGACTAGGAGCAG
GAACTTGGCTCCGACTCAGTTTGGAAAATGGGAAATAGGGGACAGTAAGCACAATGCCCAGTAGTAGTTGATTTCCAAGGACCCTGGAAC
CCTACACTTGAGAGGCTTAGGGTCACCATCTGCTCAAGAGGATCCCCTCTGATCTACAGGCCTTTTCCCTAGGTTTCTGCCTCCTCGTTT
TTGTTCAAGTTGGGTTCTGAGTCCTCCCCAAAAACCATTGTTTTAGACCTCTTGGCAGGGCCCCAAAACAGCCTCCCTCATACCCATCAT
TCCCTCTGCCTTCTGCTGCCCTCATGGGCAGTGCTCTGAGCAGTGACCTCCCTTTCCTCCGTGGAAGTAGCTAGTGCAGACACCGTCATC
CCACCCCACCTGAGTCACCCCAACCAAGAGGGTGACTGAATTTCAGCCTGATTATGCCCTCCTGGGGCTCCTGTGAGGTGGAGCCAAGGT
TCCCTCTCTGTTCCTGTTTGTTTTTAAATATTGTTGTGTGTTTTGTATCTGTGGCACTGGCCTGCAGCATACTCTGTATATATTGTAAAG
AAACCGTTAGGAGTAATTTTCTTTTGCATTGGGCAGGCATGGCCCTGCATTCCTGCCCTTTCCACTCATTCTGTAACACAGAGGACGAAC
TTCTGTATTAGCTGGGCAGCCTTGGGTTCTCCAGAAGAGAACAGGTTTTTCTTTTCCTTTTTAATTTTTCTTCTTAAACATTTGGCTCTT
TGATCCTCATATCCAAGTCTCCCCTGAAGAGTAGGAGCTGCTCAGAAGAGCAGGTGAAAGCCACCATGGCAGATCCTGATGCCTGCCGGG
CCTAGTCTTCCCTCTGAAATAACATGAAGCAGCAGCTGTGGAGATTCTTGACAAGTGCTGAGTGAAAGATTTGCTGCCCACCTCTACATG
GGGAGGAGAAACACAGGTGGGAGCTACCTGTGGCATCCATGACCTAGTCAGAGGGATGAGATGCTCAGCAGGGGTCCCCATCCTATCCCA
CCCCACAAACAAAGGCTGGAAAAATTTGCTACCAAGGGCCAAGACCACCAGACCAAGCCTGTTTATGAGCCACCCCTGCCCAGGCCCTCA
CAGACATTGCTCACGGGGCTTCCCATAGAGGAGAAGCTAAAGAGGGAGGGGGCCTCATCCCCAGATAGATCAGGCAAGGCTTGGAGAGCT
GCTCTTTAGGATCCACATCAACTACTTCCTCATTTTAAGGTATGGCAGTTCCCTTCATCCCCTTTTCCTGCCTTGTACATGTACATGTAT
GAAATTTCCTTCTCTTACCGAACTCTCTCCACACATCACAAGGTCAAAGAACCACACGCTTAGAAGGGTAAGAGGGCACCCTATGAAATG
AAATGGTGATTTCTTGAGTCTCTTTTTTCCACGTTTAAGGGGCCATGGCAGGACTTAGAGTTGCGAGTTAAGACTGCAGAGGGCTAGAGA
ATTATTTCATACAGGCTTTGAGGCCACCCATGTCACTTATCCCGTATACCCTCTCACCATCCCCTTGTCTACTCTGATGCCCCCAAGATG
CAACTGGGCAGCTAGTTGGCCCCATAATTCTGGGCCTTTGTTGTTTGTTTTAATTACTTGGGCATCCCAGGAAGCTTTCCAGTGATCTCC
TACCATGGGCCCCCCTCCTGGGATCAAGCCCCTCCCAGGCCCTGTCCCCAGCCCCTCCTGCCCCAGCCCACCCGCTTGCCTTGGTGCTCA
GCCCTCCCATTGGGAGCAGGTTGGGGCGAGCTGGAGGCCCGGGCTGGAGGGGCAGTGTTGCTGTTCATAGATTTTGTTCCATTGGCGTTG
CTCTGTTGAATTTAATTTCAGTCTTCCTGATTCTTCCCTTCTGTAAAGTGTACATTACCAAGTTCCTTGTTTTTTTATATATATATATAA
ATATATATATATACAAACTGTACTCTTTTTGCCTTTGTACATTCAGGCAAGAAGAGAAAATAAATCTTTTTAAGAGACAATCACAAATCT
GTGAGGGCTGCTGGTTATTTCTCCTGGAGTTTGCTGCTGAGCTGCCTCTTCCTTCCTCCCAATTTTCCTGTTCTCCCTCAGCTCTCCTGA
TCTTCCTGGCCCTGCTCCATATGCATCCTCAGCTTCACTTTCCCTGGCTGATGGCAAGCTGTTGAATCCAGTGTCCAGACTACCTGCCTT
GTAACCCTTTTCTGCCCAGCATTGTTTTCTGGCTTGGCCACTGGCTTAGCCCAGGAGCTTTACTCTGTGCCCTGGCCTCCCCTCTCTTCA
CCTTTAGATTTCCATTCACCGAAGTGGCTTTGGACCCCTGGGTACTCTGGGACCTGTTTCCTGGAGGCCCTGGCTTGGGACACTCACCTG
TGAAACTATGCAGCTGGGAGCTCTCTGCCTAAGAGTTTGCACTATTTAAACCTGCCTGGGAGTTAGGACGGATGGTTTTAGGAATGACCG
GAAAACTACCCCTAAAACTCCCCCGACATTCCAGCCTCTAGAATGCTCTGATCCAGAGCTCAGTGGATGATTCCCAGCTGGTGGACTCCT
GTGGCTACCCCATCAGAACAAGGGCTAAGGGTTTATGGGTCAAGAGTATTTGATCAGAATTTTAAAGGGTGGTATACTCTGAAACACAGC
CCAACCAAACCATTGTTTGGCCGCTTTCTCTTTTCCTCTACCTTCCTCATCCCCACTTTTTTCCCTTTCTCTCTACTTCCTCTTCTTAAT


Top

FusionGenePPI for PIAS1_ZNF609


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIAS1STAT1, DNMT3A, STAB2, UBE2I, SUMO1, SP3, TP53, CSRP2, AR, MX1, SUMO2, SIAH1, SIAH2, AKT1, ZMIZ2, BRCA1, MBD1, CREB1, SREBF2, GLUL, MITF, NCOR1, PPARG, TRIM27, ZNF76, JUN, HIC1, DDX5, SATB1, MAML1, DCLRE1A, DNMT3B, RBBP6, SAFB, ESR1, PPP1CA, MDC1, PRDM1, MDM2, CHUK, DNM1, PML, ATXN7, SRSF1, NFATC1, CEBPE, CEBPA, FLI1, CSNK2A1, CASP8AP2, MYB, SERBP1, ZMYND11, RAD54L2, PLAG1, NR1H3, NR1H2, PPARGC1B, PPARGC1A, BARD1, PAXIP1, PPP1CC, HTT, ATXN1, SMAD7, PRPF40A, SKIL, SMAD4, SMAD1, SOX2, SGTA, YWHAZ, SPOP, SUMO3, SHFM1, CBS, L3MBTL2, CEP250, TRIM63, TRIM55, ZNF451, PIAS1, FOXA1, HIF1A, ID1, KLC1, FRAT1, ERP44, POLK, VPS16, PIAS2, PTK2, TERF2, TRIM5, HECTD2, GSK3B, NCOA3, PSME3, TRIM35, GTF2IRD1, NR0B2, EP300ZNF609ATXN1, SOX2, HDAC1, AUTS2, NTRK1, PRKCI, USP7, DYNLL1, ATL3, VWA9, NANOG, EYA2, FLCN, SBSPON, THSD4, PIGT, RCCD1, EXOC5, CYLD, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIAS1_ZNF609


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIAS1_ZNF609


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIAS1C0037274Dermatologic disorders1CTD_human
HgenePIAS1C0311375Arsenic Poisoning1CTD_human