FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26540

FusionGeneSummary for PDLIM5_TIMM23

check button Fusion gene summary
Fusion gene informationFusion gene name: PDLIM5_TIMM23
Fusion gene ID: 26540
HgeneTgene
Gene symbol

PDLIM5

TIMM23

Gene ID

10611

100287932

Gene namePDZ and LIM domain 5translocase of inner mitochondrial membrane 23
SynonymsENH|ENH1|L9|LIMTIM23
Cytomap

4q22.3

10q11.22

Type of geneprotein-codingprotein-coding
DescriptionPDZ and LIM domain protein 5enigma homologenigma-like LIM domain proteinenigma-like PDZ and LIM domains proteinmitochondrial import inner membrane translocase subunit Tim23translocase of inner mitochondrial membrane 23 homologtranslocase of the inner mitochondrial membrane
Modification date2018052220180523
UniProtAcc

Q96HC4

O14925

Ensembl transtripts involved in fusion geneENST00000450793, ENST00000538141, 
ENST00000380180, ENST00000318007, 
ENST00000437932, ENST00000317968, 
ENST00000542407, ENST00000508216, 
ENST00000514743, ENST00000380176, 
ENST00000359265, ENST00000512274, 
ENST00000504489, 
ENST00000260867, 
ENST00000485812, ENST00000374064, 
ENST00000374065, 
Fusion gene scores* DoF score14 X 14 X 6=11762 X 2 X 2=8
# samples 152
** MAII scorelog2(15/1176*10)=-2.97085365434048
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: PDLIM5 [Title/Abstract] AND TIMM23 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-06-2570-01APDLIM5chr4

95376535

+TIMM23chr10

51613311

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000450793ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000450793ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000450793ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000450793ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000538141ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000538141ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000538141ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000538141ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000380180ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000380180ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000380180ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000380180ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000318007ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000318007ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000318007ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000318007ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000437932ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000437932ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000437932ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000437932ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000317968ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000317968ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000317968ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000317968ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5UTR-3CDSENST00000542407ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5UTR-intronENST00000542407ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5UTR-intronENST00000542407ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5UTR-intronENST00000542407ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000508216ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000508216ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000508216ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000508216ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000514743ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000514743ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000514743ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000514743ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
intron-3CDSENST00000380176ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
intron-intronENST00000380176ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
intron-intronENST00000380176ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
intron-intronENST00000380176ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000359265ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000359265ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000359265ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000359265ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
Frame-shiftENST00000512274ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000512274ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000512274ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000512274ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
In-frameENST00000504489ENST00000260867PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000504489ENST00000485812PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000504489ENST00000374064PDLIM5chr4

95376535

+TIMM23chr10

51613311

+
5CDS-intronENST00000504489ENST00000374065PDLIM5chr4

95376535

+TIMM23chr10

51613311

+

Top

FusionProtFeatures for PDLIM5_TIMM23


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDLIM5

Q96HC4

TIMM23

O14925

May play an important role in the heart development byscaffolding PKC to the Z-disk region. May play a role in theregulation of cardiomyocyte expansion. Overexpression promotes thedevelopment of heart hypertrophy. Contributes to the regulation ofdendritic spine morphogenesis in neurons. May restrainpostsynaptic growth of excitatory synapses (By similarity).{ECO:0000250}. Essential component of the TIM23 complex, a complex thatmediates the translocation of transit peptide-containing proteinsacross the mitochondrial inner membrane.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTIMM23chr4:95376535chr10:51613311ENST00000260867-17125_14555210TransmembraneHelical
TgeneTIMM23chr4:95376535chr10:51613311ENST00000260867-17181_19755210TransmembraneHelical
TgeneTIMM23chr4:95376535chr10:51613311ENST00000260867-1773_9355210TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDLIM5chr4:95376535chr10:51613311ENST00000317968+2132_8532597DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000317968+213418_47732597DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000317968+213477_53632597DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000317968+213536_59632597DomainLIM zinc-binding 3
HgenePDLIM5chr4:95376535chr10:51613311ENST00000318007+2102_8532215DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000318007+210418_47732215DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000318007+210477_53632215DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000318007+210536_59632215DomainLIM zinc-binding 3
HgenePDLIM5chr4:95376535chr10:51613311ENST00000359265+232_8532137DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000359265+23418_47732137DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000359265+23477_53632137DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000359265+23536_59632137DomainLIM zinc-binding 3
HgenePDLIM5chr4:95376535chr10:51613311ENST00000380180+292_8532235DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000380180+29418_47732235DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000380180+29477_53632235DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000380180+29536_59632235DomainLIM zinc-binding 3
HgenePDLIM5chr4:95376535chr10:51613311ENST00000437932+2132_8532488DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000437932+213418_47732488DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000437932+213477_53632488DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000437932+213536_59632488DomainLIM zinc-binding 3
HgenePDLIM5chr4:95376535chr10:51613311ENST00000508216+182_8532235DomainPDZ
HgenePDLIM5chr4:95376535chr10:51613311ENST00000508216+18418_47732235DomainLIM zinc-binding 1
HgenePDLIM5chr4:95376535chr10:51613311ENST00000508216+18477_53632235DomainLIM zinc-binding 2
HgenePDLIM5chr4:95376535chr10:51613311ENST00000508216+18536_59632235DomainLIM zinc-binding 3


Top

FusionGeneSequence for PDLIM5_TIMM23


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDLIM5_ENST00000450793_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000538141_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000380180_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000318007_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000437932_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000317968_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000508216_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000514743_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000359265_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS

>In-frame_PDLIM5_ENST00000504489_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_187aa
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRN
VQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDLIM5_ENST00000450793_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000538141_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000380180_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000318007_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000437932_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000317968_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000508216_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000514743_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000359265_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC

>In-frame_PDLIM5_ENST00000504489_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_561nt
ATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATC
TCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGT
TGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAAT
GTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTC
ATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGT
CTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDLIM5_ENST00000450793_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1136nt
AGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCC
GCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGG
CCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACC
TACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAAT
GAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCA
AGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGA
TGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGAC
AGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTG
CCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAG
TTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAA
GCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAG
AAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCA

>In-frame_PDLIM5_ENST00000538141_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1136nt
AGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCC
GCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGG
CCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACC
TACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAAT
GAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCA
AGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGA
TGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGAC
AGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTG
CCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAG
TTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAA
GCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAG
AAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCA

>In-frame_PDLIM5_ENST00000380180_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1136nt
AGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCC
GCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGG
CCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACC
TACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAAT
GAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCA
AGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGA
TGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGAC
AGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTG
CCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAG
TTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAA
GCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAG
AAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCA

>In-frame_PDLIM5_ENST00000318007_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1136nt
AGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCC
GCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGG
CCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACC
TACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAAT
GAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCA
AGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGA
TGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGAC
AGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTG
CCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAG
TTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAA
GCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAG
AAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCA

>In-frame_PDLIM5_ENST00000437932_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1136nt
AGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCC
GCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGG
CCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACC
TACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAAT
GAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCA
AGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGA
TGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGAC
AGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTG
CCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAG
TTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAA
GCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAG
AAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCA

>In-frame_PDLIM5_ENST00000317968_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1121nt
GTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCCGCGCCGCGCCGGACC
CGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGG
TTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAA
AACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCT
AGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGC
TAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGT
AGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTAC
CAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTGCCAACTCATGAATGG
AGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAGTTTGAAAAATTGGAG
ATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAAGCCAAAGCCCTTTGG
TGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAGAAAACCACTTACTCC
CAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCACTGTATTCCAAATAA

>In-frame_PDLIM5_ENST00000508216_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1029nt
AGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTT
TCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAA
CCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAG
GATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTA
ATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAG
CAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCA
GCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTGCCAACTCATGAATGGAG
GACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAGTTTGAAAAATTGGAGAT
TTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAAGCCAAAGCCCTTTGGTG
ACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAGAAAACCACTTACTCCCA
GAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCACTGTATTCCAAATAAAG

>In-frame_PDLIM5_ENST00000514743_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1029nt
AGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTT
TCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAA
CCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAG
GATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTA
ATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAG
CAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCA
GCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTGCCAACTCATGAATGGAG
GACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTAGTTTGAAAAATTGGAGAT
TTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAAGCCAAAGCCCTTTGGTG
ACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTAGAAAACCACTTACTCCCA
GAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGCACTGTATTCCAAATAAAG

>In-frame_PDLIM5_ENST00000359265_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1137nt
GAGCCAGGAGGCGGAAGTTCCCGCGGGCGGTGGGGACGGCGCCCTCACCGCGAGTCACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCC
CGCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATTAGAACCATGAGCAACTACAGTGTGTCACTGGTTG
GCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTGACAATCTCTAGTGATACAGATGAGTTTATTTTAC
CTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGAGGATGTTGCATGACAGGGGCTGCGTTTGGTGCAA
TGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCAAGAAATGTACAGATTTTGAATATGGTGACTAGGC
AAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTTGGTGTCATCATTGAGAAAACACGAGGTGCAGAAG
ATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACAGGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGA
CAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAAGGCTCCTTGCTCCAACAGTCACTCTGAAGATTTT
GCCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAGTTTGGAGTTATTCTCTCTCTTCTACCTACAATTA
GTTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCAAGACTGGCACTTGTTCCAGCCATTAGTGAGTTGA
AGCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGATCTTGCACGTATCTGTTTTCCTCCCCCATGAACTA
GAAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGTCCATTCATTTAATGATCCAAAACTGTAATGTTGC

>In-frame_PDLIM5_ENST00000504489_chr4_95376535_+_TIMM23_ENST00000260867_chr10_51613311_+_1081nt
ACTTGTCAGCCCTTGTCTGAGGCGGAGGCAGCCCCGCGCCGCGCCGGACCCGAGCATATTTCATTTTCTGTCATTGGACTTTGAGCCATT
AGAACCATGAGCAACTACAGTGTGTCACTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTGCAGGGCGGTAAGGATTTCAACATGCCTCTG
ACAATCTCTAGTGATACAGATGAGTTTATTTTACCTACCGGAGCTAATAAAACCCGGGGCAGATTTGAGCTGGCCTTCTTTACGATTGGA
GGATGTTGCATGACAGGGGCTGCGTTTGGTGCAATGAATGGTCTTCGGCTAGGATTGAAGGAAACCCAGAACATGGCCTGGTCCAAACCA
AGAAATGTACAGATTTTGAATATGGTGACTAGGCAAGGGGCACTTTGGGCTAATACTCTAGGTTCTCTGGCTTTGCTCTATAGTGCATTT
GGTGTCATCATTGAGAAAACACGAGGTGCAGAAGATGACCTTAACACAGTAGCAGCTGGAACCATGACAGGCATGTTGTATAAATGTACA
GGTGGTCTTCGAGGGATAGCACGAGGTGGTCTGACAGGACTAACACTTACCAGCCTCTATGCACTATATAATAACTGGGAGCACATGAAA
GGCTCCTTGCTCCAACAGTCACTCTGAAGATTTTGCCAACTCATGAATGGAGGACACTTCAGTAGTCATCTAGATCCTTTTATAAGACAG
TTTGGAGTTATTCTCTCTCTTCTACCTACAATTAGTTTGAAAAATTGGAGATTTTGATTTGCTGTGATGAAAATCCTGGATGGCTGACCA
AGACTGGCACTTGTTCCAGCCATTAGTGAGTTGAAGCCAAAGCCCTTTGGTGACTCACTGAGTACCATGGTTCTGTTCTCCTCTGGAGAT
CTTGCACGTATCTGTTTTCCTCCCCCATGAACTAGAAAACCACTTACTCCCAGAATTCAGGTCGTGCTTGTTAGTACTATATCACCAAGT
CCATTCATTTAATGATCCAAAACTGTAATGTTGCACTGTATTCCAAATAAAGGGTAAAAACAGAACCAAAGTTATAACTCCAACACACAA


Top

FusionGenePPI for PDLIM5_TIMM23


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDLIM5TRIM39, CACNA1B, PRKCB, PRKCE, GFI1B, NDUFA7, SIN3A, ELMSAN1, DSTN, FN1, CALU, EIF4A3, METTL1, NPLOC4, PDE12, ANP32A, CBS, IPO11, PKM, PLIN3, SRP14, UBA2, RAD23B, TPD52, ZYX, COIL, CCDC136, KRT40, KRTAP10-7, SUZ12, RNF2, BMI1, SIRT6, ILK, METTL6, RWDD2B, SYT11, DNAJC8, MAP2K1, MAP2K2, ARFIP2, CAMK2G, NTRK1, BTRC, MED4, SSX2IP, CEP128, CEP19, XPO1, CDH1, PDLIM7, TULP3, PHF19, NFATC2IP, DENR, TPM2, EMILIN1, ATG14, G3BP1, BRCA1, TESTIMM23FBXO6, EGFR, TIMM17B, ABCE1, NDUFA13, ATXN3, PML, FANCI, SUCO, MCM2, FAF2, OPA3, C15orf48, COQ9, SLC2A8, ATP12A, TMEM184B, C1orf85, RUFY1, ATP2B2, PIKFYVE


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDLIM5_TIMM23


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PDLIM5_TIMM23


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDLIM5C0005586Bipolar Disorder5PSYGENET
HgenePDLIM5C0036341Schizophrenia4PSYGENET
HgenePDLIM5C0041696Unipolar Depression4PSYGENET
HgenePDLIM5C1269683Major Depressive Disorder4PSYGENET
HgenePDLIM5C0151744Myocardial Ischemia1CTD_human
HgenePDLIM5C0221765Chronic schizophrenia1PSYGENET