FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 27073

FusionGeneSummary for PIAS1_HMCN2

check button Fusion gene summary
Fusion gene informationFusion gene name: PIAS1_HMCN2
Fusion gene ID: 27073
HgeneTgene
Gene symbol

PIAS1

HMCN2

Gene ID

8554

256158

Gene nameprotein inhibitor of activated STAT 1hemicentin 2
SynonymsDDXBP1|GBP|GU/RH-II|ZMIZ3-
Cytomap

15q23

9q34.11

Type of geneprotein-codingprotein-coding
DescriptionE3 SUMO-protein ligase PIAS1AR interacting proteinDEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1DEAD/H box-binding protein 1E3 SUMO-protein transferase PIAS1RNA helicase II-binding proteingu-binding proteinprotein inhibitor of activated STAT prhemicentin-2
Modification date2018052220180523
UniProtAcc

O75925

Q8NDA2

Ensembl transtripts involved in fusion geneENST00000249636, ENST00000545237, 
ENST00000567417, 
ENST00000428715, 
ENST00000487727, ENST00000302481, 
Fusion gene scores* DoF score5 X 3 X 4=603 X 3 X 3=27
# samples 53
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: PIAS1 [Title/Abstract] AND HMCN2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePIAS1

GO:0016925

protein sumoylation

18579533

HgenePIAS1

GO:0033235

positive regulation of protein sumoylation

17696781|21965678


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-KK-A7B1-01APIAS1chr15

68379088

+HMCN2chr9

133297964

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000249636ENST00000428715PIAS1chr15

68379088

+HMCN2chr9

133297964

+
5CDS-intronENST00000249636ENST00000487727PIAS1chr15

68379088

+HMCN2chr9

133297964

+
5CDS-intronENST00000249636ENST00000302481PIAS1chr15

68379088

+HMCN2chr9

133297964

+
In-frameENST00000545237ENST00000428715PIAS1chr15

68379088

+HMCN2chr9

133297964

+
5CDS-intronENST00000545237ENST00000487727PIAS1chr15

68379088

+HMCN2chr9

133297964

+
5CDS-intronENST00000545237ENST00000302481PIAS1chr15

68379088

+HMCN2chr9

133297964

+
intron-3CDSENST00000567417ENST00000428715PIAS1chr15

68379088

+HMCN2chr9

133297964

+
intron-intronENST00000567417ENST00000487727PIAS1chr15

68379088

+HMCN2chr9

133297964

+
intron-intronENST00000567417ENST00000302481PIAS1chr15

68379088

+HMCN2chr9

133297964

+

Top

FusionProtFeatures for PIAS1_HMCN2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PIAS1

O75925

HMCN2

Q8NDA2

Functions as an E3-type small ubiquitin-like modifier(SUMO) ligase, stabilizing the interaction between UBE2I and thesubstrate, and as a SUMO-tethering factor. Plays a crucial role asa transcriptional coregulation in various cellular pathways,including the STAT pathway, the p53 pathway and the steroidhormone signaling pathway. In vitro, binds A/T-rich DNA. Theeffects of this transcriptional coregulation, transactivation orsilencing, may vary depending upon the biological context.Together with PRMT1, may repress STAT1 transcriptional activity,in the late phase of interferon gamma (IFN-gamma) signaling.Sumoylates PML (at'Lys-65' and 'Lys-160') and PML-RAR and promotestheir ubiquitin-mediated degradation. PIAS1-mediated sumoylationof PML promotes its interaction with CSNK2A1/CK2 which in turnpromotes PML phosphorylation and degradation (By similarity).Enhances the sumoylation of MTA1 and may participate in itsparalog-selective sumoylation. Plays a dynamic role inadipogenesis by promoting the SUMOylation and degradation of CEBPB(By similarity). {ECO:0000250|UniProtKB:O88907,ECO:0000269|PubMed:14500712, ECO:0000269|PubMed:19136629,ECO:0000269|PubMed:21965678}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+21411_45156652DomainSAP
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+21419_23156652MotifNote=LXXLL motif
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+21456_64156652MotifNuclear localization signal
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041066_1159-85221DomainIg-like C2-type 7
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041164_1244-85221DomainIg-like C2-type 8
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041265_1338-85221DomainIg-like C2-type 9
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041343_1429-85221DomainIg-like C2-type 10
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041436_1525-85221DomainIg-like C2-type 11
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041530_1618-85221DomainIg-like C2-type 12
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041623_1714-85221DomainIg-like C2-type 13
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041717_1805-85221DomainIg-like C2-type 14
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041810_1887-85221DomainIg-like C2-type 15
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041894_1982-85221DomainIg-like C2-type 16
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+041985_2074-85221DomainIg-like C2-type 17
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042079_2165-85221DomainIg-like C2-type 18
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042170_2261-85221DomainIg-like C2-type 19
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042264_2353-85221DomainIg-like C2-type 20
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042358_2447-85221DomainIg-like C2-type 21
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042452_2540-85221DomainIg-like C2-type 22
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042545_2636-85221DomainIg-like C2-type 23
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042641_2732-85221DomainIg-like C2-type 24
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042739_2833-85221DomainIg-like C2-type 25
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042849_2938-85221DomainIg-like C2-type 26
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+042945_3032-85221DomainIg-like C2-type 27
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043037_3127-85221DomainIg-like C2-type 28
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043131_3219-85221DomainIg-like C2-type 29
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043224_3314-85221DomainIg-like C2-type 30
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043319_3406-85221DomainIg-like C2-type 31
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043412_3497-85221DomainIg-like C2-type 32
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043502_3588-85221DomainIg-like C2-type 33
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043593_3681-85221DomainIg-like C2-type 34
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043686_3772-85221DomainIg-like C2-type 35
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043777_3848-85221DomainIg-like C2-type 36
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043851_3937-85221DomainIg-like C2-type 37
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+0438_205-85221DomainNote=VWFA
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+043942_4027-85221DomainIg-like C2-type 38
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044031_4118-85221DomainIg-like C2-type 39
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044123_4204-85221DomainIg-like C2-type 40
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044212_4295-85221DomainIg-like C2-type 41
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044303_4388-85221DomainIg-like C2-type 42
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044392_4614-85221DomainNidogen G2 beta-barrel
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044628_4668-85221DomainEGF-like 1%3B calcium-binding
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044669_4712-85221DomainEGF-like 2%3B calcium-binding
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044713_4751-85221DomainEGF-like 3%3B calcium-binding
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044756_4796-85221DomainEGF-like 4%3B calcium-binding
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+044863_4902-85221DomainEGF-like 5%3B calcium-binding
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04517_602-85221DomainIg-like C2-type 1
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04607_690-85221DomainIg-like C2-type 2
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04697_780-85221DomainIg-like C2-type 3
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04785_879-85221DomainIg-like C2-type 4
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04884_970-85221DomainIg-like C2-type 5
TgeneHMCN2chr15:68379088chr9:133297964ENST00000302481+04975_1061-85221DomainIg-like C2-type 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214577_634156652Compositional biasNote=Ser-rich
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214124_288156652DomainPINIT
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214368_380156652MotifNuclear localization signal
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214462_473156652RegionSUMO1-binding
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214520_615156652RegionNote=4 X 4 AA repeats of N-T-S-L
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214520_523156652RepeatNote=1
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214557_560156652RepeatNote=2
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214598_601156652RepeatNote=3%3B approximate
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214612_615156652RepeatNote=4%3B approximate
HgenePIAS1chr15:68379088chr9:133297964ENST00000249636+214320_397156652Zinc fingerSP-RING-type


Top

FusionGeneSequence for PIAS1_HMCN2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PIAS1_ENST00000249636_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_826aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELTRRRFPQKIMTPADLSIPNVHSSPMPATLS
PSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDELIKPTSLGEPQGSWGSMTGVINGRKFGVATL
NTSVMQEAHSGVSSIHSSIRHVPANVGPLMRVLVVTIAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGELLTMTQVARGLDPDGL
LLLDVVVNGVVPESLADADLQVQDFEEHYVQTGPGQLFVGSTQRFFQGGLPSFLRCNHSIQYNAARGPQPQLVQHLRASAISSAFDPEAE
ALRFQLATALQAEENEVGCPEGFELDSQGAFCVDRDECSGGPSPCSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCREGQ
RCVNLLGSYRCLPDCGPGFRVADGAGCEDVDECLEGLDDCHYNQLCENTPGGHRCSCPRGYRMQGPSLPCLDVNECLQLPKACAYQCHNL
QGSYRCLCPPGQTLLRDGKACTSLERNGQNVTTVSHRGPLLPWLRPWASIPGTSYHAWVSLRPGPMALSSVGRAWCPPGFIRQNGVCTDL
DECRVRNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCFRRCSQD
CGTGGPSTLQYRLLPLPLGVRAHHDVARLTAFSEVGVPANRTELSMLEPDPRSPFALRPLRAGLGAVYTRRALTRAGLYRLTVRAAAPRH

>In-frame_PIAS1_ENST00000545237_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_828aa
MFTLQDSTVKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKELTRRRFPQKIMTPADLSIPNVHSSPMPAT
LSPSTIPQLTYDGHPASSPLLPVSLLGPKHELELPHLTSALHPVHPDIKLQKLPFTDLLDELIKPTSLGEPQGSWGSMTGVINGRKFGVA
TLNTSVMQEAHSGVSSIHSSIRHVPANVGPLMRVLVVTIAPIYWALARESGEALNGHSLTGGRFRQESHVEFATGELLTMTQVARGLDPD
GLLLLDVVVNGVVPESLADADLQVQDFEEHYVQTGPGQLFVGSTQRFFQGGLPSFLRCNHSIQYNAARGPQPQLVQHLRASAISSAFDPE
AEALRFQLATALQAEENEVGCPEGFELDSQGAFCVDRDECSGGPSPCSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLCRE
GQRCVNLLGSYRCLPDCGPGFRVADGAGCEDVDECLEGLDDCHYNQLCENTPGGHRCSCPRGYRMQGPSLPCLDVNECLQLPKACAYQCH
NLQGSYRCLCPPGQTLLRDGKACTSLERNGQNVTTVSHRGPLLPWLRPWASIPGTSYHAWVSLRPGPMALSSVGRAWCPPGFIRQNGVCT
DLDECRVRNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGPGQMCFNTRGSYQCVDTPCPATYRQGPSPGTCFRRCS
QDCGTGGPSTLQYRLLPLPLGVRAHHDVARLTAFSEVGVPANRTELSMLEPDPRSPFALRPLRAGLGAVYTRRALTRAGLYRLTVRAAAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PIAS1_ENST00000249636_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_2478nt
ATGGCGGACAGTGCGGAACTAAAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAG
CACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTC
TATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCT
CCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTG
GAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTG
ATAAAACCCACCAGTCTAGGGGAGCCCCAGGGGAGCTGGGGCAGCATGACTGGGGTGATAAATGGCCGGAAATTTGGCGTGGCCACACTC
AACACCAGCGTGATGCAGGAGGCACACTCCGGGGTCAGCAGCATCCACAGCAGCATCCGCCATGTCCCAGCAAACGTGGGGCCTCTGATG
CGGGTGCTCGTGGTCACCATCGCCCCCATCTACTGGGCCCTGGCCAGAGAGAGTGGGGAAGCCCTGAATGGCCACTCTCTGACTGGGGGC
AGGTTCCGGCAGGAGTCACACGTGGAGTTTGCTACAGGGGAGCTGCTCACGATGACCCAGGTGGCCCGGGGTCTGGATCCCGATGGCCTC
CTGCTCCTCGACGTGGTGGTCAATGGCGTTGTCCCCGAGAGCCTGGCTGACGCAGATCTTCAAGTGCAGGACTTTGAGGAGCACTACGTG
CAAACAGGGCCTGGCCAGCTGTTCGTGGGCTCCACACAGCGCTTCTTCCAGGGCGGCCTCCCCTCGTTCCTACGCTGCAACCACAGCATC
CAGTACAACGCGGCCCGGGGCCCCCAGCCCCAGCTGGTGCAGCACCTGCGGGCCTCAGCTATCAGCTCGGCCTTTGATCCAGAGGCCGAG
GCCCTGCGCTTCCAGCTCGCTACAGCCCTGCAGGCGGAGGAGAACGAGGTCGGCTGCCCCGAGGGCTTTGAGCTGGACTCCCAGGGAGCG
TTTTGTGTGGACAGGGACGAGTGCTCAGGAGGCCCTAGCCCCTGCTCCCATGCCTGCCTTAATGCACCCGGCCGCTTCTCCTGCACCTGC
CCCACTGGCTTCGCCCTGGCCTGGGATGACAGGAACTGCAGAGATGTGGACGAGTGTGCGTGGGATGCTCACCTCTGCCGAGAGGGACAG
CGCTGTGTGAACCTGCTCGGGTCCTACCGCTGCCTCCCCGACTGTGGGCCTGGCTTCCGGGTGGCTGATGGGGCCGGCTGTGAAGATGTG
GACGAATGCCTGGAGGGGTTGGACGACTGTCACTACAACCAGCTCTGCGAGAACACCCCAGGCGGTCACCGCTGCAGCTGCCCCAGGGGT
TACCGGATGCAGGGCCCCAGCCTGCCCTGCCTAGATGTCAATGAGTGCCTGCAGCTGCCCAAGGCCTGCGCCTACCAGTGCCACAACCTC
CAGGGCAGCTACCGCTGCCTGTGCCCCCCAGGCCAGACCCTCCTTCGCGACGGCAAGGCCTGCACCTCACTGGAGCGGAATGGACAAAAT
GTGACCACCGTCAGCCACCGAGGCCCTCTATTGCCCTGGCTGCGGCCCTGGGCCTCGATCCCCGGTACCTCCTACCACGCCTGGGTCTCT
CTCCGTCCGGGTCCCATGGCCCTGAGCAGTGTGGGCCGGGCCTGGTGCCCTCCTGGTTTCATCAGGCAGAACGGAGTCTGCACAGACCTT
GACGAGTGCCGCGTGAGGAACCTGTGTCAGCACGCCTGCCGCAACACTGAGGGCAGCTACCAGTGCCTGTGCCCCGCCGGCTACCGTCTG
CTCCCCAGCGGGAAGAACTGCCAGGACATCAACGAGTGCGAGGAGGAGAGCATCGAGTGTGGACCCGGCCAGATGTGCTTCAACACCCGT
GGCAGCTACCAGTGTGTGGACACACCCTGTCCTGCCACCTACCGGCAGGGCCCCAGCCCTGGGACGTGCTTCCGGCGCTGCTCGCAGGAC
TGCGGCACGGGCGGCCCCTCTACGCTGCAGTACCGGCTGCTGCCGCTGCCCCTGGGCGTGCGCGCCCACCACGACGTGGCCCGCCTCACC
GCCTTCTCCGAGGTCGGCGTCCCCGCCAACCGCACCGAGCTCAGCATGCTGGAGCCCGACCCCCGCAGCCCCTTCGCGCTGCGTCCGCTG
CGCGCGGGCCTTGGCGCGGTCTACACCCGTCGCGCGCTCACCCGCGCCGGCCTCTACCGGCTCACCGTGCGTGCTGCGGCACCGCGCCAC

>In-frame_PIAS1_ENST00000545237_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_2484nt
ATGTTTACACTCCAAGATTCGTATGTTAAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGA
AACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAG
GAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACT
TTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACAT
GAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGAT
GAACTGATAAAACCCACCAGTCTAGGGGAGCCCCAGGGGAGCTGGGGCAGCATGACTGGGGTGATAAATGGCCGGAAATTTGGCGTGGCC
ACACTCAACACCAGCGTGATGCAGGAGGCACACTCCGGGGTCAGCAGCATCCACAGCAGCATCCGCCATGTCCCAGCAAACGTGGGGCCT
CTGATGCGGGTGCTCGTGGTCACCATCGCCCCCATCTACTGGGCCCTGGCCAGAGAGAGTGGGGAAGCCCTGAATGGCCACTCTCTGACT
GGGGGCAGGTTCCGGCAGGAGTCACACGTGGAGTTTGCTACAGGGGAGCTGCTCACGATGACCCAGGTGGCCCGGGGTCTGGATCCCGAT
GGCCTCCTGCTCCTCGACGTGGTGGTCAATGGCGTTGTCCCCGAGAGCCTGGCTGACGCAGATCTTCAAGTGCAGGACTTTGAGGAGCAC
TACGTGCAAACAGGGCCTGGCCAGCTGTTCGTGGGCTCCACACAGCGCTTCTTCCAGGGCGGCCTCCCCTCGTTCCTACGCTGCAACCAC
AGCATCCAGTACAACGCGGCCCGGGGCCCCCAGCCCCAGCTGGTGCAGCACCTGCGGGCCTCAGCTATCAGCTCGGCCTTTGATCCAGAG
GCCGAGGCCCTGCGCTTCCAGCTCGCTACAGCCCTGCAGGCGGAGGAGAACGAGGTCGGCTGCCCCGAGGGCTTTGAGCTGGACTCCCAG
GGAGCGTTTTGTGTGGACAGGGACGAGTGCTCAGGAGGCCCTAGCCCCTGCTCCCATGCCTGCCTTAATGCACCCGGCCGCTTCTCCTGC
ACCTGCCCCACTGGCTTCGCCCTGGCCTGGGATGACAGGAACTGCAGAGATGTGGACGAGTGTGCGTGGGATGCTCACCTCTGCCGAGAG
GGACAGCGCTGTGTGAACCTGCTCGGGTCCTACCGCTGCCTCCCCGACTGTGGGCCTGGCTTCCGGGTGGCTGATGGGGCCGGCTGTGAA
GATGTGGACGAATGCCTGGAGGGGTTGGACGACTGTCACTACAACCAGCTCTGCGAGAACACCCCAGGCGGTCACCGCTGCAGCTGCCCC
AGGGGTTACCGGATGCAGGGCCCCAGCCTGCCCTGCCTAGATGTCAATGAGTGCCTGCAGCTGCCCAAGGCCTGCGCCTACCAGTGCCAC
AACCTCCAGGGCAGCTACCGCTGCCTGTGCCCCCCAGGCCAGACCCTCCTTCGCGACGGCAAGGCCTGCACCTCACTGGAGCGGAATGGA
CAAAATGTGACCACCGTCAGCCACCGAGGCCCTCTATTGCCCTGGCTGCGGCCCTGGGCCTCGATCCCCGGTACCTCCTACCACGCCTGG
GTCTCTCTCCGTCCGGGTCCCATGGCCCTGAGCAGTGTGGGCCGGGCCTGGTGCCCTCCTGGTTTCATCAGGCAGAACGGAGTCTGCACA
GACCTTGACGAGTGCCGCGTGAGGAACCTGTGTCAGCACGCCTGCCGCAACACTGAGGGCAGCTACCAGTGCCTGTGCCCCGCCGGCTAC
CGTCTGCTCCCCAGCGGGAAGAACTGCCAGGACATCAACGAGTGCGAGGAGGAGAGCATCGAGTGTGGACCCGGCCAGATGTGCTTCAAC
ACCCGTGGCAGCTACCAGTGTGTGGACACACCCTGTCCTGCCACCTACCGGCAGGGCCCCAGCCCTGGGACGTGCTTCCGGCGCTGCTCG
CAGGACTGCGGCACGGGCGGCCCCTCTACGCTGCAGTACCGGCTGCTGCCGCTGCCCCTGGGCGTGCGCGCCCACCACGACGTGGCCCGC
CTCACCGCCTTCTCCGAGGTCGGCGTCCCCGCCAACCGCACCGAGCTCAGCATGCTGGAGCCCGACCCCCGCAGCCCCTTCGCGCTGCGT
CCGCTGCGCGCGGGCCTTGGCGCGGTCTACACCCGTCGCGCGCTCACCCGCGCCGGCCTCTACCGGCTCACCGTGCGTGCTGCGGCACCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PIAS1_ENST00000249636_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_3056nt
GGGGCTTCGAGCGCCCTGAGCGGGGCGGAGGCTAGAGGCGGGCTGGGAAGGTGGAGGGGCGGGCCGGGGCGGGGCCAGGCCGGCTAGAGG
GGCGGGTCTAGCGGCGGCCCCCGGCGAAGTTCACTGCGCTTGCGCTGACAGACGCAAGATGGCGGACAGTGCGGAACTAAAGCAAATGGT
TATGAGCCTTAGAGTTTCTGAACTCCAAGTACTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGC
CCTGCATTTGCTAAAGGCTGGCTGTAGTCCTGCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGAC
GCCTGCAGACTTGTCCATCCCCAACGTACATTCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGG
TCACCCTGCATCATCGCCATTACTCCCTGTTTCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCC
AGTCCATCCGGATATAAAACTTCAAAAATTACCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGGGGAGCCCCAGGG
GAGCTGGGGCAGCATGACTGGGGTGATAAATGGCCGGAAATTTGGCGTGGCCACACTCAACACCAGCGTGATGCAGGAGGCACACTCCGG
GGTCAGCAGCATCCACAGCAGCATCCGCCATGTCCCAGCAAACGTGGGGCCTCTGATGCGGGTGCTCGTGGTCACCATCGCCCCCATCTA
CTGGGCCCTGGCCAGAGAGAGTGGGGAAGCCCTGAATGGCCACTCTCTGACTGGGGGCAGGTTCCGGCAGGAGTCACACGTGGAGTTTGC
TACAGGGGAGCTGCTCACGATGACCCAGGTGGCCCGGGGTCTGGATCCCGATGGCCTCCTGCTCCTCGACGTGGTGGTCAATGGCGTTGT
CCCCGAGAGCCTGGCTGACGCAGATCTTCAAGTGCAGGACTTTGAGGAGCACTACGTGCAAACAGGGCCTGGCCAGCTGTTCGTGGGCTC
CACACAGCGCTTCTTCCAGGGCGGCCTCCCCTCGTTCCTACGCTGCAACCACAGCATCCAGTACAACGCGGCCCGGGGCCCCCAGCCCCA
GCTGGTGCAGCACCTGCGGGCCTCAGCTATCAGCTCGGCCTTTGATCCAGAGGCCGAGGCCCTGCGCTTCCAGCTCGCTACAGCCCTGCA
GGCGGAGGAGAACGAGGTCGGCTGCCCCGAGGGCTTTGAGCTGGACTCCCAGGGAGCGTTTTGTGTGGACAGGGACGAGTGCTCAGGAGG
CCCTAGCCCCTGCTCCCATGCCTGCCTTAATGCACCCGGCCGCTTCTCCTGCACCTGCCCCACTGGCTTCGCCCTGGCCTGGGATGACAG
GAACTGCAGAGATGTGGACGAGTGTGCGTGGGATGCTCACCTCTGCCGAGAGGGACAGCGCTGTGTGAACCTGCTCGGGTCCTACCGCTG
CCTCCCCGACTGTGGGCCTGGCTTCCGGGTGGCTGATGGGGCCGGCTGTGAAGATGTGGACGAATGCCTGGAGGGGTTGGACGACTGTCA
CTACAACCAGCTCTGCGAGAACACCCCAGGCGGTCACCGCTGCAGCTGCCCCAGGGGTTACCGGATGCAGGGCCCCAGCCTGCCCTGCCT
AGATGTCAATGAGTGCCTGCAGCTGCCCAAGGCCTGCGCCTACCAGTGCCACAACCTCCAGGGCAGCTACCGCTGCCTGTGCCCCCCAGG
CCAGACCCTCCTTCGCGACGGCAAGGCCTGCACCTCACTGGAGCGGAATGGACAAAATGTGACCACCGTCAGCCACCGAGGCCCTCTATT
GCCCTGGCTGCGGCCCTGGGCCTCGATCCCCGGTACCTCCTACCACGCCTGGGTCTCTCTCCGTCCGGGTCCCATGGCCCTGAGCAGTGT
GGGCCGGGCCTGGTGCCCTCCTGGTTTCATCAGGCAGAACGGAGTCTGCACAGACCTTGACGAGTGCCGCGTGAGGAACCTGTGTCAGCA
CGCCTGCCGCAACACTGAGGGCAGCTACCAGTGCCTGTGCCCCGCCGGCTACCGTCTGCTCCCCAGCGGGAAGAACTGCCAGGACATCAA
CGAGTGCGAGGAGGAGAGCATCGAGTGTGGACCCGGCCAGATGTGCTTCAACACCCGTGGCAGCTACCAGTGTGTGGACACACCCTGTCC
TGCCACCTACCGGCAGGGCCCCAGCCCTGGGACGTGCTTCCGGCGCTGCTCGCAGGACTGCGGCACGGGCGGCCCCTCTACGCTGCAGTA
CCGGCTGCTGCCGCTGCCCCTGGGCGTGCGCGCCCACCACGACGTGGCCCGCCTCACCGCCTTCTCCGAGGTCGGCGTCCCCGCCAACCG
CACCGAGCTCAGCATGCTGGAGCCCGACCCCCGCAGCCCCTTCGCGCTGCGTCCGCTGCGCGCGGGCCTTGGCGCGGTCTACACCCGTCG
CGCGCTCACCCGCGCCGGCCTCTACCGGCTCACCGTGCGTGCTGCGGCACCGCGCCACCAAAGCGTCTTCGTCTTGCTCATCGCCGTGTC
CCCCTACCCCTACTAAACGGGAGAGGGCATTGGCGGCCGCCCTGGCGTGACCCCCGAGGAAGGGGTCGAGGAGAAGCTTGGTCCACGCCA
CCTGCTGTGGCAAGCGGAGCGTCATCGTCTCCCGCCCCGTGCGTCAGCGAGACCTTGGGTCAACACGACCCTGCGCACAGCCTTGACCCC
CGACAGCGAGGACCTGACCTCACAGAGGGAGGCGTCCAGGGCGGCCCTTGGGTGGCCAGTCCCGCAGGCAGGGCCCGGGGAAGCCCGGAT
CAGACCTCCAGGTCTGATCCGCCCCTCAGTGGGAGCGGGACAGGGACACAGGGCACCTGGACGCGCGGGAGAGGGGGCAGACCCCGCGTT

>In-frame_PIAS1_ENST00000545237_chr15_68379088_+_HMCN2_ENST00000428715_chr9_133297964_+_3655nt
TTGTTGTGGGCGCCTCTGGCGGGGGTGGCGGGGGAAGAGATAGGGAGTCCGGAGGTAGGGGCTGCAGCTGTCTCATGGGCTCGGCTTTTT
CACCTTCCAGTTAGCCTCCCTGCCCCCCATGGGGAGCTGGGGCTGGGGGCAGGGTGCTCTCGTAGGGGGGATTGGGAAAGCTCCCCGTGG
CCGCTTCCTCTTCCTCCTTTGCAGTCCCGGGCTCCTGTCAGGCGCTCTTCTCAGACCCCCGGGAACTTGGCTTCGGCCGCCCCGCCCCTC
CGTGGATCCCAGTAGCCCCCGCCCCGGACTCGGCTTTCCCCGGCTGCTCGCTTGTCAGGAAGCGCCTGGGGTGCCCCGCTTGTGGGAAGC
GCGATCCCGGGGCGATAGGGTGGGGATCTGGGGGAGAAGCTCTGGTAAAGTTTAGCGAGCCCCGGGCCGGCGTTGGGGTTCGGCTGAGAG
GTAGTGAGCGGGACGTTACTCTTTCTCTCTGATTCCGGGCAGCCGAGGGGAGAAACCCCCTCGAAGAGTGTGTCTTTGGAAGCAGTGTTG
GGAGGGGGGGATGCAGCTACCTCTCTCCCTTCTTTTGCCTTAGCTGGTGTGGAGGGTGAGAGGAGCCTTTGGGGGTCTCTGCACACACCA
TGATGGCGATGCTGTAGCTGATGGAGAACAACCAAATGCCAGATTTGATTCTGTAGAGTTTTTCCTGTGGAATATCCTCACCGAAAGAGC
TTTTCTCCTAATAACTTCACAATGTTTACACTCCAAGATTCGTATGTTAAGCAAATGGTTATGAGCCTTAGAGTTTCTGAACTCCAAGTA
CTGTTGGGCTACGCCGGGAGAAACAAGCACGGACGCAAACACGAACTTCTCACAAAAGCCCTGCATTTGCTAAAGGCTGGCTGTAGTCCT
GCTGTGCAAATGAAAATTAAGGAACTCTATAGGCGGCGGTTCCCACAGAAAATCATGACGCCTGCAGACTTGTCCATCCCCAACGTACAT
TCAAGTCCTATGCCAGCAACTTTGTCTCCATCTACCATTCCACAACTCACTTACGATGGTCACCCTGCATCATCGCCATTACTCCCTGTT
TCTCTTCTGGGACCTAAACATGAACTGGAACTCCCACATCTTACATCAGCTCTTCACCCAGTCCATCCGGATATAAAACTTCAAAAATTA
CCATTTTATGATTTACTGGATGAACTGATAAAACCCACCAGTCTAGGGGAGCCCCAGGGGAGCTGGGGCAGCATGACTGGGGTGATAAAT
GGCCGGAAATTTGGCGTGGCCACACTCAACACCAGCGTGATGCAGGAGGCACACTCCGGGGTCAGCAGCATCCACAGCAGCATCCGCCAT
GTCCCAGCAAACGTGGGGCCTCTGATGCGGGTGCTCGTGGTCACCATCGCCCCCATCTACTGGGCCCTGGCCAGAGAGAGTGGGGAAGCC
CTGAATGGCCACTCTCTGACTGGGGGCAGGTTCCGGCAGGAGTCACACGTGGAGTTTGCTACAGGGGAGCTGCTCACGATGACCCAGGTG
GCCCGGGGTCTGGATCCCGATGGCCTCCTGCTCCTCGACGTGGTGGTCAATGGCGTTGTCCCCGAGAGCCTGGCTGACGCAGATCTTCAA
GTGCAGGACTTTGAGGAGCACTACGTGCAAACAGGGCCTGGCCAGCTGTTCGTGGGCTCCACACAGCGCTTCTTCCAGGGCGGCCTCCCC
TCGTTCCTACGCTGCAACCACAGCATCCAGTACAACGCGGCCCGGGGCCCCCAGCCCCAGCTGGTGCAGCACCTGCGGGCCTCAGCTATC
AGCTCGGCCTTTGATCCAGAGGCCGAGGCCCTGCGCTTCCAGCTCGCTACAGCCCTGCAGGCGGAGGAGAACGAGGTCGGCTGCCCCGAG
GGCTTTGAGCTGGACTCCCAGGGAGCGTTTTGTGTGGACAGGGACGAGTGCTCAGGAGGCCCTAGCCCCTGCTCCCATGCCTGCCTTAAT
GCACCCGGCCGCTTCTCCTGCACCTGCCCCACTGGCTTCGCCCTGGCCTGGGATGACAGGAACTGCAGAGATGTGGACGAGTGTGCGTGG
GATGCTCACCTCTGCCGAGAGGGACAGCGCTGTGTGAACCTGCTCGGGTCCTACCGCTGCCTCCCCGACTGTGGGCCTGGCTTCCGGGTG
GCTGATGGGGCCGGCTGTGAAGATGTGGACGAATGCCTGGAGGGGTTGGACGACTGTCACTACAACCAGCTCTGCGAGAACACCCCAGGC
GGTCACCGCTGCAGCTGCCCCAGGGGTTACCGGATGCAGGGCCCCAGCCTGCCCTGCCTAGATGTCAATGAGTGCCTGCAGCTGCCCAAG
GCCTGCGCCTACCAGTGCCACAACCTCCAGGGCAGCTACCGCTGCCTGTGCCCCCCAGGCCAGACCCTCCTTCGCGACGGCAAGGCCTGC
ACCTCACTGGAGCGGAATGGACAAAATGTGACCACCGTCAGCCACCGAGGCCCTCTATTGCCCTGGCTGCGGCCCTGGGCCTCGATCCCC
GGTACCTCCTACCACGCCTGGGTCTCTCTCCGTCCGGGTCCCATGGCCCTGAGCAGTGTGGGCCGGGCCTGGTGCCCTCCTGGTTTCATC
AGGCAGAACGGAGTCTGCACAGACCTTGACGAGTGCCGCGTGAGGAACCTGTGTCAGCACGCCTGCCGCAACACTGAGGGCAGCTACCAG
TGCCTGTGCCCCGCCGGCTACCGTCTGCTCCCCAGCGGGAAGAACTGCCAGGACATCAACGAGTGCGAGGAGGAGAGCATCGAGTGTGGA
CCCGGCCAGATGTGCTTCAACACCCGTGGCAGCTACCAGTGTGTGGACACACCCTGTCCTGCCACCTACCGGCAGGGCCCCAGCCCTGGG
ACGTGCTTCCGGCGCTGCTCGCAGGACTGCGGCACGGGCGGCCCCTCTACGCTGCAGTACCGGCTGCTGCCGCTGCCCCTGGGCGTGCGC
GCCCACCACGACGTGGCCCGCCTCACCGCCTTCTCCGAGGTCGGCGTCCCCGCCAACCGCACCGAGCTCAGCATGCTGGAGCCCGACCCC
CGCAGCCCCTTCGCGCTGCGTCCGCTGCGCGCGGGCCTTGGCGCGGTCTACACCCGTCGCGCGCTCACCCGCGCCGGCCTCTACCGGCTC
ACCGTGCGTGCTGCGGCACCGCGCCACCAAAGCGTCTTCGTCTTGCTCATCGCCGTGTCCCCCTACCCCTACTAAACGGGAGAGGGCATT
GGCGGCCGCCCTGGCGTGACCCCCGAGGAAGGGGTCGAGGAGAAGCTTGGTCCACGCCACCTGCTGTGGCAAGCGGAGCGTCATCGTCTC
CCGCCCCGTGCGTCAGCGAGACCTTGGGTCAACACGACCCTGCGCACAGCCTTGACCCCCGACAGCGAGGACCTGACCTCACAGAGGGAG
GCGTCCAGGGCGGCCCTTGGGTGGCCAGTCCCGCAGGCAGGGCCCGGGGAAGCCCGGATCAGACCTCCAGGTCTGATCCGCCCCTCAGTG
GGAGCGGGACAGGGACACAGGGCACCTGGACGCGCGGGAGAGGGGGCAGACCCCGCGTTAGGGGTGGCAGCAGCTGTCGCCCGGCCACAC


Top

FusionGenePPI for PIAS1_HMCN2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PIAS1STAT1, DNMT3A, STAB2, UBE2I, SUMO1, SP3, TP53, CSRP2, AR, MX1, SUMO2, SIAH1, SIAH2, AKT1, ZMIZ2, BRCA1, MBD1, CREB1, SREBF2, GLUL, MITF, NCOR1, PPARG, TRIM27, ZNF76, JUN, HIC1, DDX5, SATB1, MAML1, DCLRE1A, DNMT3B, RBBP6, SAFB, ESR1, PPP1CA, MDC1, PRDM1, MDM2, CHUK, DNM1, PML, ATXN7, SRSF1, NFATC1, CEBPE, CEBPA, FLI1, CSNK2A1, CASP8AP2, MYB, SERBP1, ZMYND11, RAD54L2, PLAG1, NR1H3, NR1H2, PPARGC1B, PPARGC1A, BARD1, PAXIP1, PPP1CC, HTT, ATXN1, SMAD7, PRPF40A, SKIL, SMAD4, SMAD1, SOX2, SGTA, YWHAZ, SPOP, SUMO3, SHFM1, CBS, L3MBTL2, CEP250, TRIM63, TRIM55, ZNF451, PIAS1, FOXA1, HIF1A, ID1, KLC1, FRAT1, ERP44, POLK, VPS16, PIAS2, PTK2, TERF2, TRIM5, HECTD2, GSK3B, NCOA3, PSME3, TRIM35, GTF2IRD1, NR0B2, EP300HMCN2SRPK2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PIAS1_HMCN2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PIAS1_HMCN2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePIAS1C0037274Dermatologic disorders1CTD_human
HgenePIAS1C0311375Arsenic Poisoning1CTD_human