FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26469

FusionGeneSummary for PDGFRL_VPS37A

check button Fusion gene summary
Fusion gene informationFusion gene name: PDGFRL_VPS37A
Fusion gene ID: 26469
HgeneTgene
Gene symbol

PDGFRL

VPS37A

Gene ID

5157

137492

Gene nameplatelet derived growth factor receptor likeVPS37A, ESCRT-I subunit
SynonymsPDGRL|PRLTSHCRP1|PQBP2|SPG53
Cytomap

8p22

8p22

Type of geneprotein-codingprotein-coding
Descriptionplatelet-derived growth factor receptor-like proteinPDGF receptor beta-like tumor suppressorPDGFR-like proteinplatelet-derived growth factor-beta-like tumor suppressorvacuolar protein sorting-associated protein 37AESCRT-I complex subunit VPS37Ahepatocellular carcinoma-related protein 1polyglutamine binding protein 2vacuolar protein sorting 37 homolog A
Modification date2018032920180522
UniProtAcc

Q15198

Q8NEZ2

Ensembl transtripts involved in fusion geneENST00000541323, ENST00000251630, 
ENST00000398074, ENST00000523248, 
ENST00000324849, ENST00000324815, 
ENST00000521829, ENST00000521005, 
ENST00000521162, 
Fusion gene scores* DoF score2 X 2 X 2=84 X 4 X 3=48
# samples 24
** MAII scorelog2(2/8*10)=1.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PDGFRL [Title/Abstract] AND VPS37A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-91-A4BC-01APDGFRLchr8

17447274

+VPS37Achr8

17132242

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000541323ENST00000324849PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000541323ENST00000324815PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000541323ENST00000521829PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000541323ENST00000521005PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000541323ENST00000521162PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
In-frameENST00000251630ENST00000324849PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000251630ENST00000324815PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000251630ENST00000521829PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000251630ENST00000521005PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000251630ENST00000521162PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
In-frameENST00000398074ENST00000324849PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000398074ENST00000324815PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000398074ENST00000521829PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000398074ENST00000521005PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
5CDS-intronENST00000398074ENST00000521162PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
intron-3CDSENST00000523248ENST00000324849PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
intron-intronENST00000523248ENST00000324815PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
intron-intronENST00000523248ENST00000521829PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
intron-intronENST00000523248ENST00000521005PDGFRLchr8

17447274

+VPS37Achr8

17132242

+
intron-intronENST00000523248ENST00000521162PDGFRLchr8

17447274

+VPS37Achr8

17132242

+

Top

FusionProtFeatures for PDGFRL_VPS37A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDGFRL

Q15198

VPS37A

Q8NEZ2

Component of the ESCRT-I complex, a regulator ofvesicular trafficking process. Required for the sorting ofendocytic ubiquitinated cargos into multivesicular bodies. May beinvolved in cell growth and differentiation.{ECO:0000269|PubMed:15240819}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneVPS37Achr8:17447274chr8:17132242ENST00000324815+06308_397-118186DomainVPS37 C-terminal
TgeneVPS37Achr8:17447274chr8:17132242ENST00000324849+312308_3971381144DomainVPS37 C-terminal
TgeneVPS37Achr8:17447274chr8:17132242ENST00000521829+211308_397113312DomainVPS37 C-terminal

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDGFRLchr8:17447274chr8:17132242ENST00000251630+37272_375117376DomainNote=Ig-like C2-type 2
HgenePDGFRLchr8:17447274chr8:17132242ENST00000251630+3762_159117376DomainNote=Ig-like C2-type 1
HgenePDGFRLchr8:17447274chr8:17132242ENST00000398074+26272_375117376DomainNote=Ig-like C2-type 2
HgenePDGFRLchr8:17447274chr8:17132242ENST00000398074+2662_159117376DomainNote=Ig-like C2-type 1
HgenePDGFRLchr8:17447274chr8:17132242ENST00000541323+37272_375117376DomainNote=Ig-like C2-type 2
HgenePDGFRLchr8:17447274chr8:17132242ENST00000541323+3762_159117376DomainNote=Ig-like C2-type 1


Top

FusionGeneSequence for PDGFRL_VPS37A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDGFRL_ENST00000541323_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_377aa
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQ
TVELRCKGSRIGWSYPATLDTFKDSRLSLYSNPSGMSPTASQGFPFLPPTPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSN
LPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLE
AKRQTVLDKTELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEE

>In-frame_PDGFRL_ENST00000251630_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_377aa
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQ
TVELRCKGSRIGWSYPATLDTFKDSRLSLYSNPSGMSPTASQGFPFLPPTPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSN
LPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLE
AKRQTVLDKTELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEE

>In-frame_PDGFRL_ENST00000398074_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_377aa
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQ
TVELRCKGSRIGWSYPATLDTFKDSRLSLYSNPSGMSPTASQGFPFLPPTPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSN
LPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLE
AKRQTVLDKTELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHCRRAKEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDGFRL_ENST00000541323_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_1131nt
ATGAAGGTCTGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCA
AAAGAACCAGGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCA
GCACCAAAGACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAA
ACTGTAGAGCTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATAC
AGTAACCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACT
TCTTTATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAAT
CTGCCATTACCCATTCCCACAGTGGATGCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTT
CCAGAACTCTCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAA
CTAAAACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAA
GCCAAAAGACAAACTGTTTTAGATAAGTATGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTT
AGTGAGAGCTGTAGTGCAAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGAC
TTCTTGGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAG

>In-frame_PDGFRL_ENST00000251630_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_1131nt
ATGAAGGTCTGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCA
AAAGAACCAGGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCA
GCACCAAAGACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAA
ACTGTAGAGCTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATAC
AGTAACCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACT
TCTTTATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAAT
CTGCCATTACCCATTCCCACAGTGGATGCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTT
CCAGAACTCTCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAA
CTAAAACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAA
GCCAAAAGACAAACTGTTTTAGATAAGTATGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTT
AGTGAGAGCTGTAGTGCAAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGAC
TTCTTGGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAG

>In-frame_PDGFRL_ENST00000398074_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_1131nt
ATGAAGGTCTGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCA
AAAGAACCAGGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCA
GCACCAAAGACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAA
ACTGTAGAGCTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATAC
AGTAACCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACT
TCTTTATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAAT
CTGCCATTACCCATTCCCACAGTGGATGCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTT
CCAGAACTCTCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAA
CTAAAACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAA
GCCAAAAGACAAACTGTTTTAGATAAGTATGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTT
AGTGAGAGCTGTAGTGCAAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGAC
TTCTTGGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDGFRL_ENST00000541323_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_4614nt
ACTTCTGCCTTGTTATCAGAGGAGCGAGGATGTGGCCTGTGTGCCGCCTAATCATGCCTAGAACTGTCTGCACCTGCTGATCTTTTGCTT
CTGCGAACTGGCTGCACCTGCTGTTCTCCTGCTCATACCCTAGCCCGTGCTTACCCTAATTCCCTGTTCTCCTGCCTCACCACCAGAGGC
CCGGGTTGTCTGCACAGTCTCATTTTCCACGTTATTCCTGTAATGAACCCGTCCTCCCACCCCCACCAGCAGTTACAGGGCTGGGTGCGG
AGACCAACTCTGGCCAGACACAGAGGAGCAGCAAGAACCCGGGGCAACGGTCCTGTGAAAACCGAATCCTCCCGCTTCGGCGTCCCAGGA
GCCCGCCCCTCGCCCGCCGCCTCCCCTGCGTCCCCGCCCCGCGCAGCCGCCGCGCTCCTGCGCTCCGAGGTCCGAGGTTCCCGAGATGAA
GGTCTGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCAAAAGA
ACCAGGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCAGCACC
AAAGACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAAACTGT
AGAGCTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATACAGTAA
CCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACTTCTTT
ATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAATCTGCC
ATTACCCATTCCCACAGTGGATGCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTTCCAGA
ACTCTCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAACTAAA
ACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAAGCCAA
AAGACAAACTGTTTTAGATAAGTATGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTTAGTGA
GAGCTGTAGTGCAAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGACTTCTT
GGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAGAAACT
TCAGCAGGCGATAGCAATGCACAGCCAATTTCATGCTCCACTATAGATTTTCCTGGAAACATGAACTGCCAAGAGAGGAATGGGACACAA
AACCAAACACTGTTTTATATTTATGGTTTGCAAACTGGCATTTCATCAGTGGCTAAATTCACAGATATCCTATATAGATTGTATACAGAA
CTGAGACTGATTTTGTACCGATTAGAATGATTGCTATGATCTTTGAGAAATTTTTCTGCACTATTTGCACTGAAATGTTTATTTATTGTT
GATAAATTGTATCATATTTAAGTTCCACTGCTGTTCCTCTTACCTTGATTAAATGCCTATGCATGTACTTTTAGCTAGTTTTTAATATTT
TATAAAACTTCATTTAAATTTGTATTTTTAACTTGAAGTTCCATTTCTTTATCAAGGATGGTATTTAGATTTTTTTCCTCTTAACCTTTT
TTCAAAAACTATTTTCAACTGTGAGGAAACCCTTATTTTTCTTTCTTTGTGGATAAAACTTTCAAAAGCAATTTAAGATATTCATAGTGT
TAGGAAACACCAAACCTGCCTATGTGCCATCTCACAAAAGAAACTTTTAATACCTACAATAAATCAAAAGAATAAACCAGCTGTTCTTAT
ATATTGTTTCATTTTTAAAACTAAAGATGCATTTAAGAAGCAATACAAGTAAATATTTTACCTAATAGGAAAAAAAAAAGTTGCCTTTCA
TTTAAACCATTCCAACAGAAATTCTTATGCTAATTTAAAACATATATATATCTGGTAGGTTTGTGGTTGGATAGGTTTTCTAAATTCCTA
ATGTTAAAAACAATCTTTATGTTAATATACACTAAATCTATACACAAAAAAAGTCAGTGAACTTTTCTGACCTTTACTGTGAGTTACCTT
TTCCTAAGAGGAAAGCTATAGTAATAAGTAAAATTTAATTTTTAGGCAATCCTGATTTTTAATGAATTTAATTGAGTGTTCTTGTATACT
ACATTGAGCAGTTTGCTTCTATACCGTGTCACAAAATTCATGTATTTCTTGAGAAGCCCTAAAAGCTCATAAAGGAAAATGCCGTGAACT
ATGTAGCTCAGGCTTGGTAAGGTGCCATCTAAATTACAAAACAAACTAATGCATAATTTTGCTTAAATTTCATCCCAGTATGATTGTCTT
CCCAACACCAGCATATAGTATAGATTGTCTGTCTTTTTTATATTTTTTAGTTCTTCCTGTACATGTTTTTGGCAATAAAGTTATAGGAAG
AACAAAATTATTTTGTTAGAATTAAAACATGCTTAATATTTAGTCTGTTTGTGGAGGGCAGGTATTCACGTGGACTGAGATACAATGTTG
GATACAGAAAATAACTTTCATTGTCTTCCTGACACTGTGCTAAGGACATGCTGTTAAAGCTTCAAAGTGACCAGATGAGGAAGGAATAAT
TAATTATTACTCCTGATTTGTAGATAACTGAGGTAAGAGTGTTTCAAATTTATGATAGTCTTTTGGGTATTCAGAAACCTTTCCTTATAC
TGCACTGGCCACCAGAGCTTAATTTTCCCAGCAGTTACAGCAATGGGAGATAGAACAGTCTCAATCTTTTGCCAACCATCAGGTTCCTAG
AAACCAGGTAGGTGTATCCCATAACAAGGGAGGAGCATACCACAGCCCCTCATTTGATTAATTCATTTGATCTATCTATGTTATTAAGTA
CCTACTAGGAATAAGGCATTGTGGAAATACTATACAAAGATAAACATTGTTTAGATGCTTATCTACTTTCCTTTTCACCAGAAAAACAGA
AAAAAAAGAAACATTTTCTTACAGAGTAAAAATGTTCTACATAATCACATGAGTAGTTCATCTCAGTGTTTTTTATTCTTTAAAGTTGAA
CTATCCCAGTTTCATTCTATACCATTCATTGGATAACCTTGTTACAACCCAGTCATGAAACAGAGCAGTGTGATCAGTTATCTGCATTTA
ACAAATAGACAAATCAGTTTACATAAAGGTTATGTATGTCACCCACGATGAAAAGAATCTGCATTTGAATATGCCCGTATGAATGTGGGT
TCTGTTTTTGCAACAGAGATTAAGTGACCATTTTTTCTAATTTTATGGCTATATATTTTCTTCATAAAAATTGGTCACATCGGAGAAGCA
GTGCCACAGGAAAAATGAAATGCATGTGAAAGTTTGTATTCTGATTTTACAAGATGAGATAGAAATCAGAATTAAAGAGGAATACTTAGG
AGTTACTAGGCTAATCAGTGTACGAATTTGTCATAGGTAGAGATTTAAAGGTTAATATCTTAAAATAGAAGAAAATTCTAAATCAATCAA
TCAGTGAGATATAAACTAAACAGACCCACTTCAAAGTTGAAAGAAATTTCTAGGCATAAATTGAGACTAGGAAATTTATATCAGAATAGA
GGGTGCTTGACACATATATATGCTTAAATTGAAGGACAGCTCAGATTCATTTTTAGGAGAAGAAAGTAAACTAATGTGCTCTTAAAGAAT
AAAAATTTATTCTATGGTTTCTGTCTCTGATCATCACCTTCCATTCTATAAAAAGCTCAGTTACTGATTTGCTGGGTCATGGTCAAAATT
CTTACCTATTTATTTCATATCAACTTTAAAAAATAAATTACTTGCATTCTATATATTACTAATTGGGAAGTAATATGCCTCAAATCAGTT
TTATACTGGATTATTCCCTATGCTTTAAACCACTGCTCTCAATAAAACACTTCCTGATTAATGTTTGATTATTAGATATTTTAGTCTTGT
TGGGGATATTTTAGTCTTGTTGGGTTAGCCATGCTCTGAAGAATCTGTGAAAGTACAGTAAAGTTTTAATAAGCAATAAATGTAACCTTT
TATATAAATCTCAGTGCTAGGTTAACTTCTAATAAGCAGACGAACATGTTACATAAATTATAATGTCTGTCTTGTAAAAAAGTTGAGGGG
ACTAAAAGTTTATGACTCTGATATGGAAGTTGTCATATTAAAAAACTACATTTTAAAACATCAAATATTTATACTATTTGCTTTTCAAAT

>In-frame_PDGFRL_ENST00000251630_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_4610nt
ACTTCTGCCTTGTTATCAGAGGAGCGAGGATGTGGCCTGTGTGCCGCCTAATCATGCCTAGAACTGTCTGCACCTGCTGATCTTTTGCTT
CTGCGAACTGGCTGCACCTGCTGTTCTCCTGCTCATACCCTAGCCCGTGCTTACCCTAATTCCCTGTTCTCCTGCCTCACCACCAGAGGC
CCGGGTTGTCTGCACAGTCTCATTTTCCACGTTATTCCTGTAATGAACCCGTCCTCCCACCCCCACCAGCAGTTACAGGGCTGGGTGCGG
AGACCAACTCTGGCCAGACACAGAGGAGCAGCAAGAACCCGGGGCAACGGTCCTAAACCGAATCCTCCCGCTTCGGCGTCCCAGGAGCCC
GCCCCTCGCCCGCCGCCTCCCCTGCGTCCCCGCCCCGCGCAGCCGCCGCGCTCCTGCGCTCCGAGGTCCGAGGTTCCCGAGATGAAGGTC
TGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCAAAAGAACCA
GGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCAGCACCAAAG
ACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAAACTGTAGAG
CTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATACAGTAACCCA
AGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACTTCTTTATCT
GTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAATCTGCCATTA
CCCATTCCCACAGTGGATGCTTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTTCCAGAACTC
TCAGAACTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAACTAAAACAA
ATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAAGCCAAAAGA
CAAACTGTTTTAGATAAGTATGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTTAGTGAGAGC
TGTAGTGCAAGTGCCCTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGACTTCTTGGAG
GGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAGAAACTTCAG
CAGGCGATAGCAATGCACAGCCAATTTCATGCTCCACTATAGATTTTCCTGGAAACATGAACTGCCAAGAGAGGAATGGGACACAAAACC
AAACACTGTTTTATATTTATGGTTTGCAAACTGGCATTTCATCAGTGGCTAAATTCACAGATATCCTATATAGATTGTATACAGAACTGA
GACTGATTTTGTACCGATTAGAATGATTGCTATGATCTTTGAGAAATTTTTCTGCACTATTTGCACTGAAATGTTTATTTATTGTTGATA
AATTGTATCATATTTAAGTTCCACTGCTGTTCCTCTTACCTTGATTAAATGCCTATGCATGTACTTTTAGCTAGTTTTTAATATTTTATA
AAACTTCATTTAAATTTGTATTTTTAACTTGAAGTTCCATTTCTTTATCAAGGATGGTATTTAGATTTTTTTCCTCTTAACCTTTTTTCA
AAAACTATTTTCAACTGTGAGGAAACCCTTATTTTTCTTTCTTTGTGGATAAAACTTTCAAAAGCAATTTAAGATATTCATAGTGTTAGG
AAACACCAAACCTGCCTATGTGCCATCTCACAAAAGAAACTTTTAATACCTACAATAAATCAAAAGAATAAACCAGCTGTTCTTATATAT
TGTTTCATTTTTAAAACTAAAGATGCATTTAAGAAGCAATACAAGTAAATATTTTACCTAATAGGAAAAAAAAAAGTTGCCTTTCATTTA
AACCATTCCAACAGAAATTCTTATGCTAATTTAAAACATATATATATCTGGTAGGTTTGTGGTTGGATAGGTTTTCTAAATTCCTAATGT
TAAAAACAATCTTTATGTTAATATACACTAAATCTATACACAAAAAAAGTCAGTGAACTTTTCTGACCTTTACTGTGAGTTACCTTTTCC
TAAGAGGAAAGCTATAGTAATAAGTAAAATTTAATTTTTAGGCAATCCTGATTTTTAATGAATTTAATTGAGTGTTCTTGTATACTACAT
TGAGCAGTTTGCTTCTATACCGTGTCACAAAATTCATGTATTTCTTGAGAAGCCCTAAAAGCTCATAAAGGAAAATGCCGTGAACTATGT
AGCTCAGGCTTGGTAAGGTGCCATCTAAATTACAAAACAAACTAATGCATAATTTTGCTTAAATTTCATCCCAGTATGATTGTCTTCCCA
ACACCAGCATATAGTATAGATTGTCTGTCTTTTTTATATTTTTTAGTTCTTCCTGTACATGTTTTTGGCAATAAAGTTATAGGAAGAACA
AAATTATTTTGTTAGAATTAAAACATGCTTAATATTTAGTCTGTTTGTGGAGGGCAGGTATTCACGTGGACTGAGATACAATGTTGGATA
CAGAAAATAACTTTCATTGTCTTCCTGACACTGTGCTAAGGACATGCTGTTAAAGCTTCAAAGTGACCAGATGAGGAAGGAATAATTAAT
TATTACTCCTGATTTGTAGATAACTGAGGTAAGAGTGTTTCAAATTTATGATAGTCTTTTGGGTATTCAGAAACCTTTCCTTATACTGCA
CTGGCCACCAGAGCTTAATTTTCCCAGCAGTTACAGCAATGGGAGATAGAACAGTCTCAATCTTTTGCCAACCATCAGGTTCCTAGAAAC
CAGGTAGGTGTATCCCATAACAAGGGAGGAGCATACCACAGCCCCTCATTTGATTAATTCATTTGATCTATCTATGTTATTAAGTACCTA
CTAGGAATAAGGCATTGTGGAAATACTATACAAAGATAAACATTGTTTAGATGCTTATCTACTTTCCTTTTCACCAGAAAAACAGAAAAA
AAAGAAACATTTTCTTACAGAGTAAAAATGTTCTACATAATCACATGAGTAGTTCATCTCAGTGTTTTTTATTCTTTAAAGTTGAACTAT
CCCAGTTTCATTCTATACCATTCATTGGATAACCTTGTTACAACCCAGTCATGAAACAGAGCAGTGTGATCAGTTATCTGCATTTAACAA
ATAGACAAATCAGTTTACATAAAGGTTATGTATGTCACCCACGATGAAAAGAATCTGCATTTGAATATGCCCGTATGAATGTGGGTTCTG
TTTTTGCAACAGAGATTAAGTGACCATTTTTTCTAATTTTATGGCTATATATTTTCTTCATAAAAATTGGTCACATCGGAGAAGCAGTGC
CACAGGAAAAATGAAATGCATGTGAAAGTTTGTATTCTGATTTTACAAGATGAGATAGAAATCAGAATTAAAGAGGAATACTTAGGAGTT
ACTAGGCTAATCAGTGTACGAATTTGTCATAGGTAGAGATTTAAAGGTTAATATCTTAAAATAGAAGAAAATTCTAAATCAATCAATCAG
TGAGATATAAACTAAACAGACCCACTTCAAAGTTGAAAGAAATTTCTAGGCATAAATTGAGACTAGGAAATTTATATCAGAATAGAGGGT
GCTTGACACATATATATGCTTAAATTGAAGGACAGCTCAGATTCATTTTTAGGAGAAGAAAGTAAACTAATGTGCTCTTAAAGAATAAAA
ATTTATTCTATGGTTTCTGTCTCTGATCATCACCTTCCATTCTATAAAAAGCTCAGTTACTGATTTGCTGGGTCATGGTCAAAATTCTTA
CCTATTTATTTCATATCAACTTTAAAAAATAAATTACTTGCATTCTATATATTACTAATTGGGAAGTAATATGCCTCAAATCAGTTTTAT
ACTGGATTATTCCCTATGCTTTAAACCACTGCTCTCAATAAAACACTTCCTGATTAATGTTTGATTATTAGATATTTTAGTCTTGTTGGG
GATATTTTAGTCTTGTTGGGTTAGCCATGCTCTGAAGAATCTGTGAAAGTACAGTAAAGTTTTAATAAGCAATAAATGTAACCTTTTATA
TAAATCTCAGTGCTAGGTTAACTTCTAATAAGCAGACGAACATGTTACATAAATTATAATGTCTGTCTTGTAAAAAAGTTGAGGGGACTA
AAAGTTTATGACTCTGATATGGAAGTTGTCATATTAAAAAACTACATTTTAAAACATCAAATATTTATACTATTTGCTTTTCAAATAAAA

>In-frame_PDGFRL_ENST00000398074_chr8_17447274_+_VPS37A_ENST00000324849_chr8_17132242_+_4230nt
CCTGCGTCCCCGCCCCGCGCAGCCGCCGCGCTCCTGCGCTCCGAGGTCCGAGGTTCCCGAGATGAAGGTCTGGCTGCTGCTTGGTCTTCT
GCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCAAAAGAACCAGGAGAGAATAGAATCAAACC
TACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCAGCACCAAAGACGCAGTCTATCATGATGCA
AGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAAACTGTAGAGCTTCGATGTAAAGGGAGTAG
AATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGTCTATACAGTAACCCAAGTGGGATGTCTCCTTATGC
TTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAAGCAAACAGGAGTATCACTTCTTTATCTGTTGCTGACACTGTTTCTTC
TTCAACAACAAGTCATACCACAGCCAAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAATCTGCCATTACCCATTCCCACAGTGGATGC
TTCAATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTTCCAGAACTCTCAGAACTAAGTGTGTCACA
ACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTTTGCCTCAACTAAAACAAATTATTACCGACAAAGATGA
CTTAGTAAAAAGTATTGAGGAACTAGCAAGAAAAAATCTCCTTTTGGAGCCCAGCTTGGAAGCCAAAAGACAAACTGTTTTAGATAAGTA
TGAATTACTTACACAGATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTTAGTGAGAGCTGTAGTGCAAGTGCCCTTCA
GGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGACTTCTTGGAGGGAAAGATGGAAATAGATGA
TTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGTAGAAGAGCCAAGGAAGAGAAACTTCAGCAGGCGATAGCAATGCACAG
CCAATTTCATGCTCCACTATAGATTTTCCTGGAAACATGAACTGCCAAGAGAGGAATGGGACACAAAACCAAACACTGTTTTATATTTAT
GGTTTGCAAACTGGCATTTCATCAGTGGCTAAATTCACAGATATCCTATATAGATTGTATACAGAACTGAGACTGATTTTGTACCGATTA
GAATGATTGCTATGATCTTTGAGAAATTTTTCTGCACTATTTGCACTGAAATGTTTATTTATTGTTGATAAATTGTATCATATTTAAGTT
CCACTGCTGTTCCTCTTACCTTGATTAAATGCCTATGCATGTACTTTTAGCTAGTTTTTAATATTTTATAAAACTTCATTTAAATTTGTA
TTTTTAACTTGAAGTTCCATTTCTTTATCAAGGATGGTATTTAGATTTTTTTCCTCTTAACCTTTTTTCAAAAACTATTTTCAACTGTGA
GGAAACCCTTATTTTTCTTTCTTTGTGGATAAAACTTTCAAAAGCAATTTAAGATATTCATAGTGTTAGGAAACACCAAACCTGCCTATG
TGCCATCTCACAAAAGAAACTTTTAATACCTACAATAAATCAAAAGAATAAACCAGCTGTTCTTATATATTGTTTCATTTTTAAAACTAA
AGATGCATTTAAGAAGCAATACAAGTAAATATTTTACCTAATAGGAAAAAAAAAAGTTGCCTTTCATTTAAACCATTCCAACAGAAATTC
TTATGCTAATTTAAAACATATATATATCTGGTAGGTTTGTGGTTGGATAGGTTTTCTAAATTCCTAATGTTAAAAACAATCTTTATGTTA
ATATACACTAAATCTATACACAAAAAAAGTCAGTGAACTTTTCTGACCTTTACTGTGAGTTACCTTTTCCTAAGAGGAAAGCTATAGTAA
TAAGTAAAATTTAATTTTTAGGCAATCCTGATTTTTAATGAATTTAATTGAGTGTTCTTGTATACTACATTGAGCAGTTTGCTTCTATAC
CGTGTCACAAAATTCATGTATTTCTTGAGAAGCCCTAAAAGCTCATAAAGGAAAATGCCGTGAACTATGTAGCTCAGGCTTGGTAAGGTG
CCATCTAAATTACAAAACAAACTAATGCATAATTTTGCTTAAATTTCATCCCAGTATGATTGTCTTCCCAACACCAGCATATAGTATAGA
TTGTCTGTCTTTTTTATATTTTTTAGTTCTTCCTGTACATGTTTTTGGCAATAAAGTTATAGGAAGAACAAAATTATTTTGTTAGAATTA
AAACATGCTTAATATTTAGTCTGTTTGTGGAGGGCAGGTATTCACGTGGACTGAGATACAATGTTGGATACAGAAAATAACTTTCATTGT
CTTCCTGACACTGTGCTAAGGACATGCTGTTAAAGCTTCAAAGTGACCAGATGAGGAAGGAATAATTAATTATTACTCCTGATTTGTAGA
TAACTGAGGTAAGAGTGTTTCAAATTTATGATAGTCTTTTGGGTATTCAGAAACCTTTCCTTATACTGCACTGGCCACCAGAGCTTAATT
TTCCCAGCAGTTACAGCAATGGGAGATAGAACAGTCTCAATCTTTTGCCAACCATCAGGTTCCTAGAAACCAGGTAGGTGTATCCCATAA
CAAGGGAGGAGCATACCACAGCCCCTCATTTGATTAATTCATTTGATCTATCTATGTTATTAAGTACCTACTAGGAATAAGGCATTGTGG
AAATACTATACAAAGATAAACATTGTTTAGATGCTTATCTACTTTCCTTTTCACCAGAAAAACAGAAAAAAAAGAAACATTTTCTTACAG
AGTAAAAATGTTCTACATAATCACATGAGTAGTTCATCTCAGTGTTTTTTATTCTTTAAAGTTGAACTATCCCAGTTTCATTCTATACCA
TTCATTGGATAACCTTGTTACAACCCAGTCATGAAACAGAGCAGTGTGATCAGTTATCTGCATTTAACAAATAGACAAATCAGTTTACAT
AAAGGTTATGTATGTCACCCACGATGAAAAGAATCTGCATTTGAATATGCCCGTATGAATGTGGGTTCTGTTTTTGCAACAGAGATTAAG
TGACCATTTTTTCTAATTTTATGGCTATATATTTTCTTCATAAAAATTGGTCACATCGGAGAAGCAGTGCCACAGGAAAAATGAAATGCA
TGTGAAAGTTTGTATTCTGATTTTACAAGATGAGATAGAAATCAGAATTAAAGAGGAATACTTAGGAGTTACTAGGCTAATCAGTGTACG
AATTTGTCATAGGTAGAGATTTAAAGGTTAATATCTTAAAATAGAAGAAAATTCTAAATCAATCAATCAGTGAGATATAAACTAAACAGA
CCCACTTCAAAGTTGAAAGAAATTTCTAGGCATAAATTGAGACTAGGAAATTTATATCAGAATAGAGGGTGCTTGACACATATATATGCT
TAAATTGAAGGACAGCTCAGATTCATTTTTAGGAGAAGAAAGTAAACTAATGTGCTCTTAAAGAATAAAAATTTATTCTATGGTTTCTGT
CTCTGATCATCACCTTCCATTCTATAAAAAGCTCAGTTACTGATTTGCTGGGTCATGGTCAAAATTCTTACCTATTTATTTCATATCAAC
TTTAAAAAATAAATTACTTGCATTCTATATATTACTAATTGGGAAGTAATATGCCTCAAATCAGTTTTATACTGGATTATTCCCTATGCT
TTAAACCACTGCTCTCAATAAAACACTTCCTGATTAATGTTTGATTATTAGATATTTTAGTCTTGTTGGGGATATTTTAGTCTTGTTGGG
TTAGCCATGCTCTGAAGAATCTGTGAAAGTACAGTAAAGTTTTAATAAGCAATAAATGTAACCTTTTATATAAATCTCAGTGCTAGGTTA
ACTTCTAATAAGCAGACGAACATGTTACATAAATTATAATGTCTGTCTTGTAAAAAAGTTGAGGGGACTAAAAGTTTATGACTCTGATAT
GGAAGTTGTCATATTAAAAAACTACATTTTAAAACATCAAATATTTATACTATTTGCTTTTCAAATAAAAGCATAGTGCTGTTTGGCATA


Top

FusionGenePPI for PDGFRL_VPS37A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDGFRLVPS37ATSG101, VPS28, MVB12A, MVB12B, ALG2, UBAP1, APP, KDM1A, TRIM42, ARRDC1, XPO1, UBC


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDGFRL_VPS37A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PDGFRL_VPS37A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDGFRLC1527249Colorectal Cancer1UNIPROT
TgeneVPS37AC3539494SPASTIC PARAPLEGIA 53, AUTOSOMAL RECESSIVE1ORPHANET;UNIPROT