FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2646

FusionGeneSummary for ARID2_PTPRB

check button Fusion gene summary
Fusion gene informationFusion gene name: ARID2_PTPRB
Fusion gene ID: 2646
HgeneTgene
Gene symbol

ARID2

PTPRB

Gene ID

196528

5787

Gene nameAT-rich interaction domain 2protein tyrosine phosphatase, receptor type B
SynonymsBAF200|CSS6|p200HPTP-BETA|HPTPB|PTPB|R-PTP-BETA|VEPTP
Cytomap

12q12

12q15

Type of geneprotein-codingprotein-coding
DescriptionAT-rich interactive domain-containing protein 2ARID domain-containing protein 2AT rich interactive domain 2 (ARID, RFX-like)BRG1-associated factor 200zinc finger protein with activation potentialzipzap/p200receptor-type tyrosine-protein phosphatase betaVE-PTPprotein tyrosine phosphatase, receptor type, beta polypeptidevascular endothelial protein tyrosine phosphatase
Modification date2018051920180519
UniProtAcc

Q68CP9

P23467

Ensembl transtripts involved in fusion geneENST00000334344, ENST00000422737, 
ENST00000479608, ENST00000444670, 
ENST00000457135, 
ENST00000451516, 
ENST00000334414, ENST00000550358, 
ENST00000538708, ENST00000550857, 
ENST00000261266, ENST00000551525, 
ENST00000538174, 
Fusion gene scores* DoF score8 X 5 X 7=2804 X 4 X 4=64
# samples 84
** MAII scorelog2(8/280*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARID2 [Title/Abstract] AND PTPRB [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARID2

GO:0006337

nucleosome disassembly

8895581

HgeneARID2

GO:0008285

negative regulation of cell proliferation

26169693

HgeneARID2

GO:0030336

negative regulation of cell migration

26169693

TgenePTPRB

GO:0016311

dephosphorylation

19116766|19136612


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A6BE-01AARID2chr12

46125097

+PTPRBchr12

70933802

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000334344ENST00000451516ARID2chr12

46125097

+PTPRBchr12

70933802

-
In-frameENST00000334344ENST00000334414ARID2chr12

46125097

+PTPRBchr12

70933802

-
In-frameENST00000334344ENST00000550358ARID2chr12

46125097

+PTPRBchr12

70933802

-
In-frameENST00000334344ENST00000538708ARID2chr12

46125097

+PTPRBchr12

70933802

-
In-frameENST00000334344ENST00000550857ARID2chr12

46125097

+PTPRBchr12

70933802

-
In-frameENST00000334344ENST00000261266ARID2chr12

46125097

+PTPRBchr12

70933802

-
5CDS-intronENST00000334344ENST00000551525ARID2chr12

46125097

+PTPRBchr12

70933802

-
5CDS-intronENST00000334344ENST00000538174ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000451516ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000334414ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000550358ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000538708ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000550857ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-3CDSENST00000422737ENST00000261266ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-intronENST00000422737ENST00000551525ARID2chr12

46125097

+PTPRBchr12

70933802

-
5UTR-intronENST00000422737ENST00000538174ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000451516ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000334414ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000550358ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000538708ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000550857ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000479608ENST00000261266ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000479608ENST00000551525ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000479608ENST00000538174ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000451516ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000334414ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000550358ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000538708ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000550857ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000444670ENST00000261266ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000444670ENST00000551525ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000444670ENST00000538174ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000451516ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000334414ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000550358ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000538708ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000550857ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-3CDSENST00000457135ENST00000261266ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000457135ENST00000551525ARID2chr12

46125097

+PTPRBchr12

70933802

-
intron-intronENST00000457135ENST00000538174ARID2chr12

46125097

+PTPRBchr12

70933802

-

Top

FusionProtFeatures for ARID2_PTPRB


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARID2

Q68CP9

PTPRB

P23467

Plays an important role in blood vessel remodeling andangiogenesis. Not necessary for the initial formation of bloodvessels, but is essential for their maintenance and remodeling.Can induce dephosphorylation of TEK/TIE2, CDH5/VE-cadherin andKDR/VEGFR-2. Regulates angiopoietin-TIE2 signaling in endothelialcells. Acts as a negative regulator of TIE2, and controls TIE2driven endothelial cell proliferation, which in turn affects bloodvessel remodeling during embryonic development and determinesblood vessel size during perinatal growth. Essential for themaintenance of endothelial cell contact integrity and for theadhesive function of VE-cadherin in endothelial cells and thisrequires the presence of plakoglobin (By similarity).{ECO:0000250, ECO:0000269|PubMed:19116766,ECO:0000269|PubMed:19136612}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321703_196316461998DomainTyrosine-protein phosphatase
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311703_196315561908DomainTyrosine-protein phosphatase
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321904_191016461998RegionSubstrate binding
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341904_191018642216RegionSubstrate binding
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311904_191015561908RegionSubstrate binding
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321643_199716461998Topological domainCytoplasmic
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311643_199715561908Topological domainCytoplasmic
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311622_164215561908TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID2chr12:46125097chr12:70933802ENST00000334344+321793_1128941836Compositional biasNote=Gln-rich
HgeneARID2chr12:46125097chr12:70933802ENST00000334344+321524_603941836DNA bindingRFX-type winged-helix
HgeneARID2chr12:46125097chr12:70933802ENST00000334344+32113_105941836DomainARID
HgeneARID2chr12:46125097chr12:70933802ENST00000334344+321313_317941836MotifNote=LXXLL
HgeneARID2chr12:46125097chr12:70933802ENST00000334344+3211632_1657941836Zinc fingerNote=C2H2-type
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321087_117516461998DomainFibronectin type-III 13
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032112_20716461998DomainFibronectin type-III 2
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321173_126016461998DomainFibronectin type-III 14
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321260_135616461998DomainFibronectin type-III 15
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321357_144816461998DomainFibronectin type-III 16
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321458_155416461998DomainFibronectin type-III 17
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032203_28816461998DomainFibronectin type-III 3
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-203223_11116461998DomainFibronectin type-III 1
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032291_37816461998DomainFibronectin type-III 4
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032379_47116461998DomainFibronectin type-III 5
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032467_55216461998DomainFibronectin type-III 6
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032556_64116461998DomainFibronectin type-III 7
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032642_72916461998DomainFibronectin type-III 8
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032730_82916461998DomainFibronectin type-III 9
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032819_90616461998DomainFibronectin type-III 10
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032909_100116461998DomainFibronectin type-III 11
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-2032995_108316461998DomainFibronectin type-III 12
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341087_117518642216DomainFibronectin type-III 13
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234112_20718642216DomainFibronectin type-III 2
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341173_126018642216DomainFibronectin type-III 14
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341260_135618642216DomainFibronectin type-III 15
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341357_144818642216DomainFibronectin type-III 16
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341458_155418642216DomainFibronectin type-III 17
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341703_196318642216DomainTyrosine-protein phosphatase
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234203_28818642216DomainFibronectin type-III 3
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-223423_11118642216DomainFibronectin type-III 1
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234291_37818642216DomainFibronectin type-III 4
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234379_47118642216DomainFibronectin type-III 5
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234467_55218642216DomainFibronectin type-III 6
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234556_64118642216DomainFibronectin type-III 7
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234642_72918642216DomainFibronectin type-III 8
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234730_82918642216DomainFibronectin type-III 9
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234819_90618642216DomainFibronectin type-III 10
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234909_100118642216DomainFibronectin type-III 11
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-2234995_108318642216DomainFibronectin type-III 12
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311087_117515561908DomainFibronectin type-III 13
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931112_20715561908DomainFibronectin type-III 2
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311173_126015561908DomainFibronectin type-III 14
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311260_135615561908DomainFibronectin type-III 15
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311357_144815561908DomainFibronectin type-III 16
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-19311458_155415561908DomainFibronectin type-III 17
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931203_28815561908DomainFibronectin type-III 3
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-193123_11115561908DomainFibronectin type-III 1
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931291_37815561908DomainFibronectin type-III 4
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931379_47115561908DomainFibronectin type-III 5
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931467_55215561908DomainFibronectin type-III 6
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931556_64115561908DomainFibronectin type-III 7
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931642_72915561908DomainFibronectin type-III 8
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931730_82915561908DomainFibronectin type-III 9
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931819_90615561908DomainFibronectin type-III 10
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931909_100115561908DomainFibronectin type-III 11
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-1931995_108315561908DomainFibronectin type-III 12
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-203223_162116461998Topological domainExtracellular
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341643_199718642216Topological domainCytoplasmic
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-223423_162118642216Topological domainExtracellular
TgenePTPRBchr12:46125097chr12:70933802ENST00000550857-193123_162115561908Topological domainExtracellular
TgenePTPRBchr12:46125097chr12:70933802ENST00000261266-20321622_164216461998TransmembraneHelical
TgenePTPRBchr12:46125097chr12:70933802ENST00000334414-22341622_164218642216TransmembraneHelical


Top

FusionGeneSequence for ARID2_PTPRB


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000451516_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000334414_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550358_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000538708_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550857_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000261266_chr12_70933802_-_446aa
MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWGEIVEEFNFPRSCSNAAFALK
QYYLRHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNR
YNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDS
LYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000451516_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000334414_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550358_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000538708_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550857_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000261266_chr12_70933802_-_1338nt
ATGGCAAACTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGA
GGGTCGCCTTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTC
GCGAAGGTTTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAA
CAGTATTACTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGC
CAGAAAGGTAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTT
CTATCCAAGGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGA
TACAACAATATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTAC
ATCCCTGGCAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAA
CAAAACGTTCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCC
CTCTACTATGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAA
CAGCTTGATGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAG
TTTGTGAGAACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGA
ACCTTTATTGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCAC
AGGGTTCACATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000451516_chr12_70933802_-_6149nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC
TGGATAAAAATTATTCACTGTGTGATTTGTTTTTAAAAACTTGCTTCATGCCCTACAGAGGTGCCAGCTATTTCTGTTGATACTATGTAT
AATTTATTAATCTGGAGAATGTTTAAAATTTTATATAATTTAAAGGTAACAGATATTATTGTACATAGTTGTATTTTGTAGTTTCTTCTG
TAAATATGTATTTTTCATAATGTTTAATATTAAGCTTTATATAATACTATTTTTCCACACTAAAGTGTTCATGACTTGTTCTACATAAAA
CTAATTCAACCTGTATGACAGGACTACTGGTAAAATGCATATGGAGGTGGTGGCAGAGACAATCCTTCAGGCCATGTTTTCTACCTGTTT
TGATATTCACTGGACAGGAAAAAGGGCAGGGCTAGAGAGAGCAAATACTATGGCTAGATTTGCTGCATTGCTGTCCCATGAATCTCGAGA
GCCAACAGACATGTCCTAACTTGCTATTAGGACAAATGTGACAGTCAAAAAAAGGATTAGAGGGAGGGAGAAAAAAGAATTAAGCAGTAC
CAAAGCTGAACTAGATGCTTGTGTCTGAACTAGTTGCTCTCTCTCTCCTTTCTCCTTCCAGGGATTCAAGCCAAAGTGGTCAGCTCAGGG
ATCATGTAACTTGCAGTGCAAGCCCAGGATGGTAGGATGCAGGGTTGAGGGTTCTGATAGAGAATGATTCCAAACAGAAGTGATGAATTC
CTTTTGTTAATAAGATGCCAGCTATACCCAGACTGGAAACATAACATGCAAAGCACTATCTACAGTGATTAGAGATCCTTTCATTGCATT
CATGGTGTGGAGTGTGAACATCCACACCCATACTGTAATGTATTTATACACACTAGTTTCTGTCTCATTTTCAGTGGTCTCCATTCCTAG
AAAAGTCACAATTATCCATTCCTACTTGATTTCCCATTAAAAGAATATTATGGTAGCAGATTGTGCCCCTCATTAAAAGGCTTAATGCCA
ACATTTTCATAGAAATGACTACAAACATCATATATAGTAAATTTAAAAACAATAGCAAAAACAAAAACAGTGGTCTTCAGTAAAATTTTC
AAAACTTCTTTTAGTAAATCAATGAAGTCAAAATGTCAAGTAATCACCCAAAGTTGCATTTAATAACAAAAGGCACTACATACTGTACCA
AGTTTATCTTCAATATTTGTGCCTTACTTACTTTGACTATAACAAATTCCAATGAGTCAGAAAGTATTTCCTTCATCAAGGTCCAGTTCC
GACAGCATTCCTGGGAAAAATTTGAAAGGAGTTTGTACGGAATCTTCATAGATACCTGAGAAGATGAGCTGGAGATGTTTGCCTTTTTCA
CACTACAAATTTTTCTGTAATAAACTTGGGAATTAGAGGTCAAGTTTGTTGATGGCATAGCTTCCTTTGCATAAAGAGTATATTTCTTTT
CAAAGTATATATTTTTGTAACCTACCATAAAGTCCGTAAGTGAATACAACGAATGTAATTGACATAATAATTGAAAATCATTGACTATAC
CTAAAATAGTTCTTTATAATTAAATAACTCTACACCCAATCTGGAAATTTTTCCAAGGTTATTTGAAGTTTACAAAAATGTGAAGCATAA
TCATAAGCTTCAAAGATTCACAGTTTCATTGTGCTCAATGCTCTTGTGAAATGACAGTCTTAAGCTCTGATTCTGTATCAAGGAACTAAG
TGAATCTTCTGGAAATGAAAAGGAACAACATATGTGTAAGTGCAGTAGATGTACCACCAGCGAGAAAATAGAGGTCAGAGATCTACAACG
TGTGGCATCCATTAGAAATCACCTTTCCTACATTGAAAAGAAAAAAGAGAAAAAGCAGAATTTTACACTAATGTTGCTTGATGCAAAGCA
CATTAATGCTTGGAAGGATACATTCATTTTCGACTTTTCATTCACTCAGAAAACTTCTAGTAAGTATCTGCAACCTGCTAGGCACTGTTC
CAGAATCTACACATTTCTACTCACATAAAGAGAATCCTCATAAAGTTAGGATTGTTGTTACTACCTTCAATTGAGCTTAAAAGACAGCCT
CATCAAGGGAATGGGATAACTGAGCCAGTCTAGGACAGTGGTCACCTTCCACAGGCCACACACTGGAAAGTGCTAATGCTACTTTAATAG
CAAACCTCTGGATCTAGGAGAGAGAGCAATTAATTGCACAAACCAGGAGTTAAAACCATAAAAAAAACCTATGCATCTGTAATAGTAAAT
AACACTCACGTACTCTGGCAACATCTAGGGTAGTATCAGAATTATGTAAATGGACATGACAGGGAAAAATCGTAGGTTTTTTTAGTCTAA
TCCAACCCAGGAAATGTTTATTCCTACCCTACACCTAATTTTAAACCTTCTTAGCAACAAATATTTCACTATTCGCTCCTACTCCTGGGA
AGACTAAATATATAATTGACTTATTTATTAAATTTAGGAGAAAAAAAAAGTTTTCCTTGACATTCAGCTCTATTGGATTTATTTCCATTT
AATTGCATCATGTGTTATGTCTTGGTAAACACTCCATTTCCTGTCTTGGTGGGCATCCTGTCTGTGTACCTGTGCAGTACACTTTAATCA
TCAAGACTTCAAAGTGCTTTTGAGCTATCAAATCTTGGGAGAGTCCCATCTAGCATCTTAATAATTATTTTTCCAAGTTCGTTATAATTA
ACTCCTTTAACCTCATCTCATTAAATCAATTTTGTATTGTCATTCTGTTGTTCTCTGGAAAGCAGCCAATTGTTCAGCTCTTGAATCAGA
ATTTTCAAAGACTCACCTCTCTTACCTGGGCTTGCACATATTTGTCCTAAGTAATTCTCTATCCCTTAAACCTCTGAGTCCCTCTGTTTT
ATTACTTGCCCCACTCCTCCTACTTGAATATGTTTGTTTTCCCAGTTGAATGTGATTTTTATCTACTGTTCATATTATCTTTTATACCCA
TGAGTATAATTTCATAGTCCTTTCAGGTTCCACATCATCAAAGAGATGACCATAATTTCACTTTTTTTTGAAATGAAGTCTTGCTCTGTT
GCCCAGGCTGGAGTGCAGTGGCACAATCTCAGCTCACTACAACCTCCGCCTCCCAGGTTCAAGCGATTCTGCCTTAGCCTCCCAAGTAGC
TGGAATTACAGGTGCCTGCCACCATGTCTGGCTAATTTTTGTGTTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAGGCTGGTCTTGA
ACTCGTGACCTTAGGTGATCCACCCACCTCAACCTCCCAAAGTGCTAGGATTACAAGAGTGAGCCACCGCACCTGGCCAATTCACTTTTA
AATACTAAAAGGCACACAGCACACAGACATTTTCGGGGCAGTTTTCTTTGGGAGGGTCTTTGATAAATTTTGTAATCACCTCTCGGAAGA
AAGCCCAAAATGACATGTGAAAATAATATTAAACCATTTACCAGATGTCCAGCAATATAAAAATAGACCTCACATGCTACCCTTCACATG
CTGATTCTCTTGCCTTGCTGTTTAAGGATCCAGTTTCTTATGTTAAACATTTTCCTTACCTTTTGCAATAATATTATTGGCCATATACTA
AATTCTCATTCACTTAGCTTTCTAAGAATTCTTTGAGGTTGGAATCCTGAAATCATAAAGCTACCAGATCTGCACAACAGCAGTGGTAGT
ATCTGAGCCCAAACTCTGAGACGCTCTAGAGTTTTAGTTTACAAACATGAGCCAGACCAAACCTGACCTGGTGAAAATCAATAGGTAATA
AACTGCTTGTATATGATAGCAGTTCAAGGGCTTTCTGGGTTCCATTTCACTGAGGAAATGAAAATATAACTGATTAGCCAAGACAGAGTG
GCAATAAGGAATAACTGATCCTCCTCCAAGTTGCAGTGAGCAAGCCCTCAAGCCTACCTCATTCCTGAAGAGTTGAAGGAGAAAATGCCG
TGCTAATTTTCTGCCCTGCTATTTTTAACCTGAAATTTAGAATTACATCAGGTATTCAAAGAATGTTCCCTATCAAAGGAAAATCTGTAA
ACGATGACTGCAAAAAGCAAGTGAAATGATGCAAAGAGAAAATATTTGCAAAACAGAATCTAACCAGACATCATCATGAAGATAAAATGG
CATCTCTTCTGTGTGGCCTGGGTGTGCTTGGACAATCCTGTCACACGTTTCTATTAGGACATGTTGCCCTTTTGAGGATTCACTCTATGT
TGGCCAGATGGTTTAACTGATTAAACAATTGAATCAATTTATTTTGCTTTTTGAATTGACCAGATATTTAACTAAATGTACTGGGTTTGG
CATTTTAGACACACTGCCTTAGATTCTTGTAGTGCATGATGACTTTGAAAATGTTTGGCCATTTTAGTTAAAATGCAGGGTAACATTTGA
TGCAGCCATGATAACAGGAAAAATCTGTTCTGTTCTAAAAATGTTTCTAGCAATAGAAGTATTTCTGGCTAAGAGAATACTCTTGACTTG
TAGGGAGGCTCCCTCGGAATAAATGTATGCAACACAAATAAGGCATTTTATTTTTTAAAAGATTGTCTATATAAGATACACTTATTAAAT

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000334414_chr12_70933802_-_6149nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC
TGGATAAAAATTATTCACTGTGTGATTTGTTTTTAAAAACTTGCTTCATGCCCTACAGAGGTGCCAGCTATTTCTGTTGATACTATGTAT
AATTTATTAATCTGGAGAATGTTTAAAATTTTATATAATTTAAAGGTAACAGATATTATTGTACATAGTTGTATTTTGTAGTTTCTTCTG
TAAATATGTATTTTTCATAATGTTTAATATTAAGCTTTATATAATACTATTTTTCCACACTAAAGTGTTCATGACTTGTTCTACATAAAA
CTAATTCAACCTGTATGACAGGACTACTGGTAAAATGCATATGGAGGTGGTGGCAGAGACAATCCTTCAGGCCATGTTTTCTACCTGTTT
TGATATTCACTGGACAGGAAAAAGGGCAGGGCTAGAGAGAGCAAATACTATGGCTAGATTTGCTGCATTGCTGTCCCATGAATCTCGAGA
GCCAACAGACATGTCCTAACTTGCTATTAGGACAAATGTGACAGTCAAAAAAAGGATTAGAGGGAGGGAGAAAAAAGAATTAAGCAGTAC
CAAAGCTGAACTAGATGCTTGTGTCTGAACTAGTTGCTCTCTCTCTCCTTTCTCCTTCCAGGGATTCAAGCCAAAGTGGTCAGCTCAGGG
ATCATGTAACTTGCAGTGCAAGCCCAGGATGGTAGGATGCAGGGTTGAGGGTTCTGATAGAGAATGATTCCAAACAGAAGTGATGAATTC
CTTTTGTTAATAAGATGCCAGCTATACCCAGACTGGAAACATAACATGCAAAGCACTATCTACAGTGATTAGAGATCCTTTCATTGCATT
CATGGTGTGGAGTGTGAACATCCACACCCATACTGTAATGTATTTATACACACTAGTTTCTGTCTCATTTTCAGTGGTCTCCATTCCTAG
AAAAGTCACAATTATCCATTCCTACTTGATTTCCCATTAAAAGAATATTATGGTAGCAGATTGTGCCCCTCATTAAAAGGCTTAATGCCA
ACATTTTCATAGAAATGACTACAAACATCATATATAGTAAATTTAAAAACAATAGCAAAAACAAAAACAGTGGTCTTCAGTAAAATTTTC
AAAACTTCTTTTAGTAAATCAATGAAGTCAAAATGTCAAGTAATCACCCAAAGTTGCATTTAATAACAAAAGGCACTACATACTGTACCA
AGTTTATCTTCAATATTTGTGCCTTACTTACTTTGACTATAACAAATTCCAATGAGTCAGAAAGTATTTCCTTCATCAAGGTCCAGTTCC
GACAGCATTCCTGGGAAAAATTTGAAAGGAGTTTGTACGGAATCTTCATAGATACCTGAGAAGATGAGCTGGAGATGTTTGCCTTTTTCA
CACTACAAATTTTTCTGTAATAAACTTGGGAATTAGAGGTCAAGTTTGTTGATGGCATAGCTTCCTTTGCATAAAGAGTATATTTCTTTT
CAAAGTATATATTTTTGTAACCTACCATAAAGTCCGTAAGTGAATACAACGAATGTAATTGACATAATAATTGAAAATCATTGACTATAC
CTAAAATAGTTCTTTATAATTAAATAACTCTACACCCAATCTGGAAATTTTTCCAAGGTTATTTGAAGTTTACAAAAATGTGAAGCATAA
TCATAAGCTTCAAAGATTCACAGTTTCATTGTGCTCAATGCTCTTGTGAAATGACAGTCTTAAGCTCTGATTCTGTATCAAGGAACTAAG
TGAATCTTCTGGAAATGAAAAGGAACAACATATGTGTAAGTGCAGTAGATGTACCACCAGCGAGAAAATAGAGGTCAGAGATCTACAACG
TGTGGCATCCATTAGAAATCACCTTTCCTACATTGAAAAGAAAAAAGAGAAAAAGCAGAATTTTACACTAATGTTGCTTGATGCAAAGCA
CATTAATGCTTGGAAGGATACATTCATTTTCGACTTTTCATTCACTCAGAAAACTTCTAGTAAGTATCTGCAACCTGCTAGGCACTGTTC
CAGAATCTACACATTTCTACTCACATAAAGAGAATCCTCATAAAGTTAGGATTGTTGTTACTACCTTCAATTGAGCTTAAAAGACAGCCT
CATCAAGGGAATGGGATAACTGAGCCAGTCTAGGACAGTGGTCACCTTCCACAGGCCACACACTGGAAAGTGCTAATGCTACTTTAATAG
CAAACCTCTGGATCTAGGAGAGAGAGCAATTAATTGCACAAACCAGGAGTTAAAACCATAAAAAAAACCTATGCATCTGTAATAGTAAAT
AACACTCACGTACTCTGGCAACATCTAGGGTAGTATCAGAATTATGTAAATGGACATGACAGGGAAAAATCGTAGGTTTTTTTAGTCTAA
TCCAACCCAGGAAATGTTTATTCCTACCCTACACCTAATTTTAAACCTTCTTAGCAACAAATATTTCACTATTCGCTCCTACTCCTGGGA
AGACTAAATATATAATTGACTTATTTATTAAATTTAGGAGAAAAAAAAAGTTTTCCTTGACATTCAGCTCTATTGGATTTATTTCCATTT
AATTGCATCATGTGTTATGTCTTGGTAAACACTCCATTTCCTGTCTTGGTGGGCATCCTGTCTGTGTACCTGTGCAGTACACTTTAATCA
TCAAGACTTCAAAGTGCTTTTGAGCTATCAAATCTTGGGAGAGTCCCATCTAGCATCTTAATAATTATTTTTCCAAGTTCGTTATAATTA
ACTCCTTTAACCTCATCTCATTAAATCAATTTTGTATTGTCATTCTGTTGTTCTCTGGAAAGCAGCCAATTGTTCAGCTCTTGAATCAGA
ATTTTCAAAGACTCACCTCTCTTACCTGGGCTTGCACATATTTGTCCTAAGTAATTCTCTATCCCTTAAACCTCTGAGTCCCTCTGTTTT
ATTACTTGCCCCACTCCTCCTACTTGAATATGTTTGTTTTCCCAGTTGAATGTGATTTTTATCTACTGTTCATATTATCTTTTATACCCA
TGAGTATAATTTCATAGTCCTTTCAGGTTCCACATCATCAAAGAGATGACCATAATTTCACTTTTTTTTGAAATGAAGTCTTGCTCTGTT
GCCCAGGCTGGAGTGCAGTGGCACAATCTCAGCTCACTACAACCTCCGCCTCCCAGGTTCAAGCGATTCTGCCTTAGCCTCCCAAGTAGC
TGGAATTACAGGTGCCTGCCACCATGTCTGGCTAATTTTTGTGTTTTTAGTAGAGATGGGGTTTCACCATGTTGGCCAGGCTGGTCTTGA
ACTCGTGACCTTAGGTGATCCACCCACCTCAACCTCCCAAAGTGCTAGGATTACAAGAGTGAGCCACCGCACCTGGCCAATTCACTTTTA
AATACTAAAAGGCACACAGCACACAGACATTTTCGGGGCAGTTTTCTTTGGGAGGGTCTTTGATAAATTTTGTAATCACCTCTCGGAAGA
AAGCCCAAAATGACATGTGAAAATAATATTAAACCATTTACCAGATGTCCAGCAATATAAAAATAGACCTCACATGCTACCCTTCACATG
CTGATTCTCTTGCCTTGCTGTTTAAGGATCCAGTTTCTTATGTTAAACATTTTCCTTACCTTTTGCAATAATATTATTGGCCATATACTA
AATTCTCATTCACTTAGCTTTCTAAGAATTCTTTGAGGTTGGAATCCTGAAATCATAAAGCTACCAGATCTGCACAACAGCAGTGGTAGT
ATCTGAGCCCAAACTCTGAGACGCTCTAGAGTTTTAGTTTACAAACATGAGCCAGACCAAACCTGACCTGGTGAAAATCAATAGGTAATA
AACTGCTTGTATATGATAGCAGTTCAAGGGCTTTCTGGGTTCCATTTCACTGAGGAAATGAAAATATAACTGATTAGCCAAGACAGAGTG
GCAATAAGGAATAACTGATCCTCCTCCAAGTTGCAGTGAGCAAGCCCTCAAGCCTACCTCATTCCTGAAGAGTTGAAGGAGAAAATGCCG
TGCTAATTTTCTGCCCTGCTATTTTTAACCTGAAATTTAGAATTACATCAGGTATTCAAAGAATGTTCCCTATCAAAGGAAAATCTGTAA
ACGATGACTGCAAAAAGCAAGTGAAATGATGCAAAGAGAAAATATTTGCAAAACAGAATCTAACCAGACATCATCATGAAGATAAAATGG
CATCTCTTCTGTGTGGCCTGGGTGTGCTTGGACAATCCTGTCACACGTTTCTATTAGGACATGTTGCCCTTTTGAGGATTCACTCTATGT
TGGCCAGATGGTTTAACTGATTAAACAATTGAATCAATTTATTTTGCTTTTTGAATTGACCAGATATTTAACTAAATGTACTGGGTTTGG
CATTTTAGACACACTGCCTTAGATTCTTGTAGTGCATGATGACTTTGAAAATGTTTGGCCATTTTAGTTAAAATGCAGGGTAACATTTGA
TGCAGCCATGATAACAGGAAAAATCTGTTCTGTTCTAAAAATGTTTCTAGCAATAGAAGTATTTCTGGCTAAGAGAATACTCTTGACTTG
TAGGGAGGCTCCCTCGGAATAAATGTATGCAACACAAATAAGGCATTTTATTTTTTAAAAGATTGTCTATATAAGATACACTTATTAAAT

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550358_chr12_70933802_-_1683nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC
TGGATAAAAATTATTCACTGTGTGATTTGTTTTTAAAAACTTGCTTCATGCCCTACAGAGGTGCCAGCTATTTCTGTTGATACTATGTAT

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000538708_chr12_70933802_-_1596nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000550857_chr12_70933802_-_1596nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC

>In-frame_ARID2_ENST00000334344_chr12_46125097_+_PTPRB_ENST00000261266_chr12_70933802_-_1596nt
GCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCGCCACCGCCGGCCCATGACTGAGCCCCGCCGCCGCCGGCCGAGGAATGGGCTCCG
GGCTCTGGTAGGAAGCGCTGGGAGCGGGGGGCGCTTTTAAAACACCGATCTGGGTTTTTTAAAAACCTCCTTTGAAAAAATAATGGCAAA
CTCGACGGGGAAGGCGCCTCCGGACGAGCGGAGAAAGGGACTCGCTTTCCTGGACGAGCTGCGGCAGTTCCACCACAGCAGAGGGTCGCC
TTTTAAAAAAATCCCTGCGGTGGGTGGGAAGGAGCTGGATCTTCACGGTCTCTACACCAGAGTCACTACTTTAGGCGGATTCGCGAAGGT
TTCTGAGAAGAATCAGTGGGGAGAAATTGTTGAAGAGTTCAACTTTCCCAGAAGTTGTTCTAACGCTGCCTTTGCTTTAAAACAGTATTA
CTTGCGCCATGGTCGAGAAAGACCCTCTGCCCGTCTGAGCATTCGTAGGGATCGACCATTATCTGTCCACTTAAACCTGGGCCAGAAAGG
TAACCGGAAAACTTCTTGTCCAATAAAAATAAATCAGTTTGAAGGGCATTTCATGAAGCTACAGGCTGACTCCAACTACCTTCTATCCAA
GGAATACGAGGAGTTAAAAGACGTGGGCCGAAACCAGTCATGTGACATTGCACTCTTGCCGGAGAATAGAGGGAAAAATCGATACAACAA
TATATTGCCCTATGATGCCACGCGAGTGAAGCTCTCCAATGTAGATGATGATCCTTGCTCTGACTACATCAATGCCAGCTACATCCCTGG
CAACAACTTCAGAAGAGAATACATTGTCACTCAGGGACCGCTTCCTGGCACCAAGGATGACTTCTGGAAAATGGTGTGGGAACAAAACGT
TCACAACATCGTCATGGTGACCCAGTGTGTTGAGAAGGGCCGAGTAAAGTGTGATCATTACTGGCCAGCGGACCAGGATTCCCTCTACTA
TGGGGACCTCATCCTGCAGATGCTCTCAGAGTCCGTCCTGCCTGAGTGGACCATCCGGGAGTTTAAGATATGCGGTGAGGAACAGCTTGA
TGCACACAGACTCATCCGCCACTTTCACTATACGGTGTGGCCAGACCATGGAGTCCCAGAAACCACCCAGTCTCTGATCCAGTTTGTGAG
AACTGTCAGGGACTACATCAACAGAAGCCCGGGTGCTGGGCCCACTGTGGTGCACTGCAGTGCTGGTGTGGGTAGGACTGGAACCTTTAT
TGCATTGGACCGAATCCTCCAGCAGTTAGACTCCAAAGACTCTGTGGACATTTATGGAGCAGTGCACGACCTAAGACTTCACAGGGTTCA
CATGGTCCAGACTGAGTGTCAGTATGTCTACCTACATCAGTGTGTAAGAGATGTCCTCAGAGCAAGAAAGCTACGGAGTGAACAAGAAAA
CCCCTTGTTTCCAATCTATGAAAATGTGAATCCAGAGTATCACAGAGATCCAGTCTATTCAAGGCATTGAGAATGTACCTGAAGAGCTCC


Top

FusionGenePPI for ARID2_PTPRB


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARID2HNRNPA1, KHDRBS2, NFYC, SMARCE1, BCL7C, BRD7, CHD7, PBRM1, SMARCC2, SMARCC1, SMARCD1, SMARCB1, SMARCA4, SMARCAD1, TFAP4, DPF3, NUP50, LHX4, SS18, HIST1H3E, CD14, EGR1, KPNA1, AP4M1, TSC22D2, RRM2, VHL, BCL7A, ZNF23, TRIM25PTPRBMAGI3, CDH5, NRCAM, CNTN1, GHR, EGFR, VEGFA, PTN, RABEP2, GOPC, PTPRG


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARID2_PTPRB


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARID2_PTPRB


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARID2C2239176Liver carcinoma2CTD_human
TgenePTPRBC0018923Hemangiosarcoma1CTD_human