FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2701

FusionGeneSummary for ARL13B_DLG1

check button Fusion gene summary
Fusion gene informationFusion gene name: ARL13B_DLG1
Fusion gene ID: 2701
HgeneTgene
Gene symbol

ARL13B

DLG1

Gene ID

200894

1739

Gene nameADP ribosylation factor like GTPase 13Bdiscs large MAGUK scaffold protein 1
SynonymsARL2L1|JBTS8DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg
Cytomap

3q11.1-q11.2

3q29

Type of geneprotein-codingprotein-coding
DescriptionADP-ribosylation factor-like protein 13BADP-ribosylation factor-like 13BADP-ribosylation factor-like 2-like 1ARL2-like protein 1disks large homolog 1discs large homolog 1, scribble cell polarity complex componentdiscs, large homolog 1 transcript variant 6-v1discs, large homolog 1 transcript variant 6-v2presynaptic protein SAP97synapse-associated protein 97
Modification date2018052320180523
UniProtAcc

Q3SXY8

Q12959

Ensembl transtripts involved in fusion geneENST00000535334, ENST00000303097, 
ENST00000394222, ENST00000539730, 
ENST00000471138, ENST00000486562, 
ENST00000357674, ENST00000314062, 
ENST00000346964, ENST00000419354, 
ENST00000452595, ENST00000422288, 
ENST00000448528, ENST00000443183, 
ENST00000450955, ENST00000392382, 
ENST00000485409, 
Fusion gene scores* DoF score3 X 1 X 3=96 X 7 X 6=252
# samples 37
** MAII scorelog2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/252*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARL13B [Title/Abstract] AND DLG1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDLG1

GO:0001935

endothelial cell proliferation

14699157

TgeneDLG1

GO:0007015

actin filament organization

14699157

TgeneDLG1

GO:0030866

cortical actin cytoskeleton organization

14699157

TgeneDLG1

GO:0042391

regulation of membrane potential

12970345

TgeneDLG1

GO:0043268

positive regulation of potassium ion transport

12970345

TgeneDLG1

GO:0070830

bicellular tight junction assembly

17332497

TgeneDLG1

GO:0098609

cell-cell adhesion

14699157

TgeneDLG1

GO:1903078

positive regulation of protein localization to plasma membrane

12970345


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-A5U1-01AARL13Bchr3

93722752

+DLG1chr3

196812627

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000535334ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000535334ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
5CDS-intronENST00000535334ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000303097ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-intronENST00000303097ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000394222ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
5CDS-intronENST00000394222ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000539730ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-intronENST00000539730ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
In-frameENST00000471138ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
5CDS-intronENST00000471138ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000357674ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000314062ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000346964ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000419354ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000452595ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000422288ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000448528ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000443183ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000450955ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-3CDSENST00000486562ENST00000392382ARL13Bchr3

93722752

+DLG1chr3

196812627

-
intron-intronENST00000486562ENST00000485409ARL13Bchr3

93722752

+DLG1chr3

196812627

-

Top

FusionProtFeatures for ARL13B_DLG1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARL13B

Q3SXY8

DLG1

Q12959

Cilium-specific protein required to control themicrotubule-based, ciliary axoneme structure. May act bymaintaining the association between IFT subcomplexes A and B.Binds GTP but is not able to hydrolyze it; the GTPase activityremains unclear. Required to pattern the neural tube. Involved incerebral cortex development: required for the initial formation ofa polarized radial glial scaffold, the first step in theconstruction of the cerebral cortex, by regulating ciliarysignaling. Regulates the migration and placement of postmitoticinterneurons in the developing cerebral cortex. May regulateendocytic recycling traffic; however, additional evidences arerequired to confirm these data. {ECO:0000269|PubMed:23150559}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARL13Bchr3:93722752chr3:196812627ENST00000394222+31028_35126429Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000394222+31071_75126429Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000471138+31128_35126524Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000471138+31171_75126524Nucleotide bindingGTP
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324581_651535854DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324714_889535854DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526714_889586927DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425581_651553894DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425714_889553894DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425581_651553872DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425714_889553872DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526714_889586905DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223581_651535854DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223714_889535854DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022581_651470801DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022714_889470801DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526714_889586905DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324581_651553894DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324714_889553894DomainGuanylate kinase-like
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021581_651470789DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021714_889470789DomainGuanylate kinase-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARL13Bchr3:93722752chr3:196812627ENST00000303097+18192_245-94322Coiled coilOntology_term=ECO:0000255
HgeneARL13Bchr3:93722752chr3:196812627ENST00000394222+310192_245126429Coiled coilOntology_term=ECO:0000255
HgeneARL13Bchr3:93722752chr3:196812627ENST00000471138+311192_245126524Coiled coilOntology_term=ECO:0000255
HgeneARL13Bchr3:93722752chr3:196812627ENST00000535334+29192_24523326Coiled coilOntology_term=ECO:0000255
HgeneARL13Bchr3:93722752chr3:196812627ENST00000303097+18369_419-94322Compositional biasNote=Pro-rich
HgeneARL13Bchr3:93722752chr3:196812627ENST00000394222+310369_419126429Compositional biasNote=Pro-rich
HgeneARL13Bchr3:93722752chr3:196812627ENST00000471138+311369_419126524Compositional biasNote=Pro-rich
HgeneARL13Bchr3:93722752chr3:196812627ENST00000535334+29369_41923326Compositional biasNote=Pro-rich
HgeneARL13Bchr3:93722752chr3:196812627ENST00000303097+18130_133-94322Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000303097+1828_35-94322Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000303097+1871_75-94322Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000394222+310130_133126429Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000471138+311130_133126524Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000535334+29130_13323326Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000535334+2928_3523326Nucleotide bindingGTP
HgeneARL13Bchr3:93722752chr3:196812627ENST00000535334+2971_7523326Nucleotide bindingGTP
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324224_310535854DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324319_405535854DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324466_546535854DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-13244_64535854DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526224_310586927DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526319_405586927DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526466_546586927DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-15264_64586927DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526581_651586927DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425224_310553894DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425319_405553894DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425466_546553894DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-14254_64553894DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425224_310553872DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425319_405553872DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425466_546553872DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-14254_64553872DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526224_310586905DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526319_405586905DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526466_546586905DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-15264_64586905DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526581_651586905DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223224_310535854DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223319_405535854DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223466_546535854DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-12234_64535854DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022224_310470801DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022319_405470801DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022466_546470801DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-10224_64470801DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526224_310586905DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526319_405586905DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526466_546586905DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-15264_64586905DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526581_651586905DomainSH3
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324224_310553894DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324319_405553894DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324466_546553894DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-13244_64553894DomainL27
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021224_310470789DomainPDZ 1
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021319_405470789DomainPDZ 2
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021466_546470789DomainPDZ 3
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-10214_64470789DomainL27


Top

FusionGeneSequence for ARL13B_DLG1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_364aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILG
PMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVS
GNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_364aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILG
PMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVS
GNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_354aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYLILITDETGCSKGGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDL
ISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIA

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_364aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILG
PMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVS
GNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVPAK

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_342aa
MEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERA
RLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCV
PHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPK

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_457aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYLILITDETGCSKGGQEEYVLSTEPVNQQEVNTTRPVI
ILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCIL
DVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWV

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_457aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYLILITDETGCSKGGQEEYVLSTEPVNQQEVNTTRPVI
ILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCIL
DVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWV

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_467aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSTEPVNQ
QEVNTTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVRE
VAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQII

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_445aa
MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIFDLGGGIRIRGIWKNYTAEST
GVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVALFDTDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGV
IPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSTEPVNQQEVNTTRPVIILGPMKDRINDD
LISEFPDKFGSCVPHTTRPKRDTEVDGRDTHFVTSREQMEKDIQEHKFIEAGQTNNHLTGTSVQSVREVAEKGKHCILDVSGNAIKRLQI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_1092nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAA
TTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGT
AGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGA
CCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGA
GATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCT
GGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCT
GGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATG
AATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATT
GTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAA

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_1092nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAA
TTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGT
AGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGA
CCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGA
GATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCT
GGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCT
GGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATG
AATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATT
GTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAA

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1062nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCTAATCTTGATTACAGATGAGTATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTA
TCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTG
ATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCAT
TTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACA
AGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCA
CAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGA
AAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTAC

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1092nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAA
TTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGT
AGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGA
CCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGA
GATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCT
GGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCT
GGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATG
AATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATT
GTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAA

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1026nt
ATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1371nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCTAATCTTGATTACAGATGAG
TATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATC
ATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGA
CCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTC
ATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTT
GATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATC
ATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTC
ACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1371nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCTAATCTTGATTACAGATGAG
TATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATC
ATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGA
CCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTC
ATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTT
GATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATC
ATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTC
ACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1401nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCA
TTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCT
GACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAA
CAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAA
TTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAG
ATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAA
GTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATT
TTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATG
AAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATA

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1335nt
ATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGAT
AATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTT
AGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTAT
GGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATA
TCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGA
GATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTG
ATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATC
CCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_3678nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAA
CAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGA
AGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGAT
AAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGG
AAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCA
TCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAG
ATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGA
AGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCT
GGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACT
CATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCA
TGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGT
CACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAA
AATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAA
GTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTC
CTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTG
ACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAAT
AACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGA
ATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACG
TTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTT
TACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTA
TGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTA
ACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATG
AGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGG
TTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTA
ATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCT
TCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATT
TGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAA
GAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGA
ATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGT
TAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAG
TATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAG

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_3612nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC
GGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGG
AGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGT
TACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGT
GGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTT
TCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTT
TGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTA
ATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTT
TTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATAT
GTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAG
ATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCA
AATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATAT
AAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTT
TGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACT
GAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACA
AAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCT
TTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGC
TCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTG
GTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTT
CTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAA
ATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAA
CTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTT
GTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGC
TATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTATAAAAGGATGCCATTTATATATTAAAATTTACATAACA

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_3678nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAA
CAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGA
AGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGAT
AAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGG
AAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCA
TCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAG
ATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGA
AGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCT
GGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACT
CATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCA
TGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGT
CACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAA
AATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAA
GTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTC
CTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTG
ACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAAT
AACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGA
ATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACG
TTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTT
TACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTA
TGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTA
ACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATG
AGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGG
TTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTA
ATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCT
TCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATT
TGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAA
GAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGA
ATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGT
TAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAG
TATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAG

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_2541nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC
GGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGG
AGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGT
TACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGT
GGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTT
TCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTT
TGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTA
ATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTT
TTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATAT
GTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAG
ATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCA
AATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATAT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1912nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC
GGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGG
AGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGT
TACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGT
GGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1841nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC
GGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGG
AGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGT
TACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1621nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC
GGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGG

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1648nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCTAATCTTGATTACAGATGAGTATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAA
TCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGA
CAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGA
GCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACG
AGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTC
CATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGC
CATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGAT
CATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1615nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAA
CAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGA
AGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGAT
AAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGG
AAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCA
TCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAG
ATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGA
AGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCT

>In-frame_ARL13B_ENST00000535334_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1549nt
AGCACGTCGACGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAA
GAGGGCAGTCGTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTT
ATCCACTTTAGGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGG
GAGGAGCGACCCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAATACCCTGAAGATGT
AGCTCCTACTGTTGGATTTTCAAAAATTAACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCG
GGGAATCTGGAAGAATTACTATGCTGAATCCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGA
GGCTATGTCAGAAATGCTAAGACATCCTAGGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGG
GCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGT
TACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAA
ATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAG
TGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCAT
ATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACC
AAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCAT
TGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGA
TGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCAT
GGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCAC
AGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCC

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_3739nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGC
AGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTG
ATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGA
ATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTG
ACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAG
AGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTAC
GAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCT
CCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAG
CCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGA
TCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAAT
TCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTC
TGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAA
CTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACT
TTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTT
TGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAG
CAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTC
AACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTT
GAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAG
TTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGG
CAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCC
TATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGC
ACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATAT
TAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTA
TAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGT
TGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTAT
GTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAG
TGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTT
ATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTAT
GAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAG
CTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAA
ATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAG
AGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTAT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_3673nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG
ACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGT
TTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTG
AATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTA
TTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTC
CTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGT
TTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTT
CTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTT
CATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAA
CGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGA
GGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACA
GTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTG
AATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGA
ATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTT
TTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAG
GAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTT
TGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGG
AAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATG
GTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCT
TCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATT
ATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTT
GAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGC
AGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGA
AGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACA

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_3739nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGC
AGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTG
ATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGA
ATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTG
ACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAG
AGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTAC
GAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCT
CCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAG
CCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGA
TCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAAT
TCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTC
TGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAA
CTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACT
TTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTT
TGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAG
CAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTC
AACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTT
GAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAG
TTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGG
CAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCC
TATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGC
ACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATAT
TAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTA
TAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGT
TGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTAT
GTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAG
TGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTT
ATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTAT
GAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAG
CTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAA
ATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAG
AGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTAT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_2602nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG
ACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGT
TTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTG
AATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTA
TTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTC
CTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGT
TTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTT
CTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTT
CATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAA
CGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGA
GGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACA
GTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTG

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1973nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG
ACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGT
TTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTG
AATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTA
TTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTC

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1902nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG
ACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGT
TTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTG
AATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTA
TTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTC

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1682nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG
ACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1709nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCTAATCTTGATTACAG
ATGAGTATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAG
TGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAA
CTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATA
AATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTA
TCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAA
ATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAAC
ATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCT

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1676nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGC
AGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTG
ATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGA
ATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTG
ACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAG
AGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTAC
GAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCT
CCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAG
CCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGA

>In-frame_ARL13B_ENST00000394222_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1610nt
CGCGGGGCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTC
GTCGCGGACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTA
GGGGCGTCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGAC
CCGGGATGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGAC
TTGATAATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTA
ACCTTAGACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAAT
CCTATGGGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTA
GGATATCGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAAT
TTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCG
GAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGG
AGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAAT
ACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATG
ATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAG
ATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTAT
ATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTAC
AGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAAC
AAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAG

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000357674_chr3_196812627_-_3733nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCAT
TCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTG
ACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAAC
AAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAAT
TTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGA
TGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAG
TAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTT
TTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGA
AACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAG
AAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATT
TTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGC
TTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAG
ATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGA
GATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCA
ACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTG
TTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATT
CTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAA
CACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCC
TTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGG
AAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTT
GTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGCACACAC
ACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTG
AATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTA
AAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCT
TGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGT
GTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAG
GTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAA
TATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAA
GAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACA
TTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACAC
AGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTC
AGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTATAAAAGG

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000314062_chr3_196812627_-_3667nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT
ACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCT
GTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGT
ATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTT
AGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAAT
GTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAAT
CAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAAT
CAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAG
GGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTC
AATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCAT
GTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTG
ACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATT
TTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATT
TTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTT
GGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACA
TTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGT
TGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCA
GGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGC
AATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCAT
TGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAAC
ATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGA
AAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGA
GTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAA
CTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000346964_chr3_196812627_-_3733nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCAT
TCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTG
ACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAAC
AAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAAT
TTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGA
TGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAG
TAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTT
TTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGA
AACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAG
AAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATT
TTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGC
TTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAG
ATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGA
GATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCA
ACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTG
TTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATT
CTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAA
CACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCC
TTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGG
AAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTT
GTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGCACACAC
ACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTG
AATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTA
AAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCT
TGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGT
GTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAG
GTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAA
TATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAA
GAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACA
TTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACAC
AGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTC
AGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTATAAAAGG

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000419354_chr3_196812627_-_2596nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT
ACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCT
GTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGT
ATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTT
AGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAAT
GTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAAT
CAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAAT
CAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAG
GGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTC
AATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCAT
GTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTG
ACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000452595_chr3_196812627_-_1967nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT
ACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCT
GTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGT
ATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTT
AGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAAT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000422288_chr3_196812627_-_1896nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT
ACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCT
GTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGT
ATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTT
AGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAAT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000448528_chr3_196812627_-_1676nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT
ACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCT

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000443183_chr3_196812627_-_1703nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCTAATCTTGATTACAGATGAGT
ATGGCTGCTCAAAAGGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCA
TATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGAC
CAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCA
TTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTG
ATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCA
TGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCA
CAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTC

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000450955_chr3_196812627_-_1670nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCAT
TCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTG
ACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAAC
AAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAAT
TTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGA
TGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAG
TAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTT
TTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGA
AACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAG

>In-frame_ARL13B_ENST00000471138_chr3_93722752_+_DLG1_ENST00000392382_chr3_196812627_-_1604nt
GCTTTTCTTTAGCCGGGTCCCGCTAACTCGGCTACGGTGTATCTGCGTCTTTGGTCAGGTTGTTCCTTGGCTAAGAGGGCAGTCGTCGCG
GACCCACGCGGTTAGCAAGGCTTAGTGCTCGGGCCGGCCGCCTTCACTTCCCTCCCGGCTTTTCCTCCCGACTTATCCACTTTAGGGGCG
TCTCGGAGTGCCGGAGGCCCCCGGGGAAGAGCGGGGTGCCGGTGTCCGCTCCGGGCTCGGATGGGAAGTGGTGGGAGGAGCGACCCGGGA
TGTTCAGTCTGATGGCCAGTTGCTGCGGCTGGTTCAAGCGGTGGCGGGAGCCTGTCAGAAAGGTGACTCTTTTGATGGTGGGACTTGATA
ATGCTGGTAAAACCGCAACAGCAAAGGGAATCCAAGGAGAATACCCTGAAGATGTAGCTCCTACTGTTGGATTTTCAAAAATTAACCTTA
GACAAGGAAAGTTTGAAGTCACCATCTTTGACTTGGGAGGTGGAATAAGAATTCGGGGAATCTGGAAGAATTACTATGCTGAATCCTATG
GGGTAATATTTGTTGTGGATTCCAGTGATGAAGAGAGAATGGAAGAGACAAAAGAGGCTATGTCAGAAATGCTAAGACATCCTAGGATAT
CGGGAAAGCCTATATTGGTAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAG
ATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGA
TTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCC
CTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCT
TATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACT
TGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATC
ATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAA
CAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTG
CACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCA
GAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTT


Top

FusionGenePPI for ARL13B_DLG1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARL13BUBE2I, MAPK14, FAM63B, TTC30A, STK25, TTC26, VAC14, IFT81, IFT46, TTI1, ARV1, FASTKD1, IFT74, IFT52, IPO11, TNPO2, ANKRD50, PDXDC1, IFT22, RAB18, TMEM17, CTDSPL, PTPRHDLG1KCNA4, ADAM17, KCNJ12, KCNJ4, GPR124, CASK, LIN7A, LIN7C, APBA1, KCNA5, GRIN2A, CAMK2A, GRIA1, BTRC, ACTN2, CACNG2, GRIN2B, EPB41, ATP2B4, CRIPT, DLGAP1, KCNJ6, GRIK2, TJAP1, LRRC1, ERBB4, ATP2B2, EZR, KIF13B, CTNNA1, KCNJ2, GUCY1A2, LCK, KCNA3, MARCH2, AMOT, UBE3A, NET1, KHDRBS1, KCNC1, MAP1A, BAI1, HUWE1, ADAM10, NTRK1, TMEM17, DLG3, KIF26B, MAPK12, PARK2, CDH1, TGFA, PTPRE, PTEN, MPP2, EFNB3, GJB7, PRDM1, GPRC5B, WWC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneDLG1chr3:93722752chr3:196812627ENST00000314062-1324162_212535854SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000346964-1526162_212586927SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000357674-1425162_212553894SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000392382-1425162_212553872SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000419354-1526162_212586905SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000422288-1223162_212535854SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000443183-1022162_212470801SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000448528-1526162_212586905SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000450955-1324162_212553894SH3 domains
TgeneDLG1chr3:93722752chr3:196812627ENST00000452595-1021162_212470789SH3 domains


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARL13B_DLG1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARL13B_DLG1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARL13BC2676771JOUBERT SYNDROME 8 (disorder)2CTD_human;UNIPROT
TgeneDLG1C0036341Schizophrenia3CTD_human
TgeneDLG1C0008925Cleft Palate1CTD_human