FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26421

FusionGeneSummary for PDE5A_C4orf3

check button Fusion gene summary
Fusion gene informationFusion gene name: PDE5A_C4orf3
Fusion gene ID: 26421
HgeneTgene
Gene symbol

PDE5A

C4orf3

Gene ID

8654

401152

Gene namephosphodiesterase 5Achromosome 4 open reading frame 3
SynonymsCGB-PDE|CN5A|PDE5ALN|HCVFTP1
Cytomap

4q26

4q26

Type of geneprotein-codingprotein-coding
DescriptioncGMP-specific 3',5'-cyclic phosphodiesterasecGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterasecGMP-specific phosphodiesterase PDE5A2cGMP-specific phosphodiesterase type 5Aphosphodiesterase 5A, cGMP-specificphosphodiesterase isozyme uncharacterized protein C4orf3HCV F-transactivated protein 1another-regulinhepatitis C virus F protein-transactivated protein 1
Modification date2018051920180519
UniProtAcc

O76074

Q8WVX3

Ensembl transtripts involved in fusion geneENST00000354960, ENST00000394439, 
ENST00000264805, ENST00000512739, 
ENST00000399075, ENST00000504110, 
Fusion gene scores* DoF score3 X 3 X 2=181 X 1 X 1=1
# samples 31
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(1/1*10)=3.32192809488736
Context

PubMed: PDE5A [Title/Abstract] AND C4orf3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePDE5A

GO:0046069

cGMP catabolic process

14687666


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-CV-7406-01APDE5Achr4

120517678

-C4orf3chr4

120219934

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000354960ENST00000399075PDE5Achr4

120517678

-C4orf3chr4

120219934

-
Frame-shiftENST00000354960ENST00000504110PDE5Achr4

120517678

-C4orf3chr4

120219934

-
In-frameENST00000394439ENST00000399075PDE5Achr4

120517678

-C4orf3chr4

120219934

-
Frame-shiftENST00000394439ENST00000504110PDE5Achr4

120517678

-C4orf3chr4

120219934

-
In-frameENST00000264805ENST00000399075PDE5Achr4

120517678

-C4orf3chr4

120219934

-
Frame-shiftENST00000264805ENST00000504110PDE5Achr4

120517678

-C4orf3chr4

120219934

-
intron-3CDSENST00000512739ENST00000399075PDE5Achr4

120517678

-C4orf3chr4

120219934

-
intron-3CDSENST00000512739ENST00000504110PDE5Achr4

120517678

-C4orf3chr4

120219934

-

Top

FusionProtFeatures for PDE5A_C4orf3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PDE5A

O76074

C4orf3

Q8WVX3

Plays a role in signal transduction by regulating theintracellular concentration of cyclic nucleotides. Thisphosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP (PubMed:9714779, PubMed:15489334). Specifically regulatesnitric-oxide-generated cGMP (PubMed:15489334).{ECO:0000269|PubMed:15489334, ECO:0000269|PubMed:9714779}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDE5Achr4:120517678chr4:120219934ENST00000264805-32110_24235834Compositional biasNote=Poly-Gln
HgenePDE5Achr4:120517678chr4:120219934ENST00000354960-32110_24277876Compositional biasNote=Poly-Gln

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePDE5Achr4:120517678chr4:120219934ENST00000264805-321164_314235834DomainNote=GAF 1
HgenePDE5Achr4:120517678chr4:120219934ENST00000264805-321346_503235834DomainNote=GAF 2
HgenePDE5Achr4:120517678chr4:120219934ENST00000264805-321536_860235834DomainPDEase
HgenePDE5Achr4:120517678chr4:120219934ENST00000354960-321164_314277876DomainNote=GAF 1
HgenePDE5Achr4:120517678chr4:120219934ENST00000354960-321346_503277876DomainNote=GAF 2
HgenePDE5Achr4:120517678chr4:120219934ENST00000354960-321536_860277876DomainPDEase
TgeneC4orf3chr4:120517678chr4:120219934ENST00000399075-1345_65199200TransmembraneHelical
TgeneC4orf3chr4:120517678chr4:120219934ENST00000504110-0245_656667TransmembraneHelical


Top

FusionGeneSequence for PDE5A_C4orf3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PDE5A_ENST00000354960_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_277aa
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRAD
NSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMP

>In-frame_PDE5A_ENST00000394439_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_225aa
MVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTPPRFD
HDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGH

>In-frame_PDE5A_ENST00000264805_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_235aa
MLPFGDKTREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKE
QMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PDE5A_ENST00000354960_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_832nt
ATGGAGCGGGCCGGCCCCAGCTTCGGGCAGCAGCGACAGCAGCAGCAGCCCCAGCAGCAGAAGCAGCAGCAGAGGGATCAGGACTCGGTC
GAAGCATGGCTGGACGATCACTGGGACTTTACCTTCTCATACTTTGTTAGAAAAGCCACCAGAGAAATGGTCAATGCATGGTTTGCTGAG
AGAGTTCACACCATCCCTGTGTGCAAGGAAGGTATCAGAGGCCACACCGAATCTTGCTCTTGTCCCTTGCAGCAGAGTCCTCGTGCAGAT
AACAGTGCCCCTGGAACACCAACCAGGAAAATCTCTGCCTCTGAATTTGACCGGCCTCTTAGACCCATTGTTGTCAAGGATTCTGAGGGA
ACTGTGAGCTTCCTCTCTGACTCAGAAAAGAAGGAACAGATGCCTCTAACCCCTCCAAGGTTTGATCATGATGAAGGGGACCAGTGCTCA
AGACTCTTGGAATTAGTGAAGGATATTTCTAGTCATTTGGATGTCACAGCCTTATGTCACAAAATTTTCTTGCATATCCATGGACTGATA
TCTGCTGACCGCTATTCCCTGTTCCTTGTCTGTGAAGACAGCTCCAATGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCTGAAGGT
TCAACACTGGAAGAAGTTTCAAATAACTGTATCCGCTTAGAATGGAACAAAGGCATTGTGGGACATGTGGCAGCGCTTGGTGAGCCCTTG
AACATCAAAGATGCATATGAGGATCCTCGGTTCAATGCAGAAGTTGACCAAATTACAGGCTACAAGACACAAAGCATTCTTTGTATGCCA

>In-frame_PDE5A_ENST00000394439_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_676nt
ATGGTCAATGCATGGTTTGCTGAGAGAGTTCACACCATCCCTGTGTGCAAGGAAGGTATCAGAGGCCACACCGAATCTTGCTCTTGTCCC
TTGCAGCAGAGTCCTCGTGCAGATAACAGTGCCCCTGGAACACCAACCAGGAAAATCTCTGCCTCTGAATTTGACCGGCCTCTTAGACCC
ATTGTTGTCAAGGATTCTGAGGGAACTGTGAGCTTCCTCTCTGACTCAGAAAAGAAGGAACAGATGCCTCTAACCCCTCCAAGGTTTGAT
CATGATGAAGGGGACCAGTGCTCAAGACTCTTGGAATTAGTGAAGGATATTTCTAGTCATTTGGATGTCACAGCCTTATGTCACAAAATT
TTCTTGCATATCCATGGACTGATATCTGCTGACCGCTATTCCCTGTTCCTTGTCTGTGAAGACAGCTCCAATGACAAGTTTCTTATCAGC
CGCCTCTTTGATGTTGCTGAAGGTTCAACACTGGAAGAAGTTTCAAATAACTGTATCCGCTTAGAATGGAACAAAGGCATTGTGGGACAT
GTGGCAGCGCTTGGTGAGCCCTTGAACATCAAAGATGCATATGAGGATCCTCGGTTCAATGCAGAAGTTGACCAAATTACAGGCTACAAG

>In-frame_PDE5A_ENST00000264805_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_706nt
ATGTTGCCCTTTGGAGACAAAACAAGAGAAATGGTCAATGCATGGTTTGCTGAGAGAGTTCACACCATCCCTGTGTGCAAGGAAGGTATC
AGAGGCCACACCGAATCTTGCTCTTGTCCCTTGCAGCAGAGTCCTCGTGCAGATAACAGTGCCCCTGGAACACCAACCAGGAAAATCTCT
GCCTCTGAATTTGACCGGCCTCTTAGACCCATTGTTGTCAAGGATTCTGAGGGAACTGTGAGCTTCCTCTCTGACTCAGAAAAGAAGGAA
CAGATGCCTCTAACCCCTCCAAGGTTTGATCATGATGAAGGGGACCAGTGCTCAAGACTCTTGGAATTAGTGAAGGATATTTCTAGTCAT
TTGGATGTCACAGCCTTATGTCACAAAATTTTCTTGCATATCCATGGACTGATATCTGCTGACCGCTATTCCCTGTTCCTTGTCTGTGAA
GACAGCTCCAATGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCTGAAGGTTCAACACTGGAAGAAGTTTCAAATAACTGTATCCGC
TTAGAATGGAACAAAGGCATTGTGGGACATGTGGCAGCGCTTGGTGAGCCCTTGAACATCAAAGATGCATATGAGGATCCTCGGTTCAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PDE5A_ENST00000354960_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_2879nt
GCTGCCGCCGCCGCCGCCGCCTCCTGGGAACCAGGGGACTGAAGAGCCTGCGAGAGCGGAACACTGCCGGACCCCGGGTGGGGGGGGCGC
AGCAGCTGCGCCTGGCCCCGCCCACCACACCTGGGCGCCCGTAGAACCGCGCGGGGCGGGGCGGGGCAGGAGGCTGGCCTGGCGCTCCGG
CCGCTTTGTCGAAAGCCGGCCCGACTGGAGCAGGACGAAGGGGGAGGGTCTCGAGGCCGAGTCCTGTTCTTCTGAGGGACGGACCCCAGC
TGGGGTGGAAAAGCAGTACCAGAGAGCCTCCGAGGCGCGCGGTGCCAACCATGGAGCGGGCCGGCCCCAGCTTCGGGCAGCAGCGACAGC
AGCAGCAGCCCCAGCAGCAGAAGCAGCAGCAGAGGGATCAGGACTCGGTCGAAGCATGGCTGGACGATCACTGGGACTTTACCTTCTCAT
ACTTTGTTAGAAAAGCCACCAGAGAAATGGTCAATGCATGGTTTGCTGAGAGAGTTCACACCATCCCTGTGTGCAAGGAAGGTATCAGAG
GCCACACCGAATCTTGCTCTTGTCCCTTGCAGCAGAGTCCTCGTGCAGATAACAGTGCCCCTGGAACACCAACCAGGAAAATCTCTGCCT
CTGAATTTGACCGGCCTCTTAGACCCATTGTTGTCAAGGATTCTGAGGGAACTGTGAGCTTCCTCTCTGACTCAGAAAAGAAGGAACAGA
TGCCTCTAACCCCTCCAAGGTTTGATCATGATGAAGGGGACCAGTGCTCAAGACTCTTGGAATTAGTGAAGGATATTTCTAGTCATTTGG
ATGTCACAGCCTTATGTCACAAAATTTTCTTGCATATCCATGGACTGATATCTGCTGACCGCTATTCCCTGTTCCTTGTCTGTGAAGACA
GCTCCAATGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCTGAAGGTTCAACACTGGAAGAAGTTTCAAATAACTGTATCCGCTTAG
AATGGAACAAAGGCATTGTGGGACATGTGGCAGCGCTTGGTGAGCCCTTGAACATCAAAGATGCATATGAGGATCCTCGGTTCAATGCAG
AAGTTGACCAAATTACAGGCTACAAGACACAAAGCATTCTTTGTATGCCAATTAAGAATCATAGGGAAGAGACTTGTTCGCTGATATCTA
AATTAAGAAGTTGGTTCTTGAGTGAATTCTGAAAATGGCTACAAACTTCTTGAATAAAGAAGACAGGACTCTCAATAGAAGAATTTCACA
TCTCCAAGGGACCCTTCCTTTCATTTTACACTTTGTTACTAATTTGCAGAACTCTATTAATTGGGTAGGATTTCACCCATTCCTAGCTAA
GTTCTTAAAATTAAACCCTTTGGTTCGTGTTTAAAAACTTTCAAACATCTGATGGCTTTACAGGGGCTGAATATAAAAGCATTTGTACTT
AAAGGTCTTGTGTATTCATTAAGAAATATAGTAATGTCTTTTAATGTTTTAAGAGTTGATCAGGGTTTACTATGATGCAAGTAATAGGAT
GATTAATAAGGGAAGGTTTTTATGAATTCAAAAGTCAATTATTCAAAAGCAGGGAAAGATTTTGAGAGAGGGAACAAAGTATTCTTAGAT
TGCGTAGAAGCTGCTAGGTTCCAGTTTTAATTTTTAGGTTTAGTTGGACTCTGTTATGAAAAGATAGGTTATGGGTGGGCGACAGGTTGA
TACAGTCTTAGAAAAAGCAGGTAATATCAAAGTATTGGAAAGCTAGCATGCATGCCCTCTTACCTGGGTATCTTCCCCCTTTTTTCCTTT
TAAACTCTTGAGCCTCCTATAACGAAGGATTATGTGTTTCAAACCTATTTTTTTTTTACTGTTTCATTAAGTGTGCTTGTGCCCAAAATA
TTTACTTGTATAATATCTGTAACTTGCTTAAATACTTCAGCAAAGTCAGCATATTTACTCATTCAACAAATATTTGAGCCAGGCATTATT
TTAGACACAGCAGTGAACAAAACAAAAAGGCATTCTTGCCTTCATGGAGCTTACATTCTTATTGTTATTTAAATCTAAATGTTATAAAAC
AAGAATTTATATTCTAGGGTTGATCAGCTAGTATTTAATCAAAAAGGCCACACTCCCATAGCAGCTACTCTAAGCTGTAGTAGCTAATAA
AAAATATTAATGTTGGCCGGGCACAGTGGCTCACGCCTATAATCCCAGCACTTTGGGAGGCCAAGGGTGGTAGATCACTTGAGGTCAAGA
GTTGTGACACCAGCCTGGCCAACCTGGTGAAACCCTATCTCTATTAAAAAATACAAAAAAATACAAAAAAATTAGCTGGGCATGTTGGCA
TGCACCTGTAGTCCCAGCTATTTGGGAGGCTGAGGCACGAGAATTGCTTGAATCCGGGAGGTGGAGGTTGCAGTGAGCCAAGATGGGGCC
ACTGCACTCTAACGTGGGCAACAGAGACCCTGTCTCAAAAAGAAAATATTCCTGTTAGCCCTAAAGGCTTTACATGAGGAATGGTAGAAG
TGGTCTTTTGTTTAAATTAGTTGCATTCAGCATATATGAATTGTCTTAAATATTTTGGGGATACTCCCCCGCCTTTTAAACAGGGCATAA
GATCTGGTAAACTCTCTGTATATCTTCCTACCTTTCAAAATCGTTCTTAGGGTTAGTCAAGTCTGGAATATAATTGCTGACTATAAAGTT
AGCAATTATGCTTTTAAGGTGTTGTCACATCAACCTAAAGAGAACCATCTATGGAAGGTATGGTTGAAACATCTGTAGGAACACAGAACT

>In-frame_PDE5A_ENST00000394439_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_2460nt
GAGGGACGAGTCCACGGGACAGCCCAAAGGCAACATGACGGAACCTTGCCAAAAGAAATGGTCAATGCATGGTTTGCTGAGAGAGTTCAC
ACCATCCCTGTGTGCAAGGAAGGTATCAGAGGCCACACCGAATCTTGCTCTTGTCCCTTGCAGCAGAGTCCTCGTGCAGATAACAGTGCC
CCTGGAACACCAACCAGGAAAATCTCTGCCTCTGAATTTGACCGGCCTCTTAGACCCATTGTTGTCAAGGATTCTGAGGGAACTGTGAGC
TTCCTCTCTGACTCAGAAAAGAAGGAACAGATGCCTCTAACCCCTCCAAGGTTTGATCATGATGAAGGGGACCAGTGCTCAAGACTCTTG
GAATTAGTGAAGGATATTTCTAGTCATTTGGATGTCACAGCCTTATGTCACAAAATTTTCTTGCATATCCATGGACTGATATCTGCTGAC
CGCTATTCCCTGTTCCTTGTCTGTGAAGACAGCTCCAATGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCTGAAGGTTCAACACTG
GAAGAAGTTTCAAATAACTGTATCCGCTTAGAATGGAACAAAGGCATTGTGGGACATGTGGCAGCGCTTGGTGAGCCCTTGAACATCAAA
GATGCATATGAGGATCCTCGGTTCAATGCAGAAGTTGACCAAATTACAGGCTACAAGACACAAAGCATTCTTTGTATGCCAATTAAGAAT
CATAGGGAAGAGACTTGTTCGCTGATATCTAAATTAAGAAGTTGGTTCTTGAGTGAATTCTGAAAATGGCTACAAACTTCTTGAATAAAG
AAGACAGGACTCTCAATAGAAGAATTTCACATCTCCAAGGGACCCTTCCTTTCATTTTACACTTTGTTACTAATTTGCAGAACTCTATTA
ATTGGGTAGGATTTCACCCATTCCTAGCTAAGTTCTTAAAATTAAACCCTTTGGTTCGTGTTTAAAAACTTTCAAACATCTGATGGCTTT
ACAGGGGCTGAATATAAAAGCATTTGTACTTAAAGGTCTTGTGTATTCATTAAGAAATATAGTAATGTCTTTTAATGTTTTAAGAGTTGA
TCAGGGTTTACTATGATGCAAGTAATAGGATGATTAATAAGGGAAGGTTTTTATGAATTCAAAAGTCAATTATTCAAAAGCAGGGAAAGA
TTTTGAGAGAGGGAACAAAGTATTCTTAGATTGCGTAGAAGCTGCTAGGTTCCAGTTTTAATTTTTAGGTTTAGTTGGACTCTGTTATGA
AAAGATAGGTTATGGGTGGGCGACAGGTTGATACAGTCTTAGAAAAAGCAGGTAATATCAAAGTATTGGAAAGCTAGCATGCATGCCCTC
TTACCTGGGTATCTTCCCCCTTTTTTCCTTTTAAACTCTTGAGCCTCCTATAACGAAGGATTATGTGTTTCAAACCTATTTTTTTTTTAC
TGTTTCATTAAGTGTGCTTGTGCCCAAAATATTTACTTGTATAATATCTGTAACTTGCTTAAATACTTCAGCAAAGTCAGCATATTTACT
CATTCAACAAATATTTGAGCCAGGCATTATTTTAGACACAGCAGTGAACAAAACAAAAAGGCATTCTTGCCTTCATGGAGCTTACATTCT
TATTGTTATTTAAATCTAAATGTTATAAAACAAGAATTTATATTCTAGGGTTGATCAGCTAGTATTTAATCAAAAAGGCCACACTCCCAT
AGCAGCTACTCTAAGCTGTAGTAGCTAATAAAAAATATTAATGTTGGCCGGGCACAGTGGCTCACGCCTATAATCCCAGCACTTTGGGAG
GCCAAGGGTGGTAGATCACTTGAGGTCAAGAGTTGTGACACCAGCCTGGCCAACCTGGTGAAACCCTATCTCTATTAAAAAATACAAAAA
AATACAAAAAAATTAGCTGGGCATGTTGGCATGCACCTGTAGTCCCAGCTATTTGGGAGGCTGAGGCACGAGAATTGCTTGAATCCGGGA
GGTGGAGGTTGCAGTGAGCCAAGATGGGGCCACTGCACTCTAACGTGGGCAACAGAGACCCTGTCTCAAAAAGAAAATATTCCTGTTAGC
CCTAAAGGCTTTACATGAGGAATGGTAGAAGTGGTCTTTTGTTTAAATTAGTTGCATTCAGCATATATGAATTGTCTTAAATATTTTGGG
GATACTCCCCCGCCTTTTAAACAGGGCATAAGATCTGGTAAACTCTCTGTATATCTTCCTACCTTTCAAAATCGTTCTTAGGGTTAGTCA
AGTCTGGAATATAATTGCTGACTATAAAGTTAGCAATTATGCTTTTAAGGTGTTGTCACATCAACCTAAAGAGAACCATCTATGGAAGGT
ATGGTTGAAACATCTGTAGGAACACAGAACTGGGATTTCACTGAGTTTACCAAATCAACTGTGTGAACTGTTTCTGCACTGCTTGCTAAT

>In-frame_PDE5A_ENST00000264805_chr4_120517678_-_C4orf3_ENST00000399075_chr4_120219934_-_2891nt
GTGGAGCAGAGAGTGCTTGGCGGGCGGGTGCCCCGAAGCCTGAGGAATTGATGCATAGTCGGGGTGCGTGGACTCCAGGACGCGCCCCTT
TGCAGAAAGAGTCCGTGCCCCGCTGCCGCCTGCTCTGGGCAGCGGCCGTCGGGCAGCGGGTGCTGGCCGTCTTGGCCGGGAGGGTGACAC
ACGCCCGGCAGTGATGGTCGAGGAGCCCGCCCGGGTTCGACGCCCGGGTCCCACTCGCCGGCGCGCGGCCGCGGCTCTGCCGGTCGCTCC
CCGCCAGGGGGCGGCGCAGCGCGGGGCGAGCGGGAGGCGACGGGCGGCGGCGCGGAGGCCGGGGCCGTGAGGGAGCTGGTTCTGAGTCGC
CGACCTCACCTCACCTCACCTGCGCGCGTTGTTGCCCCTACGGAGCCTCCTGGAGTCCAGGATCGGCGGAGTTCGAAAACGAACTTCCCA
CGTTTGCTATGTTGCCCTTTGGAGACAAAACAAGAGAAATGGTCAATGCATGGTTTGCTGAGAGAGTTCACACCATCCCTGTGTGCAAGG
AAGGTATCAGAGGCCACACCGAATCTTGCTCTTGTCCCTTGCAGCAGAGTCCTCGTGCAGATAACAGTGCCCCTGGAACACCAACCAGGA
AAATCTCTGCCTCTGAATTTGACCGGCCTCTTAGACCCATTGTTGTCAAGGATTCTGAGGGAACTGTGAGCTTCCTCTCTGACTCAGAAA
AGAAGGAACAGATGCCTCTAACCCCTCCAAGGTTTGATCATGATGAAGGGGACCAGTGCTCAAGACTCTTGGAATTAGTGAAGGATATTT
CTAGTCATTTGGATGTCACAGCCTTATGTCACAAAATTTTCTTGCATATCCATGGACTGATATCTGCTGACCGCTATTCCCTGTTCCTTG
TCTGTGAAGACAGCTCCAATGACAAGTTTCTTATCAGCCGCCTCTTTGATGTTGCTGAAGGTTCAACACTGGAAGAAGTTTCAAATAACT
GTATCCGCTTAGAATGGAACAAAGGCATTGTGGGACATGTGGCAGCGCTTGGTGAGCCCTTGAACATCAAAGATGCATATGAGGATCCTC
GGTTCAATGCAGAAGTTGACCAAATTACAGGCTACAAGACACAAAGCATTCTTTGTATGCCAATTAAGAATCATAGGGAAGAGACTTGTT
CGCTGATATCTAAATTAAGAAGTTGGTTCTTGAGTGAATTCTGAAAATGGCTACAAACTTCTTGAATAAAGAAGACAGGACTCTCAATAG
AAGAATTTCACATCTCCAAGGGACCCTTCCTTTCATTTTACACTTTGTTACTAATTTGCAGAACTCTATTAATTGGGTAGGATTTCACCC
ATTCCTAGCTAAGTTCTTAAAATTAAACCCTTTGGTTCGTGTTTAAAAACTTTCAAACATCTGATGGCTTTACAGGGGCTGAATATAAAA
GCATTTGTACTTAAAGGTCTTGTGTATTCATTAAGAAATATAGTAATGTCTTTTAATGTTTTAAGAGTTGATCAGGGTTTACTATGATGC
AAGTAATAGGATGATTAATAAGGGAAGGTTTTTATGAATTCAAAAGTCAATTATTCAAAAGCAGGGAAAGATTTTGAGAGAGGGAACAAA
GTATTCTTAGATTGCGTAGAAGCTGCTAGGTTCCAGTTTTAATTTTTAGGTTTAGTTGGACTCTGTTATGAAAAGATAGGTTATGGGTGG
GCGACAGGTTGATACAGTCTTAGAAAAAGCAGGTAATATCAAAGTATTGGAAAGCTAGCATGCATGCCCTCTTACCTGGGTATCTTCCCC
CTTTTTTCCTTTTAAACTCTTGAGCCTCCTATAACGAAGGATTATGTGTTTCAAACCTATTTTTTTTTTACTGTTTCATTAAGTGTGCTT
GTGCCCAAAATATTTACTTGTATAATATCTGTAACTTGCTTAAATACTTCAGCAAAGTCAGCATATTTACTCATTCAACAAATATTTGAG
CCAGGCATTATTTTAGACACAGCAGTGAACAAAACAAAAAGGCATTCTTGCCTTCATGGAGCTTACATTCTTATTGTTATTTAAATCTAA
ATGTTATAAAACAAGAATTTATATTCTAGGGTTGATCAGCTAGTATTTAATCAAAAAGGCCACACTCCCATAGCAGCTACTCTAAGCTGT
AGTAGCTAATAAAAAATATTAATGTTGGCCGGGCACAGTGGCTCACGCCTATAATCCCAGCACTTTGGGAGGCCAAGGGTGGTAGATCAC
TTGAGGTCAAGAGTTGTGACACCAGCCTGGCCAACCTGGTGAAACCCTATCTCTATTAAAAAATACAAAAAAATACAAAAAAATTAGCTG
GGCATGTTGGCATGCACCTGTAGTCCCAGCTATTTGGGAGGCTGAGGCACGAGAATTGCTTGAATCCGGGAGGTGGAGGTTGCAGTGAGC
CAAGATGGGGCCACTGCACTCTAACGTGGGCAACAGAGACCCTGTCTCAAAAAGAAAATATTCCTGTTAGCCCTAAAGGCTTTACATGAG
GAATGGTAGAAGTGGTCTTTTGTTTAAATTAGTTGCATTCAGCATATATGAATTGTCTTAAATATTTTGGGGATACTCCCCCGCCTTTTA
AACAGGGCATAAGATCTGGTAAACTCTCTGTATATCTTCCTACCTTTCAAAATCGTTCTTAGGGTTAGTCAAGTCTGGAATATAATTGCT
GACTATAAAGTTAGCAATTATGCTTTTAAGGTGTTGTCACATCAACCTAAAGAGAACCATCTATGGAAGGTATGGTTGAAACATCTGTAG
GAACACAGAACTGGGATTTCACTGAGTTTACCAAATCAACTGTGTGAACTGTTTCTGCACTGCTTGCTAATGGTTTCATCTAATAAATGT


Top

FusionGenePPI for PDE5A_C4orf3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PDE5AAIPL1, MIOS, FGFR1OP, BLM, SUPT5H, WDR24, PATZ1, FKBP15C4orf3GCN1L1, PANX1, EDC4, DEGS1, ERMP1, CALM1, GLP1R, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PDE5A_C4orf3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePDE5AO76074DB00277TheophyllinecGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved
HgenePDE5AO76074DB00862VardenafilcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved
HgenePDE5AO76074DB00975DipyridamolecGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved
HgenePDE5AO76074DB06237AvanafilcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved
HgenePDE5AO76074DB00203SildenafilcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved|investigational
HgenePDE5AO76074DB00806PentoxifyllinecGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved|investigational
HgenePDE5AO76074DB00820TadalafilcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved|investigational
HgenePDE5AO76074DB06267UdenafilcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved|investigational
HgenePDE5AO76074DB04272Citric AcidcGMP-specific 3',5'-cyclic phosphodiesterasesmall moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for PDE5A_C4orf3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePDE5AC0027627Neoplasm Metastasis1CTD_human