FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27075

FusionGeneSummary for PIAS1_MEF2A

check button Fusion gene summary
Fusion gene informationFusion gene name: PIAS1_MEF2A
Fusion gene ID: 27075
HgeneTgene
Gene symbol

PIAS1

MEF2A

Gene ID

8554

4205

Gene nameprotein inhibitor of activated STAT 1myocyte enhancer factor 2A
SynonymsDDXBP1|GBP|GU/RH-II|ZMIZ3ADCAD1|RSRFC4|RSRFC9|mef2
Cytomap

15q23

15q26.3

Type of geneprotein-codingprotein-coding
DescriptionE3 SUMO-protein ligase PIAS1AR interacting proteinDEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1DEAD/H box-binding protein 1E3 SUMO-protein transferase PIAS1RNA helicase II-binding proteingu-binding proteinprotein inhibitor of activated STAT prmyocyte-specific enhancer factor 2AMADS box transcription enhancer factor 2, polypeptide A (myocyte enhancer factor 2A)serum response factor-like protein 1
Modification date2018052220180523
UniProtAcc

O75925

Q02078

Ensembl transtripts involved in fusion geneENST00000249636, ENST00000545237, 
ENST00000567417, 
ENST00000453228, 
ENST00000354410, ENST00000558856, 
ENST00000558812, ENST00000338042, 
ENST00000557785, ENST00000449277, 
ENST00000557942, 
Fusion gene scores* DoF score5 X 3 X 4=605 X 4 X 4=80
# samples 55
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PIAS1 [Title/Abstract] AND MEF2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIAS1

GO:0016925

protein sumoylation

18579533

HgenePIAS1

GO:0033235

positive regulation of protein sumoylation

17696781|21965678

TgeneMEF2A

GO:0000122

negative regulation of transcription by RNA polymerase II

16484498

TgeneMEF2A

GO:0000165

MAPK cascade

9858528

TgeneMEF2A

GO:0006351

transcription, DNA-templated

16043483

TgeneMEF2A

GO:0010613

positive regulation of cardiac muscle hypertrophy

24161931

TgeneMEF2A

GO:0045944

positive regulation of transcription by RNA polymerase II

7760790|9858528|10748098|15466416|20590529|21468593

TgeneMEF2A

GO:0071277

cellular response to calcium ion

16484498


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A1KY-01APIAS1chr15

68346688

+MEF2Achr15

100211528

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000249636ENST00000453228PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000354410PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000558856PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000558812PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000338042PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000557785PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000449277PIAS1chr15

68346688

+MEF2Achr15

100211528

+
5CDS-intronENST00000249636ENST00000557942PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-3CDSENST00000545237ENST00000453228PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000354410PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000558856PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000558812PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000338042PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000557785PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000449277PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000545237ENST00000557942PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-3CDSENST00000567417ENST00000453228PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000354410PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000558856PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000558812PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000338042PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000557785PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000449277PIAS1chr15

68346688

+MEF2Achr15

100211528

+
intron-intronENST00000567417ENST00000557942PIAS1chr15

68346688

+MEF2Achr15

100211528

+

Top

FusionProtFeatures for PIAS1_MEF2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIAS1

O75925

MEF2A

Q02078

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway, the p53 pathway and the steroidhormone signaling pathway. In vitro, binds A/T-rich DNA. Theeffects of this transcriptional coregulation, transactivation orsilencing, may vary depending upon the biological context.Together with PRMT1, may repress STAT1 transcriptional activity,in the late phase of interferon gamma (IFN-gamma) signaling.Sumoylates PML (at'Lys-65' and 'Lys-160') and PML-RAR and promotestheir ubiquitin-mediated degradation. PIAS1-mediated sumoylationof PML promotes its interaction with CSNK2A1/CK2 which in turnpromotes PML phosphorylation and degradation (By similarity).Enhances the sumoylation of MTA1 and may participate in itsparalog-selective sumoylation. Plays a dynamic role inadipogenesis by promoting the SUMOylation and degradation of CEBPB(By similarity). {ECO:0000250|UniProtKB:O88907,ECO:0000269|PubMed:14500712, ECO:0000269|PubMed:19136629,ECO:0000269|PubMed:21965678}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMEF2Achr15:68346688chr15:100211528ENST00000354410+011141_186-210500Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000354410+011420_446-210500Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000354410+0114_31-210500Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000449277+19141_18618430Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000449277+19420_44618430Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000453228+210141_18686498Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000453228+210420_44686498Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557785+311141_18686498Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557785+311420_44686498Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557942+312141_18686506Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557942+312420_44686506Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000558812+110141_18618438Compositional biasNote=Ser/Thr-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000558812+110420_44618438Compositional biasNote=Gln/Pro-rich
TgeneMEF2Achr15:68346688chr15:100211528ENST00000354410+01158_86-210500DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000449277+1958_8618430DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000558812+11058_8618438DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000354410+0113_57-210500DomainMADS-box

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114577_6348652Compositional biasNote=Ser-rich
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+11411_458652DomainSAP
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114124_2888652DomainPINIT
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+11419_238652MotifNote=LXXLL motif
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114368_3808652MotifNuclear localization signal
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+11456_648652MotifNuclear localization signal
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114462_4738652RegionSUMO1-binding
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114520_6158652RegionNote=4 X 4 AA repeats of N-T-S-L
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114520_5238652RepeatNote=1
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114557_5608652RepeatNote=2
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114598_6018652RepeatNote=3%3B approximate
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114612_6158652RepeatNote=4%3B approximate
HgenePIAS1chr15:68346688chr15:100211528ENST00000249636+114320_3978652Zinc fingerSP-RING-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000449277+194_3118430Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000453228+2104_3186498Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557785+3114_3186498Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557942+3124_3186506Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000558812+1104_3118438Compositional biasNote=Lys-rich (basic)
TgeneMEF2Achr15:68346688chr15:100211528ENST00000453228+21058_8686498DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557785+31158_8686498DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557942+31258_8686506DNA bindingMef2-type
TgeneMEF2Achr15:68346688chr15:100211528ENST00000449277+193_5718430DomainMADS-box
TgeneMEF2Achr15:68346688chr15:100211528ENST00000453228+2103_5786498DomainMADS-box
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557785+3113_5786498DomainMADS-box
TgeneMEF2Achr15:68346688chr15:100211528ENST00000557942+3123_5786506DomainMADS-box
TgeneMEF2Achr15:68346688chr15:100211528ENST00000558812+1103_5718438DomainMADS-box


Top

FusionGeneSequence for PIAS1_MEF2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_MEF2A_ENST00000453228_chr15_100211528_+_420aa
MADSAELKTLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIFKRGPPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA
SSTLTDSSMLSPPQTTLHRNVSPGAPQRPPSTGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKVMPTKSPPPPG
GGNLGMNSRKPDLRVVIPPSSKGMMPPLNTQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDTSLTSADLSALQGFNSPGM
LSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEPISPPRDRMTPSGFQQQQQQQQQQQPPPPPQPQPQPPQPQPRQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_MEF2A_ENST00000453228_chr15_100211528_+_1260nt
ATGGCGGACAGTGCGGAACTAAAGACTTTAAGAAAGAAAGGCCTTAATGGTTGTGAGAGCCCTGATGCTGACGATTACTTTGAGCACAGT
CCACTCTCGGAGGACAGATTCAGCAAACTAAATGAAGATAGTGATTTTATTTTCAAACGAGGCCCTCCTGGTCTGCCACCTCAGAACTTT
TCAATGTCTGTCACAGTTCCAGTGACCAGCCCCAATGCTTTGTCCTACACTAACCCAGGGAGTTCACTGGTGTCCCCATCTTTGGCAGCC
AGCTCAACGTTAACAGATTCAAGCATGCTCTCTCCACCTCAAACCACATTACATAGAAATGTGTCTCCTGGAGCTCCTCAGAGACCACCA
AGTACTGGCAATGCAGGTGGGATGTTGAGCACTACAGACCTCACAGTGCCAAATGGAGCTGGAAGCAGTCCAGTGGGGAATGGATTTGTA
AACTCAAGAGCTTCTCCAAATTTGATTGGAGCTACTGGTGCAAATAGCTTAGGCAAAGTCATGCCTACAAAGTCTCCCCCTCCACCAGGT
GGTGGTAATCTTGGAATGAACAGTAGGAAACCAGATCTTCGAGTTGTCATCCCCCCTTCAAGCAAGGGCATGATGCCTCCACTAAATACC
CAGAGGATCAGTAGTTCTCAAGCCACTCAACCTCTTGCTACCCCAGTCGTGTCTGTGACAACCCCAAGCTTGCCTCCGCAAGGACTTGTG
TACTCAGCAATGCCGACTGCCTACAACACTGATTATTCACTGACCAGCGCTGACCTGTCAGCCCTTCAAGGCTTCAACTCGCCAGGAATG
CTGTCGCTGGGACAGGTGTCGGCCTGGCAGCAGCACCACCTAGGACAAGCAGCCCTCAGCTCTCTTGTTGCTGGAGGGCAGTTATCTCAG
GGTTCCAATTTATCCATTAATACCAACCAAAACATCAGCATCAAGTCCGAACCGATTTCACCTCCTCGGGATCGTATGACCCCATCGGGC
TTCCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCGCCGCCACCACCGCAGCCCCAGCCACAACCCCCGCAGCCCCAGCCCCGACAG
GAAATGGGGCGCTCCCCTGTGGACAGTCTGAGCAGCTCTAGTAGCTCCTATGATGGCAGTGATCGGGAGGATCCACGGGGCGACTTCCAT
TCTCCAATTGTGCTTGGCCGACCCCCAAACACTGAGGACAGAGAAAGCCCTTCTGTAAAGCGAATGAGGATGGACGCGTGGGTGACCTAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIAS1_ENST00000249636_chr15_68346688_+_MEF2A_ENST00000453228_chr15_100211528_+_5059nt
GGGGCTTCGAGCGCCCTGAGCGGGGCGGAGGCTAGAGGCGGGCTGGGAAGGTGGAGGGGCGGGCCGGGGCGGGGCCAGGCCGGCTAGAGG
GGCGGGTCTAGCGGCGGCCCCCGGCGAAGTTCACTGCGCTTGCGCTGACAGACGCAAGATGGCGGACAGTGCGGAACTAAAGACTTTAAG
AAAGAAAGGCCTTAATGGTTGTGAGAGCCCTGATGCTGACGATTACTTTGAGCACAGTCCACTCTCGGAGGACAGATTCAGCAAACTAAA
TGAAGATAGTGATTTTATTTTCAAACGAGGCCCTCCTGGTCTGCCACCTCAGAACTTTTCAATGTCTGTCACAGTTCCAGTGACCAGCCC
CAATGCTTTGTCCTACACTAACCCAGGGAGTTCACTGGTGTCCCCATCTTTGGCAGCCAGCTCAACGTTAACAGATTCAAGCATGCTCTC
TCCACCTCAAACCACATTACATAGAAATGTGTCTCCTGGAGCTCCTCAGAGACCACCAAGTACTGGCAATGCAGGTGGGATGTTGAGCAC
TACAGACCTCACAGTGCCAAATGGAGCTGGAAGCAGTCCAGTGGGGAATGGATTTGTAAACTCAAGAGCTTCTCCAAATTTGATTGGAGC
TACTGGTGCAAATAGCTTAGGCAAAGTCATGCCTACAAAGTCTCCCCCTCCACCAGGTGGTGGTAATCTTGGAATGAACAGTAGGAAACC
AGATCTTCGAGTTGTCATCCCCCCTTCAAGCAAGGGCATGATGCCTCCACTAAATACCCAGAGGATCAGTAGTTCTCAAGCCACTCAACC
TCTTGCTACCCCAGTCGTGTCTGTGACAACCCCAAGCTTGCCTCCGCAAGGACTTGTGTACTCAGCAATGCCGACTGCCTACAACACTGA
TTATTCACTGACCAGCGCTGACCTGTCAGCCCTTCAAGGCTTCAACTCGCCAGGAATGCTGTCGCTGGGACAGGTGTCGGCCTGGCAGCA
GCACCACCTAGGACAAGCAGCCCTCAGCTCTCTTGTTGCTGGAGGGCAGTTATCTCAGGGTTCCAATTTATCCATTAATACCAACCAAAA
CATCAGCATCAAGTCCGAACCGATTTCACCTCCTCGGGATCGTATGACCCCATCGGGCTTCCAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCAGCCGCCGCCACCACCGCAGCCCCAGCCACAACCCCCGCAGCCCCAGCCCCGACAGGAAATGGGGCGCTCCCCTGTGGACAGTCTGAG
CAGCTCTAGTAGCTCCTATGATGGCAGTGATCGGGAGGATCCACGGGGCGACTTCCATTCTCCAATTGTGCTTGGCCGACCCCCAAACAC
TGAGGACAGAGAAAGCCCTTCTGTAAAGCGAATGAGGATGGACGCGTGGGTGACCTAAGGCTTCCAAGCTGATGTTTGTACTTTTGTGTT
ACTGCAGTGACCTGCCCTACATATCTAAATCGGTAAATAAGGACATGAGTTAAATATATTTATATGTACATACATATATATATCCCTTTA
CATATATATGTATGTGGGTGTGAGTGTGTATGTGTGGGTGTGTGTTACATACACAGAATCAGGCACTTACCTGCAAACTCCTTGTAGGTC
TGCAGATGTGTGTCCCATGGCAGACAAAGCACCCTGTAGGCACAGACAAGTCTGGCACTTCCTTGGACTACTTGTTTCGTAAAGATAACC
AGTTTTTGCAGAGAAACGTGTACCCATATATAATTCTCCCACACTAGCTTGCAGAAACCTAGAGGGCCCCCTACTTGTTTTATTTAACTG
TGCAGTGACTGTAGTTACTTAAGAGAAAATGCTTTGTAGAACAGAGCAGTAGAAAAGCAGGAACCAAGAAAGCAATACTGTACATAAAAT
GTCATTTATATTTTCCAACCTGGCATGGGTGTCTGTTGCAAAGGGGTGCATGGGAAAGGGCTGTTGATATTAAAAACAAACAAAACAAAA
AAGCCCCACACATAACTGTTTTGCACGTGCAAAAATGTATTGGGTCAAGAAGTGATCTTTAGCTAATAAAGAAAGAGAATAGAAAACACG
CATGAGATATTCAGAAAATACTAGCCTAGAAATATAGAGCATTAACAAAGTAAAATTAATATATTAAGTTATAATTGGAATATGTCAGAA
GTTTCTTTTTACATTCATATCTTAAAAATTAAAGAAACTGATTTTAGCTCATGTATATTTTATATGAAAGAAAACACCCTTATGAATTGA
TGACTATATATAAAATTATATTCACTACTTTTGAACACATTCTGCTATGAATTATTTATATAAGCCAAAGCTATATGTTGTAACTTTTTT
TTAGAGAATAGCTTTATCTTGGTTTAACTCTTTAGTTTTATTTTAAGAGGGGAAAACAAAAATATCTTGCAAGCAGAACCTTGGAAAAAA
AAAGCCATGAACACTTATTCTAAATGTAAATTAAAAGTTGAGCCAAACTCTTTGTGTATATAGCATCTTAAATATATTATCACCTTTGAT
GTAAGTACCTATGTATTGTATGGTCACCAGATTAAAAAGTATATTTTTGTGGATTGCCGCCAATCTGGGGGGAAAAGGCGAGGTCCTTTA
TTAAGTATTCACTGTTTAATATTTACTATTTTGTTAAATATACTGTACTTTGGATTTTAATTATTAGCCCAGTTTTTTCAGAGGATTGTA
TAAAGGGGTTTCTCCCCTCACTGGTGGTGAATGTGTGATGTTACATTGTAATCTTTGTGCTGTATGGGTTGAGCATCATTATATATTTTG
TATGTGTACATAAATAGCAAAGTGGCAAAAAAAATTGGTGTTAAGTTCATCCTGCATAAGTATAAAATGTGTTGTAACAGATTTTGTAAG
GCATTATTTAAAACTTGCCTTTTGTGAGGAAAAAATGTAGTAGAAAAAGCTGACCTAATTTAATTAATATTAGAGAAAATGGCAAAATAG
TAGATGAGCACAAAGGTTTTATAAGTGGTAAATGATTAGGGGAAAATAATCATGGGGAAAGGGATCTTTTTTCCTTGACCCTCTGAAAAC
AGAACGATGCAGCTGGTTACAAAATCCTACCGTTATCAGCTCTTCTGCACATTGCAGTGATGCTTTGGTATGCGGGGAGAAACACTCTTA
GGGTGCTGGTCCTTGGCATGACTCTTGCCATTCTAATTGGAATTAGTGCCACCCTCAGCTTGGATTTTGAACAAGGCCTTATTCTTTCAG
GAAGACAACTAATGGATGATAGCAAGTTCATCCACTTACTGGGCTTGTGCCATGAGCAAAATTCAAAGTCCTGTATATCTTTCATTGTAG
ATTTTTAAATACTCCTTTTCCTAAAAAACTCAAGGGTTTAAAAATTGCTATTTTATATTTTAAATGATATTGAGCAGCTACCTACAATTT
CTATGTACATTTTGTTCCCCCCCCCCCACCCCCCCCCCAAATTACGTTCCTTTTGACATTTTCCTCATCTGCTGTTTGTGACAAGTCATC
AGCCAGATTTCCTGACTGACACATAGGTATGATCAGTGCAGGAGAGACCTGCGCACCACAGGCTGCAAACTGGAGGTTCTGTTCTCATGG
CAGTTTGGGCAGTAACTTTTGAGAGAGGCCAAAAAAAGGAGGATGACATGCTGTCTCCTCTCTTCAGTATAGACATTAGGCTCTTATTCA
GAAAGGATTTTTCTTTAAAAATGTACTTACTTTACTGAACTACTTACAGGCACATTTCTTCATAAGGCCACACCTAATCCAAACAAGACA
GTCTCCCAACACTGAAGTTCCAAAATAATCCTTACCACTTTGTAAACCATTTATAGCTTTGAAAGTGTTAAGTGATTCCTTCGTTATTAT
TTATGCATGTTCATGAACTTCTGCTGTACATTGGAATAGGAGTTAACACATTCACATTTACTGTCTATTTTCTTGTGTGCCTTATGAGAT
GGCTTTTCTGACTGTATCTCAATAGTCTTTCTTTCTATGCAGGTTTATAATCAGTACAACTACTGTTTTCTAAAATACTACTACTCAAGG
CTCGGAGTTTGTATTTAAATTACACTGACCAAGTAACAATGTATTCCATTTCAGGAACTGAATATTTGACTGTTAACCTTTTTCCCATAC
GTCCAGTGTGGCATGGAGCATATGGACTTGACAGACATCTCTCACCCAGACGCCCACGTGTGAACACACCCACATCCACATCTCTGGGTG
GAAACCAGCCTAGAGAGGGGACGACGCTAATGGTGTTGCTTTAGAACCGTCTTTTCTTACCCTTTTAGACTCGTGTTTTGTATGAGACAC
CATTGCAAGAAAATTTTATCCCTCCAGAAGTATTTTATTACTAAAGAACAAAAGCAAAAAAAGCTTAAATTGCACTGGTTAAAGTACAGT
TTCCAACAGCTGTCCTTCCTCAGTACTCTAATGGCCACTCCACCGCGAGTGGAAGTCACTGTTGTGTGTACACAGGTGGTCCCAATCAAA
ACTCCATCTTTTGAGCCCAATTATGTCCATTTTGTTATAGACTAAATCAGGGGTTTGTTCTACAAGAACAATACATGTTTTACCCTTTCC
TTTAACTAGAAGGATAACTAGTAATGCATCAACATAATTTCTGTATTAACCATCATGCGCACAAGAAATACATAGTAAATAAGGAAGCTG
AAAACTCCTGGCATTGGATCTTAAGCTAGATGATTAGAATGTGAAAAAGATTTTACAAATGTAAAACTTCTATTTCTCTGTAGAAACTTT
CTTCACTTTGCTGTGCAAGAAGACACTGCTTTGCTATATTTAAAATGGCTTTTTTAAAAGAGATTTATGTATTTGGTAAATGTTTGTAGT
CAACAGTTCACACAAGAAGCTGTACACGGTTTGATCATGTAAAACCGTTTGGCGGCACAAGCTGGACTTTGTTGCCATCCTTGAGATGAA
CCTTTTAAGAAAAATAAGTTAATCTCAATTTTTCCCTGAATGTGTTGTTTTTCTTCATTATACAATAAATATAATAGTGAACTTTTTATC


Top

FusionGenePPI for PIAS1_MEF2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIAS1STAT1, DNMT3A, STAB2, UBE2I, SUMO1, SP3, TP53, CSRP2, AR, MX1, SUMO2, SIAH1, SIAH2, AKT1, ZMIZ2, BRCA1, MBD1, CREB1, SREBF2, GLUL, MITF, NCOR1, PPARG, TRIM27, ZNF76, JUN, HIC1, DDX5, SATB1, MAML1, DCLRE1A, DNMT3B, RBBP6, SAFB, ESR1, PPP1CA, MDC1, PRDM1, MDM2, CHUK, DNM1, PML, ATXN7, SRSF1, NFATC1, CEBPE, CEBPA, FLI1, CSNK2A1, CASP8AP2, MYB, SERBP1, ZMYND11, RAD54L2, PLAG1, NR1H3, NR1H2, PPARGC1B, PPARGC1A, BARD1, PAXIP1, PPP1CC, HTT, ATXN1, SMAD7, PRPF40A, SKIL, SMAD4, SMAD1, SOX2, SGTA, YWHAZ, SPOP, SUMO3, SHFM1, CBS, L3MBTL2, CEP250, TRIM63, TRIM55, ZNF451, PIAS1, FOXA1, HIF1A, ID1, KLC1, FRAT1, ERP44, POLK, VPS16, PIAS2, PTK2, TERF2, TRIM5, HECTD2, GSK3B, NCOA3, PSME3, TRIM35, GTF2IRD1, NR0B2, EP300MEF2AVGLL4, HDAC4, HDAC9, THRA, EP300, HDAC5, SMAD2, MAPK14, ASCL1, MYOG, MAPK7, MEF2D, ACTN4, HDAC7, HDAC1, HNRNPA1, UBE2I, PHB2, ERBB2IP, DDB1, NDUFB9, GNB2, GNG12, TBP, TAF8, HDAC3, HAND1, XPO1, KLC4, JUN, ATF3, ATF7, CABIN1, HIST1H2BA, MEF2C, HIRA, REV3L, SH2B1, HIST1H2BC, HIST3H3, JUND, CCDC15, MAPKAPK3, SETX, TTLL7, ZCWPW1, ITGB1, MEF2B, XYLT1, DNMT3L, TSR3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIAS1_MEF2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIAS1_MEF2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIAS1C0037274Dermatologic disorders1CTD_human
HgenePIAS1C0311375Arsenic Poisoning1CTD_human
TgeneMEF2AC0033975Psychotic Disorders1PSYGENET
TgeneMEF2AC0349204Nonorganic psychosis1PSYGENET