FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26612

FusionGeneSummary for PDZRN3_CACNA2D3

check button Fusion gene summary
Fusion gene informationFusion gene name: PDZRN3_CACNA2D3
Fusion gene ID: 26612
HgeneTgene
Gene symbol

PDZRN3

CACNA2D3

Gene ID

23024

55799

Gene namePDZ domain containing ring finger 3calcium voltage-gated channel auxiliary subunit alpha2delta 3
SynonymsLNX3|SEMACAP3|SEMCAP3HSA272268
Cytomap

3p13

3p21.1-p14.3

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase PDZRN3RING-type E3 ubiquitin transferase PDZRN3ligand of Numb protein X 3likely ortholog of mouse semaF cytoplasmic domain associated protein 3semaphorin cytoplasmic domain-associated protein 3voltage-dependent calcium channel subunit alpha-2/delta-3calcium channel alpha2-delta3 subunitcalcium channel, voltage-dependent, alpha 2/delta 3 subunitcalcium channel, voltage-dependent, alpha 2/delta subunit 3voltage-gated calcium channel subunit a
Modification date2018052320180522
UniProtAcc

Q9UPQ7

Q8IZS8

Ensembl transtripts involved in fusion geneENST00000263666, ENST00000466780, 
ENST00000308537, ENST00000462146, 
ENST00000535920, ENST00000479530, 
ENST00000466348, 
ENST00000415676, 
ENST00000288197, ENST00000474759, 
ENST00000490478, ENST00000478261, 
Fusion gene scores* DoF score8 X 4 X 6=19211 X 9 X 7=693
# samples 1011
** MAII scorelog2(10/192*10)=-0.941106310946431
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/693*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PDZRN3 [Title/Abstract] AND CACNA2D3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-LI-A9QH-01APDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000263666ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000263666ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000263666ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000263666ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
5CDS-intronENST00000263666ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466780ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466780ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466780ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466780ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-intronENST00000466780ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000308537ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000308537ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000308537ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
In-frameENST00000308537ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
5CDS-intronENST00000308537ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000462146ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000462146ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000462146ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000462146ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-intronENST00000462146ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000535920ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000535920ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000535920ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000535920ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-intronENST00000535920ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000479530ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000479530ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000479530ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000479530ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-intronENST00000479530ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466348ENST00000415676PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466348ENST00000288197PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466348ENST00000474759PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-3CDSENST00000466348ENST00000490478PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+
intron-intronENST00000466348ENST00000478261PDZRN3chr3

73651505

-CACNA2D3chr3

54420742

+

Top

FusionProtFeatures for PDZRN3_CACNA2D3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDZRN3

Q9UPQ7

CACNA2D3

Q8IZS8

E3 ubiquitin-protein ligase. Plays an important role inregulating the surface level of MUSK on myotubes. Mediates theubiquitination of MUSK, promoting its endocytosis and lysosomaldegradation. Might contribute to terminal myogenicdifferentiation. {ECO:0000250|UniProtKB:Q69ZS0}. The alpha-2/delta subunit of voltage-dependent calciumchannels regulates calcium current density andactivation/inactivation kinetics of the calcium channel. Acts as aregulatory subunit for P/Q-type calcium channel (CACNA1A), N-type(CACNA1B), L-type (CACNA1C OR CACNA1D) but not T-type (CACNA1G)(By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-310100_1583061067Zinc fingerTRAF-type
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-31018_563061067Zinc fingerRING-type%3B degenerate
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-34100_158306361Zinc fingerTRAF-type
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-3418_56306361Zinc fingerRING-type%3B degenerate
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+238256_4381071092DomainVWFA
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+238452_5491071092DomainNote=Cache
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+339256_4381071092DomainVWFA
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+339452_5491071092DomainNote=Cache
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+238256_4381071092DomainVWFA
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+238452_5491071092DomainNote=Cache
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+137256_43813998DomainVWFA
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+137452_54913998DomainNote=Cache
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+238262_2661071092MotifNote=MIDAS-like motif
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+339262_2661071092MotifNote=MIDAS-like motif
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+238262_2661071092MotifNote=MIDAS-like motif
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+137262_26613998MotifNote=MIDAS-like motif
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+2381090_10911071092Topological domainCytoplasmic
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+3391090_10911071092Topological domainCytoplasmic
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+2381090_10911071092Topological domainCytoplasmic
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+1371090_109113998Topological domainCytoplasmic
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+13729_106813998Topological domainExtracellular
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+2381069_10891071092TransmembraneHelical
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+3391069_10891071092TransmembraneHelical
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+2381069_10891071092TransmembraneHelical
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000490478+1371069_108913998TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-310679_7043061067Coiled coilOntology_term=ECO:0000255
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-310975_10253061067Coiled coilOntology_term=ECO:0000255
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-34679_704306361Coiled coilOntology_term=ECO:0000255
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-34975_1025306361Coiled coilOntology_term=ECO:0000255
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-310249_3393061067DomainPDZ 1
HgenePDZRN3chr3:73651505chr3:54420742ENST00000263666-310419_5033061067DomainPDZ 2
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-34249_339306361DomainPDZ 1
HgenePDZRN3chr3:73651505chr3:54420742ENST00000308537-34419_503306361DomainPDZ 2
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000288197+23829_10681071092Topological domainExtracellular
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000415676+33929_10681071092Topological domainExtracellular
TgeneCACNA2D3chr3:73651505chr3:54420742ENST00000474759+23829_10681071092Topological domainExtracellular


Top

FusionGeneSequence for PDZRN3_CACNA2D3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_1291aa
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCG
RVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRDSGSLGFNIIGGRPSV
DNHDGSSSEGIFVSKIVDSGPAAKEGGLQIHDRIIERLVEAAEEAHLKHEFDADLQTEYFNAVLINERDKDGNFLELGKEFILAPNDHFN
NLPVNISLSDVQVPTNMYNKDPAIVNGVTWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQTPGIKWEPDENGVIAFDCRNRKWYIQAA
TSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIATNEELHTVEPCLNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIA
LNEAFNILSDFNHTGQGSICSQAIMLITDGAVDTTDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADVQENV
MEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLTDDQGPVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIPKYKLGIH
GTAFAITNNGTILTHPELRLLYEEGKKRRKPNTSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYTTTDIKG
TPFSLGVALSRGHGKTFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVS
APIEATWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGP
VNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEI
EGAVMNKLLTMGSFKRITLTDYQAMCRANKESSDGAHGLLDPTNAFLSAVKWIMTELVLFLVEFNLCSWWHSDMTAKAQKLKQTLEPCDT
ETPAFVSERTIKETTGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVAPITMAPIEIRTNESLKCERLKAQKIRRRPESCHGFHPE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_3873nt
ATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTGGAGGACCCGCTGACC
ACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGCTGCCGCGGTCGCCTG
TCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCGACGCGCGGCTGCGGC
CGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCGGGTTGCGGCCAGGTG
CTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGCTGCGGGCTACCCTTG
ACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCCCGCCTGGGCGCGCTG
CACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCGCAGCTTGAGCTGCAG
ATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCCGCGCCGCCCGGCGGC
AAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGTGGCCGGCCGAGTGTG
GATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAAGGAGGCCTGCAAATT
CATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTACAGTATGAATACTTC
AATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCAAATGACCATTTTAAT
AATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTCAATGGGGTTTATTGG
TCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGTGCAAAGGGCTTTTTT
AGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGGTACATCCAGGCAGCA
ACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAGCAAACAGTCTCATCC
ATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCTTGCCTGAATGGAACT
TTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGAATGTTGGATATAGCT
CTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATGCTCATAACTGATGGG
GCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTCATTGGACGAGAGGCT
GCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGATGTGCAGGAGAATGTC
ATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTACATTGACAGCACTCTC
CCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAGCAGAACGAAACCAGA
TCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATACAAGTTAGGGATTCAC
GGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGAAAAAAGCGAAGGAAA
CCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTGAATCGAAAGACGGGG
AAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTATACAGACATCAAGGGT
ACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAAGAAGGCCTGCATGAC
TTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCATCTGTCTCAGTTAGAA
GCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTTGACGCGGTGGTGAGT
GCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCCTTCCTCGGCACTCGC
ACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGACAAGGAGAACATTTTT
AACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCATTCAGCACTGGACCA
GTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCAGCTGTAGGCATTCAG
ATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCCATCAGCTGTGATGAT
GAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGACTTTTTTGGTGAGATC
GAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATGTGTAGAGCCAACAAG
GAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACAGAACTTGTCTTGTTC
CTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTGGAGCCTTGTGATACT
GAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAGTCCTTTGTCATCCAG
CAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACCATGGCACCCATTGAA
ATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCATGGCTTCCATCCTGAG
GAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTGATGCTCTTCTCAAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_4255nt
GTCCGGGGAGAGCCAGCGAGCGCGCGGGCGGCGTAGCCGGCCTGTCTGGGCCGCCTCGTGGGGAGGGAGGGGGCGCCCGGCCGCCCGGCG
GCGACCCCGGGGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCA
CAAGGTCCTGGAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTG
CCCGGCGCGCTGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTG
CGCGTACGCGACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTG
TCGCCACGCGGGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTG
CCAGGAGGGCTGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGC
GCTCCAGGCCCGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCT
GGCCGCGGCGCAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCG
CTGCGTGGCCGCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAA
TATTATTGGTGGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGC
AGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGA
TGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCAT
CTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCC
TGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTA
CTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAA
CCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGAC
TATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTA
TGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAA
AGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCA
GGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTT
CACATACCTCATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCAC
CTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGAC
CGAAGCTTACATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGT
GTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCAT
CCCCAAATACAAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTA
CGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAA
TGCTATGGTGAATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGA
CTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGT
AACCATCGAAGAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGA
GCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGA
AGTCCTTTTTGACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGT
GGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAA
AGCTGGCGACAAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTA
CTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCC
TGTGGTGGCAGCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGG
CAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACA
GACTGGAGACTTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTA
CCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATG
GATCATGACAGAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAA
ACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGA
CTGCTCCAAGTCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGC
CCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGA
ATCTTGTCATGGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCC
TCTGCTTTTGATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAA
ACTGTGAACCAAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATA
AACTCTTAAAGATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCC

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_4335nt
GTCCGGGGAGAGCCAGCGAGCGCGCGGGCGGCGTAGCCGGCCTGTCTGGGCCGCCTCGTGGGGAGGGAGGGGGCGCCCGGCCGCCCGGCG
GCGACCCCGGGGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCA
CAAGGTCCTGGAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTG
CCCGGCGCGCTGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTG
CGCGTACGCGACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTG
TCGCCACGCGGGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTG
CCAGGAGGGCTGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGC
GCTCCAGGCCCGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCT
GGCCGCGGCGCAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCG
CTGCGTGGCCGCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAA
TATTATTGGTGGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGC
AGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGA
TGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCAT
CTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCC
TGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTA
CTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAA
CCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGAC
TATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTA
TGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAA
AGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCA
GGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTT
CACATACCTCATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCAC
CTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGAC
CGAAGCTTACATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGT
GTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCAT
CCCCAAATACAAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTA
CGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAA
TGCTATGGTGAATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGA
CTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGT
AACCATCGAAGAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGA
GCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGA
AGTCCTTTTTGACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGT
GGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAA
AGCTGGCGACAAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTA
CTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCC
TGTGGTGGCAGCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGG
CAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACA
GACTGGAGACTTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTA
CCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATG
GATCATGACAGAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAA
ACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGA
CTGCTCCAAGTCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGC
CCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGA
ATCTTGTCATGGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCC
TCTGCTTTTGATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAA
ACTGTGAACCAAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATA
AACTCTTAAAGATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCC
TTCATCAGAAATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATA

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_4339nt
GTCCGGGGAGAGCCAGCGAGCGCGCGGGCGGCGTAGCCGGCCTGTCTGGGCCGCCTCGTGGGGAGGGAGGGGGCGCCCGGCCGCCCGGCG
GCGACCCCGGGGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCA
CAAGGTCCTGGAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTG
CCCGGCGCGCTGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTG
CGCGTACGCGACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTG
TCGCCACGCGGGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTG
CCAGGAGGGCTGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGC
GCTCCAGGCCCGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCT
GGCCGCGGCGCAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCG
CTGCGTGGCCGCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAA
TATTATTGGTGGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGC
AGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGA
TGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCAT
CTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCC
TGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTA
CTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAA
CCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGAC
TATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTA
TGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAA
AGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCA
GGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTT
CACATACCTCATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCAC
CTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGAC
CGAAGCTTACATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGT
GTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCAT
CCCCAAATACAAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTA
CGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAA
TGCTATGGTGAATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGA
CTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGT
AACCATCGAAGAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGA
GCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGA
AGTCCTTTTTGACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGT
GGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAA
AGCTGGCGACAAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTA
CTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCC
TGTGGTGGCAGCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGG
CAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACA
GACTGGAGACTTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTA
CCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATG
GATCATGACAGAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAA
ACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGA
CTGCTCCAAGTCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGC
CCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGA
ATCTTGTCATGGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCC
TCTGCTTTTGATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAA
ACTGTGAACCAAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATA
AACTCTTAAAGATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCC
TTCATCAGAAATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATA

>In-frame_PDZRN3_ENST00000263666_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_4339nt
GTCCGGGGAGAGCCAGCGAGCGCGCGGGCGGCGTAGCCGGCCTGTCTGGGCCGCCTCGTGGGGAGGGAGGGGGCGCCCGGCCGCCCGGCG
GCGACCCCGGGGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCA
CAAGGTCCTGGAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTG
CCCGGCGCGCTGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTG
CGCGTACGCGACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTG
TCGCCACGCGGGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTG
CCAGGAGGGCTGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGC
GCTCCAGGCCCGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCT
GGCCGCGGCGCAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCG
CTGCGTGGCCGCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAA
TATTATTGGTGGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGC
AGCCAAGGAAGGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGA
TGCAGACTTACAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCAT
CTTAGCCCCAAATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCC
TGCAATTGTCAATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTA
CTTTGGAAGTGCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAA
CCGAAAATGGTACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGAC
TATCGCGAAGCAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTA
TGTGGAACCTTGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAA
AGGAATTGGAATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCA
GGCCATCATGCTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTT
CACATACCTCATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCAC
CTTGGCTGATGTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGAC
CGAAGCTTACATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGT
GTTTAGTAAGCAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCAT
CCCCAAATACAAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTA
CGAAGAAGGAAAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAA
TGCTATGGTGAATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGA
CTACTATTATACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGT
AACCATCGAAGAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGA
GCACCGCCATCTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGA
AGTCCTTTTTGACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGT
GGAGGTTGCCTTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAA
AGCTGGCGACAAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTA
CTCGATCCCATTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCC
TGTGGTGGCAGCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGG
CAAATGCTCCATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACA
GACTGGAGACTTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTA
CCAAGCCATGTGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATG
GATCATGACAGAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAA
ACAGACCCTGGAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGA
CTGCTCCAAGTCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGC
CCCCATCACCATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGA
ATCTTGTCATGGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCC
TCTGCTTTTGATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAA
ACTGTGAACCAAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATA
AACTCTTAAAGATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCC
TTCATCAGAAATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATA

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000415676_chr3_54420742_+_4155nt
GGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTG
GAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGC
TGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCG
ACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCG
GGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGC
TGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCC
CGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCG
CAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCC
GCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGT
GGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAA
GGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTA
CAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCA
AATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTC
AATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGT
GCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGG
TACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAG
CAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCT
TGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGA
ATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATG
CTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTC
ATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGAT
GTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTAC
ATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAG
CAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATAC
AAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGA
AAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTG
AATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTAT
ACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAA
GAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCAT
CTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTT
GACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCC
TTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGAC
AAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCA
TTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCA
GCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCC
ATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGAC
TTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATG
TGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACA
GAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTG
GAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAG
TCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACC
ATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCAT
GGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTG
ATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAAACTGTGAACC
AAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATAAACTCTTAAA
GATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCCTTCATCAGAA

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000288197_chr3_54420742_+_4235nt
GGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTG
GAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGC
TGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCG
ACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCG
GGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGC
TGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCC
CGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCG
CAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCC
GCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGT
GGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAA
GGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTA
CAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCA
AATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTC
AATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGT
GCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGG
TACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAG
CAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCT
TGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGA
ATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATG
CTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTC
ATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGAT
GTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTAC
ATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAG
CAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATAC
AAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGA
AAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTG
AATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTAT
ACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAA
GAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCAT
CTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTT
GACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCC
TTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGAC
AAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCA
TTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCA
GCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCC
ATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGAC
TTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATG
TGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACA
GAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTG
GAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAG
TCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACC
ATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCAT
GGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTG
ATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAAACTGTGAACC
AAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATAAACTCTTAAA
GATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCCTTCATCAGAA
ATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATAAAGTATATTA

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000474759_chr3_54420742_+_4239nt
GGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTG
GAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGC
TGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCG
ACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCG
GGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGC
TGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCC
CGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCG
CAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCC
GCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGT
GGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAA
GGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTA
CAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCA
AATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTC
AATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGT
GCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGG
TACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAG
CAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCT
TGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGA
ATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATG
CTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTC
ATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGAT
GTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTAC
ATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAG
CAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATAC
AAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGA
AAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTG
AATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTAT
ACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAA
GAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCAT
CTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTT
GACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCC
TTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGAC
AAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCA
TTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCA
GCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCC
ATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGAC
TTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATG
TGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACA
GAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTG
GAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAG
TCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACC
ATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCAT
GGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTG
ATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAAACTGTGAACC
AAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATAAACTCTTAAA
GATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCCTTCATCAGAA
ATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATAAAGTATATTA

>In-frame_PDZRN3_ENST00000308537_chr3_73651505_-_CACNA2D3_ENST00000490478_chr3_54420742_+_4239nt
GGCCTGGCCGCCACCATGGGCTTCGAGCTGGACCGCTTCGACGGCGACGTGGACCCGGACCTGAAGTGCGCGCTGTGCCACAAGGTCCTG
GAGGACCCGCTGACCACGCCGTGCGGCCACGTCTTCTGCGCCGGCTGCGTGCTGCCCTGGGTGGTGCAGGAGGGCAGCTGCCCGGCGCGC
TGCCGCGGTCGCCTGTCGGCCAAAGAGCTCAACCACGTCCTGCCGCTCAAGCGCCTTATCCTCAAGCTGGACATCAAGTGCGCGTACGCG
ACGCGCGGCTGCGGCCGGGTGGTCAAGCTGCAGCAGCTGCCGGAGCACCTCGAGCGCTGCGACTTCGCGCCCGCGCGCTGTCGCCACGCG
GGTTGCGGCCAGGTGCTGCTGCGGCGCGACGTGGAGGCGCACATGCGCGACGCCTGCGACGCGCGGCCAGTGGGCCGCTGCCAGGAGGGC
TGCGGGCTACCCTTGACGCACGGCGAGCAGCGCGCGGGCGGCCACTGCTGCGCGCGAGCGCTGCGGGCGCACAACGGCGCGCTCCAGGCC
CGCCTGGGCGCGCTGCACAAGGCGCTCAAGAAGGAGGCGCTGCGCGCTGGGAAGCGCGAGAAGTCGCTGGTGGCCCAGCTGGCCGCGGCG
CAGCTTGAGCTGCAGATGACCGCGCTGCGCTACCAGAAGAAATTCACCGAATACAGCGCGCGCCTCGACTCGCTCAGCCGCTGCGTGGCC
GCGCCGCCCGGCGGCAAGGGCGAAGAAACCAAAAGTCTGACTCTTGTCCTGCATCGGGACTCCGGCTCCCTGGGATTCAATATTATTGGT
GGCCGGCCGAGTGTGGATAACCACGATGGATCATCCAGTGAAGGAATCTTTGTATCCAAGATAGTTGACAGTGGGCCTGCAGCCAAGGAA
GGAGGCCTGCAAATTCATGACAGGATTATTGAGCGTCTGGTGGAGGCTGCAGAAGAAGCACACCTGAAACATGAATTTGATGCAGACTTA
CAGTATGAATACTTCAATGCTGTGCTGATAAATGAAAGGGACAAAGACGGGAATTTTTTGGAGCTGGGAAAGGAATTCATCTTAGCCCCA
AATGACCATTTTAATAATTTGCCTGTGAACATCAGTCTAAGTGACGTCCAAGTACCAACGAACATGTACAACAAAGACCCTGCAATTGTC
AATGGGGTTTATTGGTCTGAATCTCTAAACAAAGTTTTTGTAGATAACTTTGACCGTGACCCATCTCTCATATGGCAGTACTTTGGAAGT
GCAAAGGGCTTTTTTAGGCAGTATCCGGGGATTAAATGGGAACCAGATGAGAATGGAGTCATTGCCTTCGACTGCAGGAACCGAAAATGG
TACATCCAGGCAGCAACTTCTCCGAAAGACGTGGTCATTTTAGTTGACGTCAGTGGCAGCATGAAAGGACTCCGTCTGACTATCGCGAAG
CAAACAGTCTCATCCATTTTGGATACACTTGGGGATGATGACTTCTTCAACATAATTGCTTATAATGAGGAGCTTCACTATGTGGAACCT
TGCCTGAATGGAACTTTGGTGCAAGCCGACAGGACAAACAAAGAGCACTTCAGGGAGCATCTGGACAAACTTTTCGCCAAAGGAATTGGA
ATGTTGGATATAGCTCTGAATGAGGCCTTCAACATTCTGAGTGATTTCAACCACACGGGACAAGGAAGTATCTGCAGTCAGGCCATCATG
CTCATAACTGATGGGGCGGTGGACACCTATGATACAATCTTTGCAAAATACAATTGGCCAGATCGAAAGGTTCGCATCTTCACATACCTC
ATTGGACGAGAGGCTGCGTTTGCAGACAATCTAAAGTGGATGGCCTGTGCCAACAAAGGATTTTTTACCCAGATCTCCACCTTGGCTGAT
GTGCAGGAGAATGTCATGGAATACCTTCACGTGCTTAGCCGGCCCAAAGTCATCGACCAGGAGCATGATGTGGTGTGGACCGAAGCTTAC
ATTGACAGCACTCTCCCTCAGGCACAAAAGCTGACTGATGATCAGGGCCCCGTCCTGATGACCACTGTAGCCATGCCTGTGTTTAGTAAG
CAGAACGAAACCAGATCGAAGGGCATTCTTCTGGGAGTGGTTGGCACAGATGTCCCAGTGAAAGAACTTCTGAAGACCATCCCCAAATAC
AAGTTAGGGATTCACGGTTATGCCTTTGCAATCACAAATAATGGATATATCCTGACGCATCCGGAACTCAGGCTGCTGTACGAAGAAGGA
AAAAAGCGAAGGAAACCTAACTATAGTAGCGTTGACCTCTCTGAGGTGGAGTGGGAAGACCGAGATGACGTGTTGAGAAATGCTATGGTG
AATCGAAAGACGGGGAAGTTTTCCATGGAGGTGAAGAAGACAGTGGACAAAGGGAAACGGGTTTTGGTGATGACAAATGACTACTATTAT
ACAGACATCAAGGGTACTCCTTTCAGTTTAGGTGTGGCGCTTTCCAGAGGTCATGGGAAATATTTCTTCCGAGGGAATGTAACCATCGAA
GAAGGCCTGCATGACTTAGAACATCCCGATGTGTCCTTGGCAGATGAATGGTCCTACTGCAACACTGACCTACACCCTGAGCACCGCCAT
CTGTCTCAGTTAGAAGCGATTAAGCTCTACCTAAAAGGCAAAGAACCTCTGCTCCAGTGTGATAAAGAATTGATCCAAGAAGTCCTTTTT
GACGCGGTGGTGAGTGCCCCCATTGAAGCGTATTGGACCAGCCTGGCCCTCAACAAATCTGAAAATTCTGACAAGGGCGTGGAGGTTGCC
TTCCTCGGCACTCGCACGGGCCTCTCCAGAATCAACCTGTTTGTCGGGGCTGAGCAGCTCACCAATCAGGACTTCCTGAAAGCTGGCGAC
AAGGAGAACATTTTTAACGCAGACCATTTCCCTCTCTGGTACCGAAGAGCCGCTGAGCAGATTCCAGGGAGCTTCGTCTACTCGATCCCA
TTCAGCACTGGACCAGTCAATAAAAGCAATGTGGTGACAGCAAGTACATCCATCCAGCTCCTGGATGAACGGAAATCTCCTGTGGTGGCA
GCTGTAGGCATTCAGATGAAACTTGAATTTTTCCAAAGGAAGTTCTGGACTGCCAGCAGACAGTGTGCTTCCCTGGATGGCAAATGCTCC
ATCAGCTGTGATGATGAGACTGTGAATTGTTACCTCATAGACAATAATGGATTTATTTTGGTGTCTGAAGACTACACACAGACTGGAGAC
TTTTTTGGTGAGATCGAGGGAGCTGTGATGAACAAATTGCTAACAATGGGCTCCTTTAAAAGAATTACCCTTTATGACTACCAAGCCATG
TGTAGAGCCAACAAGGAAAGCAGCGATGGCGCCCATGGCCTCCTGGATCCTTATAATGCCTTCCTCTCTGCAGTAAAATGGATCATGACA
GAACTTGTCTTGTTCCTGGTGGAATTTAACCTCTGCAGTTGGTGGCACTCCGATATGACAGCTAAAGCCCAGAAATTGAAACAGACCCTG
GAGCCTTGTGATACTGAATATCCAGCATTCGTCTCTGAGCGCACCATCAAGGAGACTACAGGGAATATTGCTTGTGAAGACTGCTCCAAG
TCCTTTGTCATCCAGCAAATCCCAAGCAGCAACCTGTTCATGGTGGTGGTGGACAGCAGCTGCCTCTGTGAATCTGTGGCCCCCATCACC
ATGGCACCCATTGAAATCAGGTATAATGAATCCCTTAAGTGTGAACGTCTAAAGGCCCAGAAGATCAGAAGGCGCCCAGAATCTTGTCAT
GGCTTCCATCCTGAGGAGAATGCAAGGGAGTGTGGGGGTGCGCCGAGTCTCCAAGCCCAGACAGTCCTCCTTCTGCTCCCTCTGCTTTTG
ATGCTCTTCTCAAGGTGACACTGACTGAGATGTTCTCTTACTGACTGAGATGTTCTCTTGGCATGCTAAATCATGGATAAACTGTGAACC
AAAATATGGTGCAACATACGAGACATGAATATAGTCCAACCATCAGCATCTCATCATGATTTTAAACTGTGCGTGATATAAACTCTTAAA
GATATGTTGACAAAAAGTTATCTATCATCTTTTTACTTTGCCAGTCATGCAAATGTGAGTTTGCCACATGATAATCACCCTTCATCAGAA
ATGGGACCGCAAGTGGTAGGCAGTGTCCCTTCTGCTTGAAACCTATTGAAACCAATTTAAAACTGTGTACTTTTTAAATAAAGTATATTA


Top

FusionGenePPI for PDZRN3_CACNA2D3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDZRN3MUSK, UBE2D2, LNX1, LNX2, OIP5, FAM13C, OFD1, SDHA, ZNF785, STX11, POTEB3, FZD4CACNA2D3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDZRN3_CACNA2D3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCACNA2D3Q8IZS8DB00381AmlodipineVoltage-dependent calcium channel subunit alpha-2/delta-3small moleculeapproved
TgeneCACNA2D3Q8IZS8DB06712NilvadipineVoltage-dependent calcium channel subunit alpha-2/delta-3small moleculeapproved|investigational

Top

RelatedDiseases for PDZRN3_CACNA2D3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDZRN3C0023893Liver Cirrhosis, Experimental1CTD_human