FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2637

FusionGeneSummary for ARID1B_SASH1

check button Fusion gene summary
Fusion gene informationFusion gene name: ARID1B_SASH1
Fusion gene ID: 2637
HgeneTgene
Gene symbol

ARID1B

SASH1

Gene ID

57492

23328

Gene nameAT-rich interaction domain 1BSAM and SH3 domain containing 1
Synonyms6A3-5|BAF250B|BRIGHT|CSS1|DAN15|ELD/OSA1|MRD12|OSA2|P250RSH3D6A|dJ323M4.1
Cytomap

6q25.3

6q24.3-q25.1

Type of geneprotein-codingprotein-coding
DescriptionAT-rich interactive domain-containing protein 1BARID domain-containing protein 1BAT rich interactive domain 1B (SWI1-like)BRG1-associated factor 250bBRG1-binding protein ELD/OSA1ELD (eyelid)/OSA proteinSAM and SH3 domain-containing protein 1proline-glutamate repeat-containing protein
Modification date2018052920180523
UniProtAcc

Q8NFD5

O94885

Ensembl transtripts involved in fusion geneENST00000350026, ENST00000346085, 
ENST00000367148, ENST00000275248, 
ENST00000478761, 
ENST00000367469, 
ENST00000367467, ENST00000470750, 
Fusion gene scores* DoF score20 X 12 X 11=26407 X 6 X 4=168
# samples 217
** MAII scorelog2(21/2640*10)=-3.65207669657969
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARID1B [Title/Abstract] AND SASH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSASH1

GO:0000209

protein polyubiquitination

23776175

TgeneSASH1

GO:0010595

positive regulation of endothelial cell migration

23776175

TgeneSASH1

GO:1900044

regulation of protein K63-linked ubiquitination

23776175

TgeneSASH1

GO:1902498

regulation of protein autoubiquitination

23776175


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A197-06AARID1Bchr6

157150555

+SASH1chr6

148711270

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000350026ENST00000367469ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000350026ENST00000367467ARID1Bchr6

157150555

+SASH1chr6

148711270

+
5CDS-intronENST00000350026ENST00000470750ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000346085ENST00000367469ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000346085ENST00000367467ARID1Bchr6

157150555

+SASH1chr6

148711270

+
5CDS-intronENST00000346085ENST00000470750ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000367148ENST00000367469ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000367148ENST00000367467ARID1Bchr6

157150555

+SASH1chr6

148711270

+
5CDS-intronENST00000367148ENST00000470750ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000275248ENST00000367469ARID1Bchr6

157150555

+SASH1chr6

148711270

+
In-frameENST00000275248ENST00000367467ARID1Bchr6

157150555

+SASH1chr6

148711270

+
5CDS-intronENST00000275248ENST00000470750ARID1Bchr6

157150555

+SASH1chr6

148711270

+
intron-3CDSENST00000478761ENST00000367469ARID1Bchr6

157150555

+SASH1chr6

148711270

+
intron-3CDSENST00000478761ENST00000367467ARID1Bchr6

157150555

+SASH1chr6

148711270

+
intron-intronENST00000478761ENST00000470750ARID1Bchr6

157150555

+SASH1chr6

148711270

+

Top

FusionProtFeatures for ARID1B_SASH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARID1B

Q8NFD5

SASH1

O94885

Involved in transcriptional activation and repression ofselect genes by chromatin remodeling (alteration of DNA-nucleosometopology). Component of SWI/SNF chromatin remodeling complexesthat carry out key enzymatic activities, changing chromatinstructure by altering DNA-histone contacts within a nucleosome inan ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and theneuron-specific chromatin remodeling complex (nBAF complex).During neural development a switch from a stem/progenitor to apostmitotic chromatin remodeling mechanism occurs as neurons exitthe cell cycle and become committed to their adult state. Thetransition from proliferating neural stem/progenitor cells topostmitotic neurons requires a switch in subunit composition ofthe npBAF and nBAF complexes. As neural progenitors exit mitosisand differentiate into neurons, npBAF complexes which containACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologousalternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunitsin neuron-specific complexes (nBAF). The npBAF complex isessential for the self-renewal/proliferative capacity of themultipotent neural stem cells. The nBAF complex along with CRESTplays a role regulating the activity of genes essential fordendrite growth (By similarity). Binds DNA non-specifically(PubMed:14982958, PubMed:15170388). {ECO:0000250|UniProtKB:E9Q4N7,ECO:0000269|PubMed:14982958, ECO:0000269|PubMed:15170388,ECO:0000303|PubMed:12672490, ECO:0000303|PubMed:22952240,ECO:0000303|PubMed:26601204}. May have a role in a signaling pathway. Could act as atumor suppressor.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220107_1315792250Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220114_1315792250Compositional biasNote=Poly-Gln
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220141_4015792250Compositional biasNote=Gly-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2202_475792250Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220329_4935792250Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+22035_575792250Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+22081_1045792250Compositional biasNote=His-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219107_1315792237Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219114_1315792237Compositional biasNote=Poly-Gln
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219141_4015792237Compositional biasNote=Gly-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2192_475792237Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219329_4935792237Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+21935_575792237Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+21981_1045792237Compositional biasNote=His-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220107_1315792290Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220114_1315792290Compositional biasNote=Poly-Gln
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220141_4015792290Compositional biasNote=Gly-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2202_475792290Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220329_4935792290Compositional biasNote=Ala-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+22035_575792290Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+22081_1045792290Compositional biasNote=His-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220419_4235792250MotifNote=LXXLL
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219419_4235792237MotifNote=LXXLL
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220419_4235792290MotifNote=LXXLL
TgeneSASH1chr6:157150555chr6:148711270ENST00000367467+020978_1059521248Compositional biasNote=Pro-rich
TgeneSASH1chr6:157150555chr6:148711270ENST00000367467+0201177_1241521248DomainSAM 2
TgeneSASH1chr6:157150555chr6:148711270ENST00000367467+020554_615521248DomainSH3
TgeneSASH1chr6:157150555chr6:148711270ENST00000367467+020633_697521248DomainSAM 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201034_10375792250Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201441_14445792250Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201459_15975792250Compositional biasNote=Pro-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201833_18365792250Compositional biasNote=Poly-Pro
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220574_6335792250Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220684_7715792250Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+220932_9355792250Compositional biasNote=Poly-Ala
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191034_10375792237Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191441_14445792237Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191459_15975792237Compositional biasNote=Pro-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191833_18365792237Compositional biasNote=Poly-Pro
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219574_6335792237Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219684_7715792237Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+219932_9355792237Compositional biasNote=Poly-Ala
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201034_10375792290Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201441_14445792290Compositional biasNote=Poly-Ser
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201459_15975792290Compositional biasNote=Pro-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201833_18365792290Compositional biasNote=Poly-Pro
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220574_6335792290Compositional biasNote=Gln-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220684_7715792290Compositional biasNote=Ser-rich
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+220932_9355792290Compositional biasNote=Poly-Ala
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201053_11445792250DomainARID
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191053_11445792237DomainARID
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201053_11445792290DomainARID
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2201358_13775792250MotifNuclear localization signal
HgeneARID1Bchr6:157150555chr6:148711270ENST00000346085+2202036_20405792250MotifNote=LXXLL
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2191358_13775792237MotifNuclear localization signal
HgeneARID1Bchr6:157150555chr6:148711270ENST00000350026+2192036_20405792237MotifNote=LXXLL
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2201358_13775792290MotifNuclear localization signal
HgeneARID1Bchr6:157150555chr6:148711270ENST00000367148+2202036_20405792290MotifNote=LXXLL
TgeneSASH1chr6:157150555chr6:148711270ENST00000367467+0209_33521248Compositional biasNote=Pro-rich


Top

FusionGeneSequence for ARID1B_SASH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_657aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT

>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_1775aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT
SLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLM
MMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEEMKK
PSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGTFF
SYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHVGSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRK
RMSKKYSSSVSEQDSGLDGMPGSPPPSQPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRG
PFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKGRPPQPKSVEDLLD
RINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSQGLSGCSPRDSGCYESSEN
LENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCE
TLEGPQTVDTWPRSHSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRFSEPQKLTTKKLEG
SIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVDAEQRMQPKIPSQPPPVPAKKSRERLANGLHPV
PMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPGSPPSTRPPPWLSELPENTSLQEHGVKLGPALTRKVSCARGVDL
ETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVS

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_657aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_1775aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT
SLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLM
MMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEEMKK
PSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGTFF
SYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHVGSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRK
RMSKKYSSSVSEQDSGLDGMPGSPPPSQPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRG
PFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKGRPPQPKSVEDLLD
RINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSQGLSGCSPRDSGCYESSEN
LENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCE
TLEGPQTVDTWPRSHSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRFSEPQKLTTKKLEG
SIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVDAEQRMQPKIPSQPPPVPAKKSRERLANGLHPV
PMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPGSPPSTRPPPWLSELPENTSLQEHGVKLGPALTRKVSCARGVDL
ETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVS

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_657aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_1775aa
MAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHA
HHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLS
KPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSAS
AAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGG
SSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPP
SQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQ
QSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPT
SLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLM
MMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEESVKFKRLHKLVNSTRRVRKKLIRVEEMKK
PSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSLDTWGAGRKLVKTFSKGESRGLIKPPKKMGTFF
SYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHVGSNNSDPMGKEGDFVYKEVIKSPTASRISLGKKVKSVKETMRK
RMSKKYSSSVSEQDSGLDGMPGSPPPSQPDPEHLDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPYRG
PFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVDVLSEDEEKPKRPTRRRRKGRPPQPKSVEDLLD
RINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNSDQSGSQEKLLVDSQGLSGCSPRDSGCYESSEN
LENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCE
TLEGPQTVDTWPRSHSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQPLEQDSAVDNALLLTQSKRFSEPQKLTTKKLEG
SIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVDAEQRMQPKIPSQPPPVPAKKSRERLANGLHPV
PMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPGSPPSTRPPPWLSELPENTSLQEHGVKLGPALTRKVSCARGVDL
ETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGGLTEICRKPVSPGCISSVS

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_599aa
METGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAP
QPGPDMEQPQHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAA
PASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGG
AGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPT
LNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGP
TMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYN

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_1717aa
METGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAP
QPGPDMEQPQHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAA
PASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGG
AGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPT
LNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGP
TMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQDGSLGNIDDLAQQYADYYN
TCFSDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKN
QKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDE
TEESVKFKRLHKLVNSTRRVRKKLIRVEEMKKPSTEGGEEHVFENSPVLDERSALYSGVHKKPLFFDGSPEKPPEDDSDSLTTSPSSSSL
DTWGAGRKLVKTFSKGESRGLIKPPKKMGTFFSYPEEEKAQKVSRSLTEGEMKKGLGSLSHGRTCSFGGFDLTNRSLHVGSNNSDPMGKE
GDFVYKEVIKSPTASRISLGKKVKSVKETMRKRMSKKYSSSVSEQDSGLDGMPGSPPPSQPDPEHLDKPKLKAGGSVESLRSSLSGQSSM
SGQTVSTTDSSTSNRESVKSEDGDDEEPPYRGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVD
VLSEDEEKPKRPTRRRRKGRPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEEDLDELNIRDPEHRAVLLTAVELLQEYDSNS
DQSGSQEKLLVDSQGLSGCSPRDSGCYESSENLENGKTRKASLLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGL
APDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSHSLDDLQVEPGAEQDVPTEVTEPPPQIVPEVPQKTTASSTKAQP
LEQDSAVDNALLLTQSKRFSEPQKLTTKKLEGSIAASGRGLSPPQCLPRNYDAQPPGAKHGLARTPLEGHRKGHEFEGTHHPLGTKEGVD
AEQRMQPKIPSQPPPVPAKKSRERLANGLHPVPMGPSGALPSPDAPCLPVKRGSPASPTSPSDCPPALAPRPLSGQAPGSPPSTRPPPWL
SELPENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVK
QLRKQHRMAIPSGGLTEICRKPVSPGCISSVSDWLISIGLPMYAGTLSTAGFSTLSQVPSLSHTCLQEAGITEERHIRKLLSAARLFKLP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_1971nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG

>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_5325nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG
TCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCAT
AAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAA
GGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAATG
ATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTG
GACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAG
GAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAA
CCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAAG
CCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACC
TGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTC
TCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGGG
AGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGAC
TTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAG
AGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGAC
CCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGGT
CAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGC
CCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATC
GATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCTC
AGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGAT
CGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTG
GATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCAG
TCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAAC
CTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTG
GGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCA
GACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGAG
ACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTG
CCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAG
CAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGGC
TCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTTA
GCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAG
CAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTT
CCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAGC
GACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAG
CTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTA
GAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCCT
GAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCTT
CGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCA
GATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCT
CACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGGC

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_1971nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_5325nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG
TCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCAT
AAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAA
GGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAATG
ATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTG
GACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAG
GAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAA
CCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAAG
CCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACC
TGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTC
TCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGGG
AGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGAC
TTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAG
AGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGAC
CCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGGT
CAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGC
CCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATC
GATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCTC
AGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGAT
CGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTG
GATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCAG
TCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAAC
CTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTG
GGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCA
GACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGAG
ACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTG
CCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAG
CAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGGC
TCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTTA
GCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAG
CAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTT
CCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAGC
GACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAG
CTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTA
GAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCCT
GAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCTT
CGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCA
GATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCT
CACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGGC

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_1971nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_5325nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG
TCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCAT
AAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAA
GGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAATG
ATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTG
GACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAG
GAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAA
CCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAAG
CCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACC
TGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTC
TCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGGG
AGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGAC
TTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAG
AGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGAC
CCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGGT
CAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGC
CCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATC
GATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCTC
AGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGAT
CGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTG
GATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCAG
TCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAAC
CTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTG
GGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCA
GACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGAG
ACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTG
CCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAG
CAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGGC
TCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTTA
GCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAG
CAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTT
CCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAGC
GACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAG
CTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTA
GAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCCT
GAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCTT
CGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCA
GATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCT
CACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGGC

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_1797nt
ATGGAGACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCAC
CATGCCCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAG
CAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCT
CAGCCCGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTG
CTGAGCAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTG
GGCACGCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCC
CCTGCGAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCC
GCCTCCGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTAT
CCGGGCTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGA
GCAGGAGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTAT
GGGGGCTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCG
AGCCTCAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACC
CTCAATCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCG
CCGCCGTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGAC
ATGGGCGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCG
ACCATGGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAG
CCTCAGCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGG
GCCATGGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAAC
ACCTGTTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGC

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_5151nt
ATGGAGACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCAC
CATGCCCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAG
CAGCAGCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCT
CAGCCCGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTG
CTGAGCAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTG
GGCACGCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCC
CCTGCGAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCC
GCCTCCGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTAT
CCGGGCTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGA
GCAGGAGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTAT
GGGGGCTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCG
AGCCTCAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACC
CTCAATCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCG
CCGCCGTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGAC
ATGGGCGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCG
ACCATGGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAG
CCTCAGCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGG
GCCATGGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAAC
ACCTGTTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGC
CCCACGTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCT
CTTCATAAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAAC
CAGAAAGGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAG
CTAATGATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCT
GCCCTGGACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAG
ACTGAGGAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATG
AAAAAACCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCAC
AAGAAGCCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTG
GACACCTGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACA
TTCTTCTCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGC
CACGGGAGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAA
GGAGACTTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATG
AGAAAGAGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAG
CCCGACCCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATG
AGCGGTCAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTAC
CGAGGCCCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGAT
ATCATCGATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGAC
GTGCTCAGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTC
CTGGATCGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAA
GACTTGGATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGC
GACCAGTCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGT
GAGAACCTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAAC
CAGTTGGGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTT
GCCCCAGACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGC
TGTGAGACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAA
GACGTGCCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCC
CTGGAGCAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTG
GAGGGCTCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACAC
GGTTTAGCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGAT
GCTGAGCAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCAC
CCTGTTCCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGC
CCTAGCGACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTC
TCAGAGCTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTG
GATCTAGAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGG
ATTCCTGAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAG
CAGCTTCGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCT
GTGTCAGATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCT
CTGTCTCACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_2255nt
CATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAG
CGCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGA
GACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGC
CCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCA
GCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCC
CGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAG
CAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCAC
GCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGC
GAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTC
CGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGG
CTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGG
AGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGG
CTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCT
CAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAA
TCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCC
GTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGG
CGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCAT
GGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCA
GCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCAT
GGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTG
TTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCAC
GTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGTAAGTCTTTCT
CCCTCTGCCCAGGACCACCTTCCAAGAAGGTGTCTTTTAGGTCCATGCTGACGGAAATCAAACAGGCGATCATGTGCGTATGTACTATGG
AGTTATGCGATGTCATTTTCCTTAACATGTTGCATGCATGTGTGTGTATCTAGGTGGCTAAGAGTGTGTTTTGTAATGCAGTTGGTGATG
TCTGAGGATTTTGTGAAGAGTTACTGATTTTACACTTATTGTGAATAAACCCTAAATAAATCTCCGGAAATAGAAAGGGAAAGGATAGGT

>In-frame_ARID1B_ENST00000350026_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_8818nt
CATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAG
CGCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGA
GACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGC
CCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCA
GCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCC
CGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAG
CAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCAC
GCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGC
GAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTC
CGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGG
CTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGG
AGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGG
CTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCT
CAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAA
TCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCC
GTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGG
CGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCAT
GGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCA
GCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCAT
GGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTG
TTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCAC
GTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCA
TAAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAA
AGGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAAT
GATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCT
GGACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGA
GGAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAA
ACCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAA
GCCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACAC
CTGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTT
CTCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGG
GAGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGA
CTTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAA
GAGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGA
CCCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGG
TCAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGG
CCCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCAT
CGATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCT
CAGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGA
TCGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTT
GGATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCA
GTCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAA
CCTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTT
GGGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCC
AGACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGA
GACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGT
GCCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGA
GCAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGG
CTCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTT
AGCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGA
GCAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGT
TCCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAG
CGACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGA
GCTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCT
AGAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCC
TGAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCT
TCGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTC
AGATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTC
TCACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGG
CCCTGAGGCCATGTAGCCAGGCCCGGAATGGGCCTCTCTGGACAAGAGCCACCCTTTCACTGTGCATATGATGCTGATGCAATTCCTCCA
TCATCTCTGGACGTGCAGACCAGATCCAGAAGAAAGGCCTGGCGTGTGGCCAAACAGCGTGAAACCTTGGCACAGGACTGAGGATCCTCT
CCTCCAGAAAAGCCCCCTCGAGGAAATAAATTAGTGCGGTTCTCTTTGACCCCCAAAGACAAGACAAGCACTTATTTTTATTTTCAGAAG
ACAAAAGAACCAAGATGCCAACTGGCTGCGAATGCTCTATCTCCAGTCTGTCTCTGTGTACTGGTAGAGGCTGGGAGGAGTAGGGGGCAG
CCTGTTCCATTTCTGATAGTGCCCTTGCTCTTCTGTCTGTCATCTTGCAGGATGCCCGAGGGCCAGATGGGCTTAGCTAGGCCAAAGTAA
CAGACTCAAGAGTTATTGTACATTACTGACCACGCTCATTTGTTCAAAAGTTAGAACATCTGGCTGCACCAGGAAAAAAAAAAAAAAAAA
GTCCTGTTCTTCTTTAGATAAACAAGAGACATTTTCATAATTGCTTTCTAGCAATCAGCTTTTATTTGCCTTAATATAAGCTTTTAAGCA
GTTATCTAACTAGTGTCCACAACCCTGTAACCATACTTCCACATCTTCAGCTTAGGCAGACATCGAACCTCTCTGGGATGTTTCCAGCAA
AAGTGAGCTTTTCTAATCGTCTCATTGTAACATGGCTTATTTTGTAGAGGTATTCATCAGCCACACACTTCATGTTGGTTTTTGGTTTTT
AAGCTAACTACAAATCTAGTAAAAAGCTATCTGAAATTCACAAATATCATGTGTGTGCGTGCGTGCGTGCGCGTGTGTGTCTGTATTCAT
AGTGACTGCTTTTGGTTTTAACCAGTTTAGTATCGTTACTGTGTGGATCGTCGCGCTGCAGTATTGACTTGGAATCCTGACCATGTCCAT
CCCAAAATTCAGTCCTCAGTTAACGGATCATGTTTGCAAAAGGTCACTGTGAGGCTGCATATTTCAGAAAGATGTCCTTAATAAGGGAAG
TCATGTATAAGATGTTTTCTAAAAGACTTTTCAGTATTACAACTAATACTATTATTATCCTTCTTTTTTTATTTAGATAATTCTTTTAAT
TTAAACAAAGGTTCACTATGGAACCAGACAAATCTCATTAGCCATGTGTTAAGTATTTGCTACTTTAAATTGTTTTACAACTGATTTCAG
CACATTCTATCCTTTTTTTTTTTTGAAATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAATGGCACGATCTTGGCTCACTGCAACC
TCAGTCTCCCAGGTTCAAGTGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTATAGGCACCCACCACCACGCCCAGCTAATTTTTG
TATTATTAGTAGAGACAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCAACTCCTGACCTCAGGTGGTCCACCCGCCTCAGCCTC
CCAAAGTGCTGGGATTACAGGTGTGAGCCACCGCACCTGGCCTCTGTCCTCTTTTAGTCTAGTGTCTGGTTTTCTAGCAAACAGTAAATT
TAAACAAGTAAACTATTATGGTTTCCATTGCTTACAAAATGATTTTCCTTTACATTCTTATCATGAACACTATTTTAAGCATCAAATGCA
ATCATCTAAAATATAAAGGTCAATCATTTATAATAGAAACACCTTGACCACAAGCCCTTGATTGAACATTTTATAATATTTCATCTACTT
ATTAAAACAAATAATTTCCCTTGGGTTGGAGGGGAAGTGATTTCATAAATTAATTAGAAAGCCATCTTTAGCATATTGCTTATGTCTGGA
TCCATGTTTCTGAGGAAAAAGACATTCTCAGGTGATGTATTTTTTTCATGCATTAGTATGCATTTTTAAAAAATAATGCATGTTTCTTTA
ATAATTAATTTTCATCTTCTATAAGATGCCATGTGAAGAAGTTGTGGAAATGTAGAATAAAAAGCTAAAGCTGCCAAATTTCTGTTGAAC
TCTTAAAAACAGCTCATGTTTGTTTGTCCTCTCGGGTTGTGGCCTAGCCTATTTGCAATGTAATGAAGCTGCAGGGTTCTTGTATAGCTA
AAGCGTTCAATGCATTTCACGTGCTGTGGTGGATGTGGGTGCTGTAGACAGGCTTCTTCTCTTCCTGCTCTCAAAATACCTCGGCTTGAC
ATTTGGACAGATCCTGTCATTGTTTAAGCTGAGCAAAAAACCACACAAAAGTTGTGTAAGAGATGAGATAACAAAGGAGCGAGAGAAATC
TCATGTGAATTTCCAAGTTTTAATTCGTTCTCCATGAAGGATTTTCATTTCAGTGAAAGTCGCAGCAGAAGAGGGAACTTTCTGGAGTTT
TTGAGAATGCCAAACCACATTTTTATCACACTTCTTTGGAAATCAATGCCTTTGCATAGAAAATCAAATTCAGGGACCACAAAGAATTTT
CAGTGGGAATGTCTAGTCTGAGGGGTCTGAGGTTGTTTTTACTTTATTGTGTTGTTTAAATATTTTAAAAATATCTTTAGCGTTTGGTCT
TTTTTTTTTCTGTAAACATTTAATTTGGTCTGAGAAAAGCTGAATGTTTGGGTGTGACGTTTGACTGAGGTGGATTGGGGCTGCCTGTGG
ACATTAGTGAACAGGTGGTAGGCTTCAGGAATATCCAGTTTTAATCAGTTGCATTTGGTACAGAATTTTGAGTAATGGTGAAAATTGTTG
TCTTTGGAAAGCACAAAAGAAACCTGGAAAGGCAGTTCGGCTCAGGTAGCTACACATAACATTGTGTATGATTTTCACTTCAAAGCTGTC
TGGAAGGAAATGCAGTCAGCTCCAGCTAGTACTATTTATGTACCCAGATAACTAAGATATTGTTTCATGGCCTTGCCTTAGTCAGAGGCC
CTTTTCTCTGTCCTGAACCCCCAGGTATGGGTGAAATTGGAAATTACTAATCTATTGGAAATCAGTTCCTGACATAGTAAAGTTTGCTTT
CATAACTGCAGCAAAAAAGGTCAACTTGCCAAGTCACTGCTGCCATGTGTGTACTGTATTATTTTCAGAAAAAAATATAATAGTCTGAGT
CCAAGTTATCTTGATTTAAAATTGATAGAGAAAAGAAACTGTCGAGCAAGTTATATAACAACTAACAACATTGCACTTTCTGTATATGAA
ATCAATATTTAAATAACTTATTTTTCTCCATTGCTGTTCTTAAAAACATTGTAAGTAGCTGTAATATACCAGTACCAATATGTTCTTGCA
ATTGCTTCAGCCCAAGAAAGCTGTGTATTGTTTTAAAAATTGTAAAAATTATTGTGATGATTCATTTAGCATAAAGAGAGGTGGACGGAA

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_2255nt
CATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAG
CGCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGA
GACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGC
CCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCA
GCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCC
CGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAG
CAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCAC
GCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGC
GAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTC
CGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGG
CTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGG
AGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGG
CTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCT
CAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAA
TCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCC
GTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGG
CGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCAT
GGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCA
GCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCAT
GGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTG
TTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCAC
GTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGTAAGTCTTTCT
CCCTCTGCCCAGGACCACCTTCCAAGAAGGTGTCTTTTAGGTCCATGCTGACGGAAATCAAACAGGCGATCATGTGCGTATGTACTATGG
AGTTATGCGATGTCATTTTCCTTAACATGTTGCATGCATGTGTGTGTATCTAGGTGGCTAAGAGTGTGTTTTGTAATGCAGTTGGTGATG
TCTGAGGATTTTGTGAAGAGTTACTGATTTTACACTTATTGTGAATAAACCCTAAATAAATCTCCGGAAATAGAAAGGGAAAGGATAGGT

>In-frame_ARID1B_ENST00000346085_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_8818nt
CATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAG
CGCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGA
GACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGC
CCACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCA
GCAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCC
CGGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAG
CAAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCAC
GCAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGC
GAGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTC
CGCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGG
CTACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGG
AGCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGG
CTCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCT
CAGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAA
TCAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCC
GTCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGG
CGCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCAT
GGGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCA
GCAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCAT
GGCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTG
TTTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCAC
GTCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCA
TAAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAA
AGGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAAT
GATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCT
GGACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGA
GGAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAA
ACCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAA
GCCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACAC
CTGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTT
CTCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGG
GAGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGA
CTTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAA
GAGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGA
CCCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGG
TCAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGG
CCCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCAT
CGATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCT
CAGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGA
TCGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTT
GGATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCA
GTCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAA
CCTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTT
GGGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCC
AGACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGA
GACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGT
GCCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGA
GCAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGG
CTCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTT
AGCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGA
GCAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGT
TCCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAG
CGACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGA
GCTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCT
AGAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCC
TGAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCT
TCGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTC
AGATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTC
TCACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGG
CCCTGAGGCCATGTAGCCAGGCCCGGAATGGGCCTCTCTGGACAAGAGCCACCCTTTCACTGTGCATATGATGCTGATGCAATTCCTCCA
TCATCTCTGGACGTGCAGACCAGATCCAGAAGAAAGGCCTGGCGTGTGGCCAAACAGCGTGAAACCTTGGCACAGGACTGAGGATCCTCT
CCTCCAGAAAAGCCCCCTCGAGGAAATAAATTAGTGCGGTTCTCTTTGACCCCCAAAGACAAGACAAGCACTTATTTTTATTTTCAGAAG
ACAAAAGAACCAAGATGCCAACTGGCTGCGAATGCTCTATCTCCAGTCTGTCTCTGTGTACTGGTAGAGGCTGGGAGGAGTAGGGGGCAG
CCTGTTCCATTTCTGATAGTGCCCTTGCTCTTCTGTCTGTCATCTTGCAGGATGCCCGAGGGCCAGATGGGCTTAGCTAGGCCAAAGTAA
CAGACTCAAGAGTTATTGTACATTACTGACCACGCTCATTTGTTCAAAAGTTAGAACATCTGGCTGCACCAGGAAAAAAAAAAAAAAAAA
GTCCTGTTCTTCTTTAGATAAACAAGAGACATTTTCATAATTGCTTTCTAGCAATCAGCTTTTATTTGCCTTAATATAAGCTTTTAAGCA
GTTATCTAACTAGTGTCCACAACCCTGTAACCATACTTCCACATCTTCAGCTTAGGCAGACATCGAACCTCTCTGGGATGTTTCCAGCAA
AAGTGAGCTTTTCTAATCGTCTCATTGTAACATGGCTTATTTTGTAGAGGTATTCATCAGCCACACACTTCATGTTGGTTTTTGGTTTTT
AAGCTAACTACAAATCTAGTAAAAAGCTATCTGAAATTCACAAATATCATGTGTGTGCGTGCGTGCGTGCGCGTGTGTGTCTGTATTCAT
AGTGACTGCTTTTGGTTTTAACCAGTTTAGTATCGTTACTGTGTGGATCGTCGCGCTGCAGTATTGACTTGGAATCCTGACCATGTCCAT
CCCAAAATTCAGTCCTCAGTTAACGGATCATGTTTGCAAAAGGTCACTGTGAGGCTGCATATTTCAGAAAGATGTCCTTAATAAGGGAAG
TCATGTATAAGATGTTTTCTAAAAGACTTTTCAGTATTACAACTAATACTATTATTATCCTTCTTTTTTTATTTAGATAATTCTTTTAAT
TTAAACAAAGGTTCACTATGGAACCAGACAAATCTCATTAGCCATGTGTTAAGTATTTGCTACTTTAAATTGTTTTACAACTGATTTCAG
CACATTCTATCCTTTTTTTTTTTTGAAATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAATGGCACGATCTTGGCTCACTGCAACC
TCAGTCTCCCAGGTTCAAGTGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTATAGGCACCCACCACCACGCCCAGCTAATTTTTG
TATTATTAGTAGAGACAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCAACTCCTGACCTCAGGTGGTCCACCCGCCTCAGCCTC
CCAAAGTGCTGGGATTACAGGTGTGAGCCACCGCACCTGGCCTCTGTCCTCTTTTAGTCTAGTGTCTGGTTTTCTAGCAAACAGTAAATT
TAAACAAGTAAACTATTATGGTTTCCATTGCTTACAAAATGATTTTCCTTTACATTCTTATCATGAACACTATTTTAAGCATCAAATGCA
ATCATCTAAAATATAAAGGTCAATCATTTATAATAGAAACACCTTGACCACAAGCCCTTGATTGAACATTTTATAATATTTCATCTACTT
ATTAAAACAAATAATTTCCCTTGGGTTGGAGGGGAAGTGATTTCATAAATTAATTAGAAAGCCATCTTTAGCATATTGCTTATGTCTGGA
TCCATGTTTCTGAGGAAAAAGACATTCTCAGGTGATGTATTTTTTTCATGCATTAGTATGCATTTTTAAAAAATAATGCATGTTTCTTTA
ATAATTAATTTTCATCTTCTATAAGATGCCATGTGAAGAAGTTGTGGAAATGTAGAATAAAAAGCTAAAGCTGCCAAATTTCTGTTGAAC
TCTTAAAAACAGCTCATGTTTGTTTGTCCTCTCGGGTTGTGGCCTAGCCTATTTGCAATGTAATGAAGCTGCAGGGTTCTTGTATAGCTA
AAGCGTTCAATGCATTTCACGTGCTGTGGTGGATGTGGGTGCTGTAGACAGGCTTCTTCTCTTCCTGCTCTCAAAATACCTCGGCTTGAC
ATTTGGACAGATCCTGTCATTGTTTAAGCTGAGCAAAAAACCACACAAAAGTTGTGTAAGAGATGAGATAACAAAGGAGCGAGAGAAATC
TCATGTGAATTTCCAAGTTTTAATTCGTTCTCCATGAAGGATTTTCATTTCAGTGAAAGTCGCAGCAGAAGAGGGAACTTTCTGGAGTTT
TTGAGAATGCCAAACCACATTTTTATCACACTTCTTTGGAAATCAATGCCTTTGCATAGAAAATCAAATTCAGGGACCACAAAGAATTTT
CAGTGGGAATGTCTAGTCTGAGGGGTCTGAGGTTGTTTTTACTTTATTGTGTTGTTTAAATATTTTAAAAATATCTTTAGCGTTTGGTCT
TTTTTTTTTCTGTAAACATTTAATTTGGTCTGAGAAAAGCTGAATGTTTGGGTGTGACGTTTGACTGAGGTGGATTGGGGCTGCCTGTGG
ACATTAGTGAACAGGTGGTAGGCTTCAGGAATATCCAGTTTTAATCAGTTGCATTTGGTACAGAATTTTGAGTAATGGTGAAAATTGTTG
TCTTTGGAAAGCACAAAAGAAACCTGGAAAGGCAGTTCGGCTCAGGTAGCTACACATAACATTGTGTATGATTTTCACTTCAAAGCTGTC
TGGAAGGAAATGCAGTCAGCTCCAGCTAGTACTATTTATGTACCCAGATAACTAAGATATTGTTTCATGGCCTTGCCTTAGTCAGAGGCC
CTTTTCTCTGTCCTGAACCCCCAGGTATGGGTGAAATTGGAAATTACTAATCTATTGGAAATCAGTTCCTGACATAGTAAAGTTTGCTTT
CATAACTGCAGCAAAAAAGGTCAACTTGCCAAGTCACTGCTGCCATGTGTGTACTGTATTATTTTCAGAAAAAAATATAATAGTCTGAGT
CCAAGTTATCTTGATTTAAAATTGATAGAGAAAAGAAACTGTCGAGCAAGTTATATAACAACTAACAACATTGCACTTTCTGTATATGAA
ATCAATATTTAAATAACTTATTTTTCTCCATTGCTGTTCTTAAAAACATTGTAAGTAGCTGTAATATACCAGTACCAATATGTTCTTGCA
ATTGCTTCAGCCCAAGAAAGCTGTGTATTGTTTTAAAAATTGTAAAAATTATTGTGATGATTCATTTAGCATAAAGAGAGGTGGACGGAA

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_2254nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG
TCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGTAAGTCTTTCTC
CCTCTGCCCAGGACCACCTTCCAAGAAGGTGTCTTTTAGGTCCATGCTGACGGAAATCAAACAGGCGATCATGTGCGTATGTACTATGGA
GTTATGCGATGTCATTTTCCTTAACATGTTGCATGCATGTGTGTGTATCTAGGTGGCTAAGAGTGTGTTTTGTAATGCAGTTGGTGATGT
CTGAGGATTTTGTGAAGAGTTACTGATTTTACACTTATTGTGAATAAACCCTAAATAAATCTCCGGAAATAGAAAGGGAAAGGATAGGTG

>In-frame_ARID1B_ENST00000367148_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_8817nt
ATGGCCCATAACGCGGGCGCCGCGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGC
GCCGCCGCGCTGTCCTCCTCCTCCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAG
ACGGGGCTGCTCCCCAACCACAAACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCC
CACCACCACCACCACCATGCCCACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAG
CAACAGCAGCAGCAGCAGCAGCAGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCC
GGCCCCGACATGGAGCAGCCGCAACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGC
AAGCCGGGCGACGAGGACGACGCGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACG
CAGCAGCCGCCGGTCGCCGTGCCCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCG
AGCGGCGGCCCCGGCGGCCGCGCTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCC
GCCGCCGCCGCCGGGGCCCCCGGCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGC
TACAGCCGGCCCGGCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGA
GCAGGAGGAGCAGGAGCGGGAGCTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGC
TCGTCCGCGGGGTACGGGGTGCTGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTC
AGCAAGGCGGCCGCCGGCTCGGCGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAAT
CAGCTGCTCACCTCGCCCAGCCCCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCG
TCGCAGCCCCAGTCCCAGGCGGCGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGC
GCCCAGTACGCCGCTGCCAGCCCGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATG
GGCAGATCCCAGGGCAGCCCAATGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAG
CAGAGCAGTCCGTACCCAGGAGGTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATG
GCCGGAATGCAGTACCCTCAGCAGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGT
TTCTCCGACGTGTGCGAGAGGATGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACG
TCACTTCAGCTGCGGTCCCAGATCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCAT
AAATCAAACTCAGAAGACAGCTCTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAA
GGAATAATGAGACAGACTTCAAAAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAATG
ATGATGGTCAAAGAAAAGATGATCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTG
GACCCTGCTGACTGGCCAGATGGTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAG
GAGTCGGTGAAGTTTAAGAGGTTACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAA
CCCAGCACTGAAGGTGGGGAGGAGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAAG
CCCCTTTTCTTTGATGGCTCTCCTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACC
TGGGGGGCTGGCCGGAAGTTGGTCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTC
TCCTACCCAGAAGAAGAAAAGGCCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGGG
AGAACCTGCAGTTTTGGAGGATTTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGAC
TTTGTGTACAAAGAAGTCATCAAATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAG
AGAATGTCTAAAAAATACAGCAGCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGAC
CCCGAACACTTGGACAAGCCCAAGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGGT
CAAACAGTGAGCACCACTGATTCCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGC
CCGTTCTGCGGGCGTGCCAGGGTGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATC
GATATAATCAGCAAGCCACCCATGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCTC
AGTGAAGACGAGGAGAAACCCAAACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGAT
CGGATTAACCTAAAAGAGCACATGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTG
GATGAGTTAAATATCAGGGACCCGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCAG
TCAGGATCCCAGGAGAAGCTGCTCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAAC
CTGGAAAACGGCAAGACTCGGAAAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTG
GGCAATTACCCAACATTGCCTTTAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCA
GACACGTCCAAGAGCTGTGACCCACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGAG
ACCCTGGAGGGCCCCCAGACTGTGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTG
CCTACCGAGGTGACAGAACCGCCCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAG
CAAGACTCTGCTGTCGACAATGCATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGGC
TCAATCGCAGCCTCTGGTCGCGGCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTTA
GCAAGGACGCCTCTGGAGGGCCACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAG
CAGAGAATGCAGCCCAAAATTCCATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTT
CCCATGGGCCCCAGTGGGGCCCTCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAGC
GACTGTCCCCCAGCACTGGCTCCCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAG
CTCCCCGAGAACACAAGCCTCCAGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTA
GAAACGCTCACTGAAAACAAGCTGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCCT
GAAGCCCTGGTGCAGAGATACGCAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCTT
CGGAAGCAGCACCGCATGGCGATTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCA
GATTGGCTCATTTCCATCGGTCTGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCT
CACACTTGCCTTCAGGAGGCCGGCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGGC
CCTGAGGCCATGTAGCCAGGCCCGGAATGGGCCTCTCTGGACAAGAGCCACCCTTTCACTGTGCATATGATGCTGATGCAATTCCTCCAT
CATCTCTGGACGTGCAGACCAGATCCAGAAGAAAGGCCTGGCGTGTGGCCAAACAGCGTGAAACCTTGGCACAGGACTGAGGATCCTCTC
CTCCAGAAAAGCCCCCTCGAGGAAATAAATTAGTGCGGTTCTCTTTGACCCCCAAAGACAAGACAAGCACTTATTTTTATTTTCAGAAGA
CAAAAGAACCAAGATGCCAACTGGCTGCGAATGCTCTATCTCCAGTCTGTCTCTGTGTACTGGTAGAGGCTGGGAGGAGTAGGGGGCAGC
CTGTTCCATTTCTGATAGTGCCCTTGCTCTTCTGTCTGTCATCTTGCAGGATGCCCGAGGGCCAGATGGGCTTAGCTAGGCCAAAGTAAC
AGACTCAAGAGTTATTGTACATTACTGACCACGCTCATTTGTTCAAAAGTTAGAACATCTGGCTGCACCAGGAAAAAAAAAAAAAAAAAG
TCCTGTTCTTCTTTAGATAAACAAGAGACATTTTCATAATTGCTTTCTAGCAATCAGCTTTTATTTGCCTTAATATAAGCTTTTAAGCAG
TTATCTAACTAGTGTCCACAACCCTGTAACCATACTTCCACATCTTCAGCTTAGGCAGACATCGAACCTCTCTGGGATGTTTCCAGCAAA
AGTGAGCTTTTCTAATCGTCTCATTGTAACATGGCTTATTTTGTAGAGGTATTCATCAGCCACACACTTCATGTTGGTTTTTGGTTTTTA
AGCTAACTACAAATCTAGTAAAAAGCTATCTGAAATTCACAAATATCATGTGTGTGCGTGCGTGCGTGCGCGTGTGTGTCTGTATTCATA
GTGACTGCTTTTGGTTTTAACCAGTTTAGTATCGTTACTGTGTGGATCGTCGCGCTGCAGTATTGACTTGGAATCCTGACCATGTCCATC
CCAAAATTCAGTCCTCAGTTAACGGATCATGTTTGCAAAAGGTCACTGTGAGGCTGCATATTTCAGAAAGATGTCCTTAATAAGGGAAGT
CATGTATAAGATGTTTTCTAAAAGACTTTTCAGTATTACAACTAATACTATTATTATCCTTCTTTTTTTATTTAGATAATTCTTTTAATT
TAAACAAAGGTTCACTATGGAACCAGACAAATCTCATTAGCCATGTGTTAAGTATTTGCTACTTTAAATTGTTTTACAACTGATTTCAGC
ACATTCTATCCTTTTTTTTTTTTGAAATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAATGGCACGATCTTGGCTCACTGCAACCT
CAGTCTCCCAGGTTCAAGTGATTCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTATAGGCACCCACCACCACGCCCAGCTAATTTTTGT
ATTATTAGTAGAGACAGGGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCAACTCCTGACCTCAGGTGGTCCACCCGCCTCAGCCTCC
CAAAGTGCTGGGATTACAGGTGTGAGCCACCGCACCTGGCCTCTGTCCTCTTTTAGTCTAGTGTCTGGTTTTCTAGCAAACAGTAAATTT
AAACAAGTAAACTATTATGGTTTCCATTGCTTACAAAATGATTTTCCTTTACATTCTTATCATGAACACTATTTTAAGCATCAAATGCAA
TCATCTAAAATATAAAGGTCAATCATTTATAATAGAAACACCTTGACCACAAGCCCTTGATTGAACATTTTATAATATTTCATCTACTTA
TTAAAACAAATAATTTCCCTTGGGTTGGAGGGGAAGTGATTTCATAAATTAATTAGAAAGCCATCTTTAGCATATTGCTTATGTCTGGAT
CCATGTTTCTGAGGAAAAAGACATTCTCAGGTGATGTATTTTTTTCATGCATTAGTATGCATTTTTAAAAAATAATGCATGTTTCTTTAA
TAATTAATTTTCATCTTCTATAAGATGCCATGTGAAGAAGTTGTGGAAATGTAGAATAAAAAGCTAAAGCTGCCAAATTTCTGTTGAACT
CTTAAAAACAGCTCATGTTTGTTTGTCCTCTCGGGTTGTGGCCTAGCCTATTTGCAATGTAATGAAGCTGCAGGGTTCTTGTATAGCTAA
AGCGTTCAATGCATTTCACGTGCTGTGGTGGATGTGGGTGCTGTAGACAGGCTTCTTCTCTTCCTGCTCTCAAAATACCTCGGCTTGACA
TTTGGACAGATCCTGTCATTGTTTAAGCTGAGCAAAAAACCACACAAAAGTTGTGTAAGAGATGAGATAACAAAGGAGCGAGAGAAATCT
CATGTGAATTTCCAAGTTTTAATTCGTTCTCCATGAAGGATTTTCATTTCAGTGAAAGTCGCAGCAGAAGAGGGAACTTTCTGGAGTTTT
TGAGAATGCCAAACCACATTTTTATCACACTTCTTTGGAAATCAATGCCTTTGCATAGAAAATCAAATTCAGGGACCACAAAGAATTTTC
AGTGGGAATGTCTAGTCTGAGGGGTCTGAGGTTGTTTTTACTTTATTGTGTTGTTTAAATATTTTAAAAATATCTTTAGCGTTTGGTCTT
TTTTTTTTCTGTAAACATTTAATTTGGTCTGAGAAAAGCTGAATGTTTGGGTGTGACGTTTGACTGAGGTGGATTGGGGCTGCCTGTGGA
CATTAGTGAACAGGTGGTAGGCTTCAGGAATATCCAGTTTTAATCAGTTGCATTTGGTACAGAATTTTGAGTAATGGTGAAAATTGTTGT
CTTTGGAAAGCACAAAAGAAACCTGGAAAGGCAGTTCGGCTCAGGTAGCTACACATAACATTGTGTATGATTTTCACTTCAAAGCTGTCT
GGAAGGAAATGCAGTCAGCTCCAGCTAGTACTATTTATGTACCCAGATAACTAAGATATTGTTTCATGGCCTTGCCTTAGTCAGAGGCCC
TTTTCTCTGTCCTGAACCCCCAGGTATGGGTGAAATTGGAAATTACTAATCTATTGGAAATCAGTTCCTGACATAGTAAAGTTTGCTTTC
ATAACTGCAGCAAAAAAGGTCAACTTGCCAAGTCACTGCTGCCATGTGTGTACTGTATTATTTTCAGAAAAAAATATAATAGTCTGAGTC
CAAGTTATCTTGATTTAAAATTGATAGAGAAAAGAAACTGTCGAGCAAGTTATATAACAACTAACAACATTGCACTTTCTGTATATGAAA
TCAATATTTAAATAACTTATTTTTCTCCATTGCTGTTCTTAAAAACATTGTAAGTAGCTGTAATATACCAGTACCAATATGTTCTTGCAA
TTGCTTCAGCCCAAGAAAGCTGTGTATTGTTTTAAAAATTGTAAAAATTATTGTGATGATTCATTTAGCATAAAGAGAGGTGGACGGAAG

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367469_chr6_148711270_+_2232nt
CGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGCGCCGCCGCGCTGTCCTCCTCCT
CCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAGACGGGGCTGCTCCCCAACCACA
AACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCCCACCACCACCACCACCATGCCC
ACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGC
AGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCCGGCCCCGACATGGAGCAGCCGC
AACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGCAAGCCGGGCGACGAGGACGACG
CGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACGCAGCAGCCGCCGGTCGCCGTGC
CCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCGAGCGGCGGCCCCGGCGGCCGCG
CTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCCGCCGCCGCCGCCGGGGCCCCCG
GCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGCTACAGCCGGCCCGGCGCGGGCG
GCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGAGCAGGAGGAGCAGGAGCGGGAG
CTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGCTCGTCCGCGGGGTACGGGGTGC
TGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTCAGCAAGGCGGCCGCCGGCTCGG
CGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAATCAGCTGCTCACCTCGCCCAGCC
CCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCGTCGCAGCCCCAGTCCCAGGCGG
CGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGCGCCCAGTACGCCGCTGCCAGCC
CGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATGGGCAGATCCCAGGGCAGCCCAA
TGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAGCAGAGCAGTCCGTACCCAGGAG
GTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATGGCCGGAATGCAGTACCCTCAGC
AGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGTTTCTCCGACGTGTGCGAGAGGA
TGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACGTCACTTCAGCTGCGGTCCCAGA
TCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGTAAGTCTTTCTCCCTCTGCCCAGGACCACCTTCC
AAGAAGGTGTCTTTTAGGTCCATGCTGACGGAAATCAAACAGGCGATCATGTGCGTATGTACTATGGAGTTATGCGATGTCATTTTCCTT
AACATGTTGCATGCATGTGTGTGTATCTAGGTGGCTAAGAGTGTGTTTTGTAATGCAGTTGGTGATGTCTGAGGATTTTGTGAAGAGTTA

>In-frame_ARID1B_ENST00000275248_chr6_157150555_+_SASH1_ENST00000367467_chr6_148711270_+_8795nt
CGGCCGCCGCCGGCACCCACAGCGCCAAGAGCGGCGGCTCCGAGGCGGCTCTCAAGGAGGGTGGAAGCGCCGCCGCGCTGTCCTCCTCCT
CCTCCTCCTCCGCGGCGGCAGCGGCGGCATCCTCTTCCTCCTCGTCGGGCCCGGGCTCGGCCATGGAGACGGGGCTGCTCCCCAACCACA
AACTGAAAACCGTTGGCGAAGCCCCCGCCGCGCCGCCCCACCAGCAGCACCACCACCACCACCATGCCCACCACCACCACCACCATGCCC
ACCACCTCCACCACCACCACGCACTACAGCAGCAGCTAAACCAGTTCCAGCAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGC
AGCAACAGCAACATCCCATTTCCAACAACAACAGCTTGGGCGGCGCGGGCGGCGGCGCGCCTCAGCCCGGCCCCGACATGGAGCAGCCGC
AACATGGAGGCGCCAAGGACAGTGCTGCGGGCGGCCAGGCCGACCCCCCGGGCCCGCCGCTGCTGAGCAAGCCGGGCGACGAGGACGACG
CGCCGCCCAAGATGGGGGAGCCGGCGGGCGGCCGCTACGAGCACCCGGGCTTGGGCGCCCTGGGCACGCAGCAGCCGCCGGTCGCCGTGC
CCGGGGGCGGCGGCGGCCCGGCGGCCGTCCCGGAGTTTAATAATTACTATGGCAGCGCTGCCCCTGCGAGCGGCGGCCCCGGCGGCCGCG
CTGGGCCTTGCTTTGATCAACATGGCGGACAACAAAGCCCCGGGATGGGGATGATGCACTCCGCCTCCGCCGCCGCCGCCGGGGCCCCCG
GCAGCATGGACCCCCTGCAGAACTCCCACGAAGGGTACCCCAACAGCCAGTGCAACCATTATCCGGGCTACAGCCGGCCCGGCGCGGGCG
GCGGCGGCGGCGGCGGCGGCGGAGGAGGAGGAGGCAGCGGAGGAGGAGGAGGAGGAGGAGGAGCAGGAGCAGGAGGAGCAGGAGCGGGAG
CTGTGGCGGCGGCGGCCGCGGCGGCGGCGGCAGCAGCAGGAGGCGGCGGCGGCGGCGGCTATGGGGGCTCGTCCGCGGGGTACGGGGTGC
TGAGCTCCCCCCGGCAGCAGGGCGGCGGCATGATGATGGGCCCCGGGGGCGGCGGGGCCGCGAGCCTCAGCAAGGCGGCCGCCGGCTCGG
CGGCGGGGGGCTTCCAGCGCTTCGCCGGCCAGAACCAGCACCCGTCGGGGGCCACCCCGACCCTCAATCAGCTGCTCACCTCGCCCAGCC
CCATGATGCGGAGCTACGGCGGCAGCTACCCCGAGTACAGCAGCCCCAGCGCGCCGCCGCCGCCGCCGTCGCAGCCCCAGTCCCAGGCGG
CGGCGGCGGGGGCGGCGGCGGGCGGCCAGCAGGCGGCCGCGGGCATGGGCTTGGGCAAGGACATGGGCGCCCAGTACGCCGCTGCCAGCC
CGGCCTGGGCGGCCGCGCAACAAAGGAGTCACCCGGCGATGAGCCCCGGCACCCCCGGACCGACCATGGGCAGATCCCAGGGCAGCCCAA
TGGATCCAATGGTGATGAAGAGACCTCAGTTGTATGGCATGGGCAGTAACCCTCATTCTCAGCCTCAGCAGAGCAGTCCGTACCCAGGAG
GTTCCTATGGCCCTCCAGGCCCACAGCGGTATCCAATTGGCATCCAGGGTCGGACTCCCGGGGCCATGGCCGGAATGCAGTACCCTCAGC
AGCAGGACGGTTCACTGGGAAACATCGATGACCTGGCGCAGCAGTATGCAGATTATTACAACACCTGTTTCTCCGACGTGTGCGAGAGGA
TGGAGGAGCTGCGGAAACGGCGGGTTTCCCAGGACCTGGAAGTGGAGAAACCCGATGCTAGCCCCACGTCACTTCAGCTGCGGTCCCAGA
TCGAAGAGTCGCTTGGCTTCTGTAGCGCCGTGTCAACCCCAGAAGTGGAAAGAAAGAACCCTCTTCATAAATCAAACTCAGAAGACAGCT
CTGTAGGAAAAGGAGACTGGAAGAAGAAAAATAAGTATTTCTGGCAGAACTTCCGAAAGAACCAGAAAGGAATAATGAGACAGACTTCAA
AAGGAGAAGACGTTGGTTATGTTGCCAGTGAAATAACGATGAGCGATGAGGAGCGGATTCAGCTAATGATGATGGTCAAAGAAAAGATGA
TCACAATTGAGGAAGCACTTGCTAGGCTCAAGGAATACGAGGCCCAGCACCGGCAGTCGGCTGCCCTGGACCCTGCTGACTGGCCAGATG
GTTCTTACCCAACGTTTGATGGCTCATCAAACTGCAATTCAAGAGAACAATCGGATGATGAGACTGAGGAGTCGGTGAAGTTTAAGAGGT
TACACAAGCTGGTAAACTCCACTCGCAGAGTCAGAAAGAAACTAATTAGGGTGGAAGAAATGAAAAAACCCAGCACTGAAGGTGGGGAGG
AGCACGTGTTTGAGAATTCGCCGGTCCTGGATGAACGGTCCGCCCTCTACTCTGGCGTGCACAAGAAGCCCCTTTTCTTTGATGGCTCTC
CTGAGAAACCTCCCGAAGATGACTCAGACTCTCTCACCACGTCTCCATCCTCCAGCAGCCTGGACACCTGGGGGGCTGGCCGGAAGTTGG
TCAAAACCTTCAGCAAAGGAGAGAGCCGGGGCCTGATTAAGCCCCCCAAGAAGATGGGGACATTCTTCTCCTACCCAGAAGAAGAAAAGG
CCCAGAAAGTGTCCCGCTCCCTCACCGAGGGGGAGATGAAGAAGGGTCTCGGGTCCCTAAGCCACGGGAGAACCTGCAGTTTTGGAGGAT
TTGACTTGACGAATCGCTCTCTGCACGTTGGCAGTAATAATTCTGACCCAATGGGTAAAGAAGGAGACTTTGTGTACAAAGAAGTCATCA
AATCACCTACTGCCTCTCGCATCTCTCTTGGGAAAAAGGTGAAATCAGTGAAAGAGACGATGAGAAAGAGAATGTCTAAAAAATACAGCA
GCTCTGTCTCTGAGCAGGACTCGGGCCTTGATGGAATGCCTGGCTCCCCTCCGCCTTCACAGCCCGACCCCGAACACTTGGACAAGCCCA
AGCTCAAGGCCGGGGGTTCTGTAGAAAGTCTTCGCAGTTCTCTCAGTGGGCAGAGCTCCATGAGCGGTCAAACAGTGAGCACCACTGATT
CCTCAACCAGCAACCGGGAAAGCGTCAAGTCGGAAGATGGGGATGACGAAGAGCCGCCTTACCGAGGCCCGTTCTGCGGGCGTGCCAGGG
TGCACACCGACTTCACCCCCAGTCCCTATGACACAGACTCACTCAAGCTCAAGAAAGGAGATATCATCGATATAATCAGCAAGCCACCCA
TGGGGACCTGGATGGGCCTGCTGAACAACAAAGTCGGCACGTTCAAGTTCATCTACGTGGACGTGCTCAGTGAAGACGAGGAGAAACCCA
AACGCCCCACCAGGAGGCGTCGGAAAGGACGACCACCCCAGCCCAAGTCTGTGGAGGATCTCCTGGATCGGATTAACCTAAAAGAGCACA
TGCCCACTTTCCTGTTCAATGGATATGAAGATTTGGACACCTTTAAGCTGCTGGAGGAGGAAGACTTGGATGAGTTAAATATCAGGGACC
CGGAACACAGAGCTGTTCTCTTGACAGCAGTGGAGCTGTTACAAGAGTATGACAGTAACAGCGACCAGTCAGGATCCCAGGAGAAGCTGC
TCGTTGACAGCCAGGGCCTGAGTGGATGCTCACCCCGAGACTCAGGATGCTACGAAAGCAGTGAGAACCTGGAAAACGGCAAGACTCGGA
AAGCTAGCCTCCTATCTGCCAAGTCATCCACCGAGCCCAGCTTGAAGTCTTTTAGCAGAAACCAGTTGGGCAATTACCCAACATTGCCTT
TAATGAAATCAGGGGATGCACTGAAGCAGGGACAGGAGGAGGGCAGGCTGGGTGGTGGCCTTGCCCCAGACACGTCCAAGAGCTGTGACC
CACCTGGTGTGACTGGTTTGAATAAAAACCGAAGAAGCCTCCCAGTTTCCATCTGCCGGAGCTGTGAGACCCTGGAGGGCCCCCAGACTG
TGGACACTTGGCCCCGATCCCATTCCCTGGATGACCTTCAAGTGGAGCCTGGTGCTGAGCAAGACGTGCCTACCGAGGTGACAGAACCGC
CCCCTCAGATTGTACCTGAAGTGCCACAGAAGACGACCGCCTCTTCCACGAAGGCCCAGCCCCTGGAGCAAGACTCTGCTGTCGACAATG
CATTGCTACTGACCCAAAGCAAGAGATTTTCTGAACCTCAGAAATTGACAACTAAGAAACTGGAGGGCTCAATCGCAGCCTCTGGTCGCG
GCCTGTCACCCCCTCAGTGTTTGCCCAGAAACTATGATGCTCAGCCTCCTGGAGCTAAACACGGTTTAGCAAGGACGCCTCTGGAGGGCC
ACAGAAAAGGACACGAGTTTGAAGGAACACACCATCCCCTGGGCACCAAAGAAGGGGTAGATGCTGAGCAGAGAATGCAGCCCAAAATTC
CATCACAGCCTCCACCTGTTCCTGCCAAAAAGAGCAGAGAACGCCTTGCTAACGGACTCCACCCTGTTCCCATGGGCCCCAGTGGGGCCC
TCCCCAGTCCCGATGCGCCATGCCTGCCAGTGAAAAGGGGCAGCCCCGCCAGCCCCACCAGCCCTAGCGACTGTCCCCCAGCACTGGCTC
CCAGGCCTCTCTCAGGGCAGGCGCCTGGCAGCCCACCAAGCACAAGGCCGCCCCCCTGGCTCTCAGAGCTCCCCGAGAACACAAGCCTCC
AGGAGCACGGTGTGAAGCTGGGCCCGGCTTTGACCAGGAAGGTCTCCTGTGCCCGGGGAGTGGATCTAGAAACGCTCACTGAAAACAAGC
TGCACGCTGAAGGCATCGATCTCACGGAGGAGCCGTATTCTGATAAGCATGGCCGCTGTGGGATTCCTGAAGCCCTGGTGCAGAGATACG
CAGAGGACTTGGATCAGCCCGAGCGGGACGTCGCCGCCAACATGGACCAGATCCGGGTGAAGCAGCTTCGGAAGCAGCACCGCATGGCGA
TTCCAAGTGGTGGACTCACGGAAATCTGCCGAAAGCCCGTCTCTCCTGGGTGCATTTCGTCTGTGTCAGATTGGCTCATTTCCATCGGTC
TGCCCATGTACGCCGGCACCCTCTCCACCGCGGGCTTCAGCACACTGAGCCAAGTGCCTTCTCTGTCTCACACTTGCCTTCAGGAGGCCG
GCATCACAGAGGAGAGACACATAAGAAAGCTCCTATCTGCAGCCAGACTCTTCAAACTGCCGCCAGGCCCTGAGGCCATGTAGCCAGGCC
CGGAATGGGCCTCTCTGGACAAGAGCCACCCTTTCACTGTGCATATGATGCTGATGCAATTCCTCCATCATCTCTGGACGTGCAGACCAG
ATCCAGAAGAAAGGCCTGGCGTGTGGCCAAACAGCGTGAAACCTTGGCACAGGACTGAGGATCCTCTCCTCCAGAAAAGCCCCCTCGAGG
AAATAAATTAGTGCGGTTCTCTTTGACCCCCAAAGACAAGACAAGCACTTATTTTTATTTTCAGAAGACAAAAGAACCAAGATGCCAACT
GGCTGCGAATGCTCTATCTCCAGTCTGTCTCTGTGTACTGGTAGAGGCTGGGAGGAGTAGGGGGCAGCCTGTTCCATTTCTGATAGTGCC
CTTGCTCTTCTGTCTGTCATCTTGCAGGATGCCCGAGGGCCAGATGGGCTTAGCTAGGCCAAAGTAACAGACTCAAGAGTTATTGTACAT
TACTGACCACGCTCATTTGTTCAAAAGTTAGAACATCTGGCTGCACCAGGAAAAAAAAAAAAAAAAAGTCCTGTTCTTCTTTAGATAAAC
AAGAGACATTTTCATAATTGCTTTCTAGCAATCAGCTTTTATTTGCCTTAATATAAGCTTTTAAGCAGTTATCTAACTAGTGTCCACAAC
CCTGTAACCATACTTCCACATCTTCAGCTTAGGCAGACATCGAACCTCTCTGGGATGTTTCCAGCAAAAGTGAGCTTTTCTAATCGTCTC
ATTGTAACATGGCTTATTTTGTAGAGGTATTCATCAGCCACACACTTCATGTTGGTTTTTGGTTTTTAAGCTAACTACAAATCTAGTAAA
AAGCTATCTGAAATTCACAAATATCATGTGTGTGCGTGCGTGCGTGCGCGTGTGTGTCTGTATTCATAGTGACTGCTTTTGGTTTTAACC
AGTTTAGTATCGTTACTGTGTGGATCGTCGCGCTGCAGTATTGACTTGGAATCCTGACCATGTCCATCCCAAAATTCAGTCCTCAGTTAA
CGGATCATGTTTGCAAAAGGTCACTGTGAGGCTGCATATTTCAGAAAGATGTCCTTAATAAGGGAAGTCATGTATAAGATGTTTTCTAAA
AGACTTTTCAGTATTACAACTAATACTATTATTATCCTTCTTTTTTTATTTAGATAATTCTTTTAATTTAAACAAAGGTTCACTATGGAA
CCAGACAAATCTCATTAGCCATGTGTTAAGTATTTGCTACTTTAAATTGTTTTACAACTGATTTCAGCACATTCTATCCTTTTTTTTTTT
TGAAATGGAGTTTCGCTCTTGTCACCCAGGCTGGAGTGCAATGGCACGATCTTGGCTCACTGCAACCTCAGTCTCCCAGGTTCAAGTGAT
TCTCCTGCCTTAGCCTCCCGAGTAGCTGGGATTATAGGCACCCACCACCACGCCCAGCTAATTTTTGTATTATTAGTAGAGACAGGGTTT
CACCATGTTGGCCAGGCTGGTCTCAAACTCAACTCCTGACCTCAGGTGGTCCACCCGCCTCAGCCTCCCAAAGTGCTGGGATTACAGGTG
TGAGCCACCGCACCTGGCCTCTGTCCTCTTTTAGTCTAGTGTCTGGTTTTCTAGCAAACAGTAAATTTAAACAAGTAAACTATTATGGTT
TCCATTGCTTACAAAATGATTTTCCTTTACATTCTTATCATGAACACTATTTTAAGCATCAAATGCAATCATCTAAAATATAAAGGTCAA
TCATTTATAATAGAAACACCTTGACCACAAGCCCTTGATTGAACATTTTATAATATTTCATCTACTTATTAAAACAAATAATTTCCCTTG
GGTTGGAGGGGAAGTGATTTCATAAATTAATTAGAAAGCCATCTTTAGCATATTGCTTATGTCTGGATCCATGTTTCTGAGGAAAAAGAC
ATTCTCAGGTGATGTATTTTTTTCATGCATTAGTATGCATTTTTAAAAAATAATGCATGTTTCTTTAATAATTAATTTTCATCTTCTATA
AGATGCCATGTGAAGAAGTTGTGGAAATGTAGAATAAAAAGCTAAAGCTGCCAAATTTCTGTTGAACTCTTAAAAACAGCTCATGTTTGT
TTGTCCTCTCGGGTTGTGGCCTAGCCTATTTGCAATGTAATGAAGCTGCAGGGTTCTTGTATAGCTAAAGCGTTCAATGCATTTCACGTG
CTGTGGTGGATGTGGGTGCTGTAGACAGGCTTCTTCTCTTCCTGCTCTCAAAATACCTCGGCTTGACATTTGGACAGATCCTGTCATTGT
TTAAGCTGAGCAAAAAACCACACAAAAGTTGTGTAAGAGATGAGATAACAAAGGAGCGAGAGAAATCTCATGTGAATTTCCAAGTTTTAA
TTCGTTCTCCATGAAGGATTTTCATTTCAGTGAAAGTCGCAGCAGAAGAGGGAACTTTCTGGAGTTTTTGAGAATGCCAAACCACATTTT
TATCACACTTCTTTGGAAATCAATGCCTTTGCATAGAAAATCAAATTCAGGGACCACAAAGAATTTTCAGTGGGAATGTCTAGTCTGAGG
GGTCTGAGGTTGTTTTTACTTTATTGTGTTGTTTAAATATTTTAAAAATATCTTTAGCGTTTGGTCTTTTTTTTTTCTGTAAACATTTAA
TTTGGTCTGAGAAAAGCTGAATGTTTGGGTGTGACGTTTGACTGAGGTGGATTGGGGCTGCCTGTGGACATTAGTGAACAGGTGGTAGGC
TTCAGGAATATCCAGTTTTAATCAGTTGCATTTGGTACAGAATTTTGAGTAATGGTGAAAATTGTTGTCTTTGGAAAGCACAAAAGAAAC
CTGGAAAGGCAGTTCGGCTCAGGTAGCTACACATAACATTGTGTATGATTTTCACTTCAAAGCTGTCTGGAAGGAAATGCAGTCAGCTCC
AGCTAGTACTATTTATGTACCCAGATAACTAAGATATTGTTTCATGGCCTTGCCTTAGTCAGAGGCCCTTTTCTCTGTCCTGAACCCCCA
GGTATGGGTGAAATTGGAAATTACTAATCTATTGGAAATCAGTTCCTGACATAGTAAAGTTTGCTTTCATAACTGCAGCAAAAAAGGTCA
ACTTGCCAAGTCACTGCTGCCATGTGTGTACTGTATTATTTTCAGAAAAAAATATAATAGTCTGAGTCCAAGTTATCTTGATTTAAAATT
GATAGAGAAAAGAAACTGTCGAGCAAGTTATATAACAACTAACAACATTGCACTTTCTGTATATGAAATCAATATTTAAATAACTTATTT
TTCTCCATTGCTGTTCTTAAAAACATTGTAAGTAGCTGTAATATACCAGTACCAATATGTTCTTGCAATTGCTTCAGCCCAAGAAAGCTG
TGTATTGTTTTAAAAATTGTAAAAATTATTGTGATGATTCATTTAGCATAAAGAGAGGTGGACGGAAGGGTTTTCCTATGTATCAAAACT


Top

FusionGenePPI for ARID1B_SASH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARID1BSMARCA4, SMARCB1, SMARCA2, KDM5B, CUL2, SMARCC2, SMARCC1, HIST2H2BE, TCEB1, RBX1, ARID1A, SMARCA1, SMARCD1, PRMT5, SMAD2, SMARCE1, CAND1, ACTL6A, EPAS1, SMAD9, YAP1, QPRT, DPF3, DPF2, SS18, SMARCD2, SMARCD3, BCL7A, BCL7B, BCL7C, KRAS, B9D2, SPICE1, STIL, PCGF1, NANOG, POU5F1, EYA2, NAGK, NR3C1, AR, TRIM25SASH1SFN, SUV39H2, KHDRBS1, SKIL, IRAK1, IRAK4, MYD88, MAP3K7, IKBKB, CHUK, IKBKG, ESR1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARID1B_SASH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARID1B_SASH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARID1BC0265338Coffin-Siris syndrome2CTD_human;ORPHANET
HgeneARID1BC0027819Neuroblastoma1CTD_human
HgeneARID1BC2239176Liver carcinoma1CTD_human