FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26320

FusionGeneSummary for PC_ACTN4

check button Fusion gene summary
Fusion gene informationFusion gene name: PC_ACTN4
Fusion gene ID: 26320
HgeneTgene
Gene symbol

PC

ACTN4

Gene ID

5420

81

Gene namepodocalyxin likeactinin alpha 4
SynonymsGp200|PC|PCLP|PCLP-1ACTININ-4|FSGS|FSGS1
Cytomap

7q32.3

19q13.2

Type of geneprotein-codingprotein-coding
DescriptionpodocalyxinGCTM-2 antigenpodocalyxin-like protein 1alpha-actinin-4focal segmental glomerulosclerosis 1non-muscle alpha-actinin 4
Modification date2018052720180522
UniProtAcc

P11498

O43707

Ensembl transtripts involved in fusion geneENST00000393958, ENST00000393960, 
ENST00000355677, ENST00000524491, 
ENST00000529047, ENST00000393955, 
ENST00000528224, 
ENST00000252699, 
ENST00000424234, ENST00000390009, 
ENST00000497637, 
Fusion gene scores* DoF score15 X 6 X 7=63019 X 14 X 7=1862
# samples 1520
** MAII scorelog2(15/630*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1862*10)=-3.21878116778407
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PC [Title/Abstract] AND ACTN4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgenePC

GO:0030335

positive regulation of cell migration

18456258

HgenePC

GO:0033634

positive regulation of cell-cell adhesion mediated by integrin

18456258

TgeneACTN4

GO:0035357

peroxisome proliferator activated receptor signaling pathway

22351778

TgeneACTN4

GO:0048384

retinoic acid receptor signaling pathway

22351778

TgeneACTN4

GO:0051272

positive regulation of cellular component movement

9508771


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-BC-A10T-01APCchr11

66631245

-ACTN4chr19

39191240

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000393958ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
Frame-shitENST00000393958ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393958ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393958ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
In-frameENST00000393960ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
In-frameENST00000393960ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393960ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393960ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
Frame-shitENST00000355677ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
Frame-shitENST00000355677ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000355677ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000355677ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
Frame-shitENST00000524491ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
Frame-shitENST00000524491ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000524491ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000524491ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
intron-3CDSENST00000529047ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
intron-3CDSENST00000529047ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
intron-intronENST00000529047ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
intron-intronENST00000529047ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
In-frameENST00000393955ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
In-frameENST00000393955ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393955ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
5CDS-intronENST00000393955ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+
intron-3CDSENST00000528224ENST00000252699PCchr11

66631245

-ACTN4chr19

39191240

+
intron-3CDSENST00000528224ENST00000424234PCchr11

66631245

-ACTN4chr19

39191240

+
intron-intronENST00000528224ENST00000390009PCchr11

66631245

-ACTN4chr19

39191240

+
intron-intronENST00000528224ENST00000497637PCchr11

66631245

-ACTN4chr19

39191240

+

Top

FusionProtFeatures for PC_ACTN4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PC

P11498

ACTN4

O43707

Pyruvate carboxylase catalyzes a 2-step reaction,involving the ATP-dependent carboxylation of the covalentlyattached biotin in the first step and the transfer of the carboxylgroup to pyruvate in the second. Catalyzes in a tissue specificmanner, the initial reactions of glucose (liver, kidney) and lipid(adipose tissue, liver, brain) synthesis from pyruvate. F-actin cross-linking protein which is thought to anchoractin to a variety of intracellular structures. This is a bundlingprotein (Probable). Probably involved in vesicular trafficking viaits association with the CART complex. The CART complex isnecessary for efficient transferrin receptor recycling but not forEGFR degradation (PubMed:15772161). Involved in tight junctionassembly in epithelial cells probably through interaction withMICALL2. Links MICALL2 to the actin cytoskeleton and recruits itto the tight junctions (By similarity). May also function as atranscriptional coactivator, stimulating transcription mediated bythe nuclear hormone receptors PPARG and RARA (PubMed:22351778).{ECO:0000250|UniProtKB:P57780, ECO:0000269|PubMed:15772161,ECO:0000269|PubMed:22351778, ECO:0000305|PubMed:9508771}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for PC_ACTN4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_1314aa
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLETKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEATLIGRGL
APVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAATGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQTGNILHLYERDCSIQRR
HQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEF
RVRGVKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGN
AKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPTKNVNVQNFHISWKDGLAFNALIHRHRPELIETDKLRKDDPVTNLNNAF
EVAEKYLDIPKMLDAEDIVNTARPDEKAIMTTVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLED
RVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRL
ERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKI
CDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAIL
AIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIE
MNGTLEDQLSHLKQTERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNTTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQ
EFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGD

>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_924aa
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLETKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEATLIGRGL
APVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAATGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQTGNILHLYERDCSIQRR
HQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEF
RVRGVKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVHELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQ
LHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQI
INSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQTERSIVDYKPNLDLLE
QQHQLIQEALIFDNKHTNTTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLG
YDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQG

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_1314aa
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLETKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEATLIGRGL
APVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAATGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQTGNILHLYERDCSIQRR
HQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEF
RVRGVKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGN
AKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPTKNVNVQNFHISWKDGLAFNALIHRHRPELIETDKLRKDDPVTNLNNAF
EVAEKYLDIPKMLDAEDIVNTARPDEKAIMTTVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLED
RVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRL
ERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKI
CDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAIL
AIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIE
MNGTLEDQLSHLKQTERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNTTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQ
EFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGD

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_924aa
MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLETKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEATLIGRGL
APVQAYLHIPDIIKVAKENNVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDAPITSLHEA
HEFSNTYGFPIIFKAATGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQTGNILHLYERDCSIQRR
HQKVVEIAPAAHLDPQLRTRLTSDSVKLAKQVGYENAGTVEFLVDRHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVAEGRSLPDL
GLRQENIRINGCAIQCRVTTEDPARSFQPDTGRIEVFRSGEGMGIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEF
RVRGVKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVHELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQ
LHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQI
INSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQTERSIVDYKPNLDLLE
QQHQLIQEALIFDNKHTNTTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLG
YDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_3942nt
ATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGG
CGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGC
ATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTG
GCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTC
CTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGA
GACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCC
CACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTAC
GAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAG
AAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGG
CACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAA
CAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAG
GTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTG
GGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGAC
ACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCC
CACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTC
CGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTC
CGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTCATATCAGGGGAGCGGTTACCTAAGCCGGAGCGGGGGAAGATGAGAGTGCACAAA
ATCAACAATGTGAACAAAGCGCTGGACTTTATTGCCAGCAAAGGCGTCAAGCTGGTCTCCATCGGGGCAGAAGAGATTGTGGACGGCAAC
GCAAAGATGACCCTGGGAATGATCTGGACCATCATCCTTAGGTTCGCCATCCAGGACATCTCCGTGGAAGAGACCTCGGCCAAGGAAGGG
CTCCTTCTCTGGTGCCAGAGAAAGACAGCCCCGTATAAGAACGTCAATGTGCAGAACTTCCACATCAGCTGGAAGGATGGTCTTGCCTTC
AATGCCCTGATCCACCGGCACAGACCAGAGCTGATTGAGTATGACAAGCTGAGGAAGGACGACCCTGTCACCAACCTGAACAATGCCTTC
GAAGTGGCTGAGAAATACCTCGACATCCCCAAGATGCTGGATGCAGAGGACATCGTGAACACGGCCCGGCCCGACGAGAAGGCCATAATG
ACCTATGTGTCCAGCTTCTACCATGCCTTTTCAGGAGCGCAGAAGGCTGAAACTGCCGCCAACCGGATCTGTAAGGTGCTGGCTGTCAAC
CAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGCTGGCCAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGAC
CGTGTGCCCCAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGACTTCCGCGACTACCGGCGTGTGCACAAGCCGCCCAAGGTGCAG
GAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAG
ATGGTCTCGGACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAGAAGGGCTACGAGGAGTGGCTGCTGAATGAGATCCGCAGGCTG
GAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGAAGGCCTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCAC
CGGGACTACGAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGCAAGCACGAGGCCTTCGAGAGCGACCTGGCTGCGCACCAGGAC
CGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCAACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATC
TGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAG
CTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCAT
ACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTG
GCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATC
ATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAG
CACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAG
ATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAG
CAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAG
CTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAG
GAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGC
TACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTC
CAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGAC
AAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGC

>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_2772nt
ATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGG
CGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGC
ATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTG
GCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTC
CTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGA
GACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCC
CACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTAC
GAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAG
AAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGG
CACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAA
CAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAG
GTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTG
GGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGAC
ACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCC
CACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTC
CGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTC
CGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTTCACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATC
TGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAG
CTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCAT
ACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTG
GCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATC
ATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAG
CACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAG
ATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAG
CAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAG
CTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAG
GAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGC
TACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTC
CAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGAC
AAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGC

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_3942nt
ATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGG
CGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGC
ATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTG
GCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTC
CTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGA
GACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCC
CACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTAC
GAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAG
AAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGG
CACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAA
CAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAG
GTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTG
GGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGAC
ACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCC
CACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTC
CGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTC
CGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTCATATCAGGGGAGCGGTTACCTAAGCCGGAGCGGGGGAAGATGAGAGTGCACAAA
ATCAACAATGTGAACAAAGCGCTGGACTTTATTGCCAGCAAAGGCGTCAAGCTGGTCTCCATCGGGGCAGAAGAGATTGTGGACGGCAAC
GCAAAGATGACCCTGGGAATGATCTGGACCATCATCCTTAGGTTCGCCATCCAGGACATCTCCGTGGAAGAGACCTCGGCCAAGGAAGGG
CTCCTTCTCTGGTGCCAGAGAAAGACAGCCCCGTATAAGAACGTCAATGTGCAGAACTTCCACATCAGCTGGAAGGATGGTCTTGCCTTC
AATGCCCTGATCCACCGGCACAGACCAGAGCTGATTGAGTATGACAAGCTGAGGAAGGACGACCCTGTCACCAACCTGAACAATGCCTTC
GAAGTGGCTGAGAAATACCTCGACATCCCCAAGATGCTGGATGCAGAGGACATCGTGAACACGGCCCGGCCCGACGAGAAGGCCATAATG
ACCTATGTGTCCAGCTTCTACCATGCCTTTTCAGGAGCGCAGAAGGCTGAAACTGCCGCCAACCGGATCTGTAAGGTGCTGGCTGTCAAC
CAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGCTGGCCAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGAC
CGTGTGCCCCAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGACTTCCGCGACTACCGGCGTGTGCACAAGCCGCCCAAGGTGCAG
GAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAG
ATGGTCTCGGACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAGAAGGGCTACGAGGAGTGGCTGCTGAATGAGATCCGCAGGCTG
GAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGAAGGCCTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCAC
CGGGACTACGAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGCAAGCACGAGGCCTTCGAGAGCGACCTGGCTGCGCACCAGGAC
CGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCAACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATC
TGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAG
CTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCAT
ACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTG
GCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATC
ATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAG
CACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAG
ATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAG
CAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAG
CTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAG
GAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGC
TACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTC
CAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGAC
AAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGC

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_2772nt
ATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGG
CGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGC
ATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTG
GCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTC
CTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGA
GACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCC
CACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTAC
GAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAG
AAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGG
CACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAA
CAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAG
GTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTG
GGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGAC
ACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCC
CACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTC
CGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTC
CGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTTCACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATC
TGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAG
CTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCAT
ACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTG
GCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATC
ATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAG
CACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAG
ATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAG
CAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAG
CTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAG
GAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGC
TACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTC
CAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGAC
AAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_6375nt
GTCAGTGGAGGCAGCAGCGGTAGAGGCGGCGGCGAGGACTGGCGACGGCGAGGAGCTGCCTTCTAGTCTCACCTGTGGACACTTTGCCAA
AGGAGTCGGGCCTGACGGTGGAAGATGGGAAATGGCCAAAAGAATAAACCATTTCCTCTTACTTACCGAATGAAAAGCTTGCTTCATCTT
GGCGTTCAAGACTCTCTAATATGATTCCACCTGTTGGGCTCTTTCTTCCATTTGCCTCCGCAGATAGTGTCTGCCTTCTGGAGAGCTGAC
CAAACACTAAGGATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCC
CCAAATGTCCGGCGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGC
ACGGAGCTGGGCATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATC
GGCCGCGGCCTGGCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCT
GGCTACGGGTTCCTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTC
CGCAAGATGGGAGACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCC
CTGCATGAGGCCCACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTG
GTGCACAGCTACGAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAG
AAGTTCATCGAGAAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCC
ATCCAGCGGCGGCACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTG
AAACTCGCTAAACAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAAC
TCCCGCCTGCAGGTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGC
CTACCCGACCTGGGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGC
TTCCAGCCGGACACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCC
GTCATCTCGCCCCACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCC
CTTGCGGAGTTCCGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATT
GATGAGGACTTCCGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTCATATCAGGGGAGCGGTTACCTAAGCCGGAGCGGGGGAAGATG
AGAGTGCACAAAATCAACAATGTGAACAAAGCGCTGGACTTTATTGCCAGCAAAGGCGTCAAGCTGGTCTCCATCGGGGCAGAAGAGATT
GTGGACGGCAACGCAAAGATGACCCTGGGAATGATCTGGACCATCATCCTTAGGTTCGCCATCCAGGACATCTCCGTGGAAGAGACCTCG
GCCAAGGAAGGGCTCCTTCTCTGGTGCCAGAGAAAGACAGCCCCGTATAAGAACGTCAATGTGCAGAACTTCCACATCAGCTGGAAGGAT
GGTCTTGCCTTCAATGCCCTGATCCACCGGCACAGACCAGAGCTGATTGAGTATGACAAGCTGAGGAAGGACGACCCTGTCACCAACCTG
AACAATGCCTTCGAAGTGGCTGAGAAATACCTCGACATCCCCAAGATGCTGGATGCAGAGGACATCGTGAACACGGCCCGGCCCGACGAG
AAGGCCATAATGACCTATGTGTCCAGCTTCTACCATGCCTTTTCAGGAGCGCAGAAGGCTGAAACTGCCGCCAACCGGATCTGTAAGGTG
CTGGCTGTCAACCAAGAGAACGAGCACCTGATGGAGGACTACGAGAAGCTGGCCAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCC
TGGCTGGAGGACCGTGTGCCCCAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGACTTCCGCGACTACCGGCGTGTGCACAAGCCG
CCCAAGGTGCAGGAGAAGTGCCAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCC
TCCGAGGGCAAGATGGTCTCGGACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAGAAGGGCTACGAGGAGTGGCTGCTGAATGAG
ATCCGCAGGCTGGAGCGGCTCGACCACCTGGCAGAGAAGTTCCGGCAGAAGGCCTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCC
ATGCTGAAGCACCGGGACTACGAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGCAAGCACGAGGCCTTCGAGAGCGACCTGGCT
GCGCACCAGGACCGCGTGGAGCAGATCGCCGCCATTGCCCAGGAGCTCAACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGG
TGCCAGAAGATCTGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAG
GCCATCGACCAGCTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATG
TTCATCGTCCATACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGC
GAGGCCATCCTGGCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTC
ACCCCGCAAATCATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAG
CAGTCCAACGAGCACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGC
ATCTCCATTGAGATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTG
GACCTGCTGGAGCAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTG
GGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAG
GAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTC
ATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGC
CTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTC
TTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCG
CCATACCAGGGCCCTGACGCCGTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCC
AGAGACCTGACCCAACACCCCCGACGGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTATCTATGCAAAGCA
CTCTCTGCAGTCCTCCGGGGTGGGTGGGTGGGCAGGGAGGGGCTGGGGCAGGCTCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTT
CCCCCGACCAGGTTGGGGAGACTTGGGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAACCAAGGAGGGGCC
AGTGGATTCCCACAGCACAACCGGTCCCTTCCATGCCCTGGGATGCCTCACCACACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAA
GGCCTCCCCAATCCAGGCCAAAGCCCCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGCGCCACCACCACC
TGACGGCTGGGGACCCACCCAGCCCCTCTCCCCTCTCTGCTCCAGACTCACTTGCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCT
TTTGCAGCAGAGGAGCTGAGTTGGCAGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTGTCTGGCCTCACG
TGTCTCAGATTTTCTAAGAACCAAAAAAAAAAAAGGAAAAAAAACACAAAACAACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAA
AAACTATAAAAAAGAAAGAATTAAAAACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAATATATATTCACC
TAGCAACATATCTCTGCCGTCTCTCCTGCTCTCATAATGAAGACATAGCCGATTCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTC
TGCGTCGGGCGTGGGTCTCTGGGGACCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTTTTGCTCCCCCTA
CCTTTTTTTTTTGAGTTTATTCTGATTGATTTTTTTTCTTGGTTTCTGGATAAACCACCCTCTGGGGACAGGATAATAAAACATGTAATA
TTTTTAAGAAGGATTCCTGCAGCATCATCTTTTTTTATTTCTCCTGTGTCTGTCCTCCACCTTCTAGGAGAGCCAGGGCAGAGCTAGCAC
TGTCTTAAGCTGTCAACGTGGACTAGCTCGTGTCATCTGCTCGAGAAGGGCTGTCGCTGTTCTTGTTTCTGAGTGAGGAGTACGCAGGCC
AGAGTGGTCACCCGGCCGTGAGCAGTGAGGGCCAGAGACTAGCCCCAGACAGGTGGATGCCAGAGAGAGTGGCACCCATGCCAGGCAAGG
CCTAGGGAGGTGGTCTTGCTCAGCAACCCTGCCCTGAGCAGCAGGTGCGCCCATCCGGAGATCCTAGGAGAAGGTGGCCACCTCCATCCA
CTAAGGAAGAGAAGGAAGACAGTGGCTTGAGGCAGGGAGCTCGCAGGACAGAGCCTGAGCCACCCTGTCCCTCCCACCTGGCTCACCTGT
CTGTGGGTCAGGCAGATGACCCCCTCACCCCCATCCAGGTGCTGGCTGCAGTGGCCTGTGCAGAGAGGGGCAGGGTGAGTGCCCACCAGT
CCCCGTACCCCTTCCCCCCATGCCCCACCATGCCGGGGTGGTACTCACAGAAGATGCAGGTGAGGTGGGCCACACAGGACACGAACCGCT
CGAAGTCCACACGCAGACGGCTATCCCGGTAGCGGCTGGTGAGGGTCTGGGTCAGCTGGTTGTTCAGGTGGAAGCCTAGGGGGAGGCTGC
TTCTGAGCCCAGTGGCCCACAGGGAACCCACCTTGGCATTGCATCCCCACCCCACCTCCTCAGGGAGGACATGAATGCCACAGGGTGTCA
CACCCCAACTCTGCCCCATCCCGGCAGGGTGAGTACAGGCTGATCCCTTCAATCCTCTGGGCCTGTTTCCTCATCCATCAAACGGACTAA
GACAGCCCCGACCCCATAGGGTGTGTGAAGACAGAACGCTCAGGACAGCGTCTGACACGTGACTCGATGTGTGGGTACTGTTACTCCTTA

>In-frame_PC_ENST00000393960_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_3054nt
GTCAGTGGAGGCAGCAGCGGTAGAGGCGGCGGCGAGGACTGGCGACGGCGAGGAGCTGCCTTCTAGTCTCACCTGTGGACACTTTGCCAA
AGGAGTCGGGCCTGACGGTGGAAGATGGGAAATGGCCAAAAGAATAAACCATTTCCTCTTACTTACCGAATGAAAAGCTTGCTTCATCTT
GGCGTTCAAGACTCTCTAATATGATTCCACCTGTTGGGCTCTTTCTTCCATTTGCCTCCGCAGATAGTGTCTGCCTTCTGGAGAGCTGAC
CAAACACTAAGGATGCTGAAGTTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCC
CCAAATGTCCGGCGCCTGGAGTATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGC
ACGGAGCTGGGCATCCGCACCGTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATC
GGCCGCGGCCTGGCCCCCGTGCAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCT
GGCTACGGGTTCCTCTCTGAGCGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTC
CGCAAGATGGGAGACAAGGTGGAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCC
CTGCATGAGGCCCACGAGTTCTCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTG
GTGCACAGCTACGAGGAGCTGGAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAG
AAGTTCATCGAGAAGCCACGGCACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCC
ATCCAGCGGCGGCACCAGAAGGTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTG
AAACTCGCTAAACAGGTGGGCTACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAAC
TCCCGCCTGCAGGTGGAGCACACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGC
CTACCCGACCTGGGCCTGCGGCAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGC
TTCCAGCCGGACACCGGCCGCATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCC
GTCATCTCGCCCCACTACGACTCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCC
CTTGCGGAGTTCCGCGTCCGAGGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATT
GATGAGGACTTCCGAGACGGGCTCAAGCTCATGCTGCTCCTGGAGGTTCACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGG
TGCCAGAAGATCTGTGACCAGTGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAG
GCCATCGACCAGCTGCACCTGGAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATG
TTCATCGTCCATACCATCGAGGAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGC
GAGGCCATCCTGGCCATCCACAAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTC
ACCCCGCAAATCATCAACTCCAAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAG
CAGTCCAACGAGCACCTGCGCCGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGC
ATCTCCATTGAGATGAACGGGACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTG
GACCTGCTGGAGCAGCAGCACCAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTG
GGCTGGGAGCAGCTGCTCACCACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAG
GAGCAGATGCAGGAGTTCCGGGCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTC
ATCAGCCTGGGCTACGACGTGGAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGC
CTTGTGACCTTCCAAGCCTTCATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTC
TTAGCAGGGGACAAGAACTTCATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCG

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000252699_chr19_39191240_+_6174nt
CAGGCAGCAGGCCTCAGGCCCAGACTTGGGTGTTACAGGAACAGTGTGGCCTCTCTGGAACTCTGCAGACCAACTGCCGTGATGCTGAAG
TTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGGCGCCTGGAG
TATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGCATCCGCACC
GTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTGGCCCCCGTG
CAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTCCTCTCTGAG
CGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGAGACAAGGTG
GAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCCCACGAGTTC
TCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTACGAGGAGCTG
GAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAGAAGCCACGG
CACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGGCACCAGAAG
GTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAACAGGTGGGC
TACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAGGTGGAGCAC
ACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTGGGCCTGCGG
CAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGACACCGGCCGC
ATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCCCACTACGAC
TCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTCCGCGTCCGA
GGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTCCGAGACGGG
CTCAAGCTCATGCTGCTCCTGGAGGTCATATCAGGGGAGCGGTTACCTAAGCCGGAGCGGGGGAAGATGAGAGTGCACAAAATCAACAAT
GTGAACAAAGCGCTGGACTTTATTGCCAGCAAAGGCGTCAAGCTGGTCTCCATCGGGGCAGAAGAGATTGTGGACGGCAACGCAAAGATG
ACCCTGGGAATGATCTGGACCATCATCCTTAGGTTCGCCATCCAGGACATCTCCGTGGAAGAGACCTCGGCCAAGGAAGGGCTCCTTCTC
TGGTGCCAGAGAAAGACAGCCCCGTATAAGAACGTCAATGTGCAGAACTTCCACATCAGCTGGAAGGATGGTCTTGCCTTCAATGCCCTG
ATCCACCGGCACAGACCAGAGCTGATTGAGTATGACAAGCTGAGGAAGGACGACCCTGTCACCAACCTGAACAATGCCTTCGAAGTGGCT
GAGAAATACCTCGACATCCCCAAGATGCTGGATGCAGAGGACATCGTGAACACGGCCCGGCCCGACGAGAAGGCCATAATGACCTATGTG
TCCAGCTTCTACCATGCCTTTTCAGGAGCGCAGAAGGCTGAAACTGCCGCCAACCGGATCTGTAAGGTGCTGGCTGTCAACCAAGAGAAC
GAGCACCTGATGGAGGACTACGAGAAGCTGGCCAGCGACCTCCTGGAGTGGATCCGGCGCACCATCCCCTGGCTGGAGGACCGTGTGCCC
CAAAAGACTATCCAGGAGATGCAGCAGAAGCTGGAGGACTTCCGCGACTACCGGCGTGTGCACAAGCCGCCCAAGGTGCAGGAGAAGTGC
CAGCTGGAGATCAACTTCAACACGCTGCAGACCAAGCTGCGCCTCAGCAACCGGCCCGCCTTCATGCCCTCCGAGGGCAAGATGGTCTCG
GACATCAACAATGGCTGGCAGCACTTGGAGCAGGCTGAGAAGGGCTACGAGGAGTGGCTGCTGAATGAGATCCGCAGGCTGGAGCGGCTC
GACCACCTGGCAGAGAAGTTCCGGCAGAAGGCCTCCATCCACGAGGCCTGGACTGACGGGAAGGAAGCCATGCTGAAGCACCGGGACTAC
GAGACGGCCACACTATCGGACATCAAAGCCCTCATTCGCAAGCACGAGGCCTTCGAGAGCGACCTGGCTGCGCACCAGGACCGCGTGGAG
CAGATCGCCGCCATTGCCCAGGAGCTCAACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATCTGTGACCAG
TGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAGCTGCACCTG
GAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCATACCATCGAG
GAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTGGCCATCCAC
AAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATCATCAACTCC
AAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAGCACCTGCGC
CGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAGATGAACGGG
ACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAGCAGCAGCAC
CAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACC
ACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGG
GCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTG
GAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTC
ATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTC
ATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCC
GTGCCCGGTGCCCTCGACTACAAGTCCTTCTCCACGGCCTTGTATGGCGAGAGCGACCTGTGAGGCCCCAGAGACCTGACCCAACACCCC
CGACGGCCTCCAGGAGGGGCCTGGGCAGCCCCACAGTCCCATTCCTCCACTCTGTATCTATGCAAAGCACTCTCTGCAGTCCTCCGGGGT
GGGTGGGTGGGCAGGGAGGGGCTGGGGCAGGCTCTCTCCTCTCTCTCTTTGTGGGTTGGCCAGGAGGTTCCCCCGACCAGGTTGGGGAGA
CTTGGGGCCAGCGCTTCTGGTCTGGTAAATATGTATGATGTGTTGTGCTTTTTTAACCAAGGAGGGGCCAGTGGATTCCCACAGCACAAC
CGGTCCCTTCCATGCCCTGGGATGCCTCACCACACCCAGGTCTCTTCCTTTGCTCTGAGGTCCCTTCAAGGCCTCCCCAATCCAGGCCAA
AGCCCCATGTGCCTTGTCCAGGAACTGCCTGGGCCATGCGAGGGGCCAGCAGAGGGCGCCACCACCACCTGACGGCTGGGGACCCACCCA
GCCCCTCTCCCCTCTCTGCTCCAGACTCACTTGCCATTGCCAGGAGATGGCCCCAACAAGCACCCCGCTTTTGCAGCAGAGGAGCTGAGT
TGGCAGACCGGGCCCCCCTGAACCGCACCCCATCCCACCAGCCCCGGCCTTGCTTTGTCTGGCCTCACGTGTCTCAGATTTTCTAAGAAC
CAAAAAAAAAAAAGGAAAAAAAACACAAAACAACAAAAACCAAAAAAAAAAAAAATCACAAAAACAAAAAAACTATAAAAAAGAAAGAAT
TAAAAACTTTCAGAGAATTACTATTTACTTTATTAACTTACGGATTTATTATATAAATATATATTCACCTAGCAACATATCTCTGCCGTC
TCTCCTGCTCTCATAATGAAGACATAGCCGATTCTCTGCCCGGGCCCCTTGCTGATGCTCCTCCGGGTCTGCGTCGGGCGTGGGTCTCTG
GGGACCCTCCAGAGGTGGAGGTGGGCTGATGGCCTGGCTGCCTGGTGGTTGATGGTTTTGCTCCCCCTACCTTTTTTTTTTGAGTTTATT
CTGATTGATTTTTTTTCTTGGTTTCTGGATAAACCACCCTCTGGGGACAGGATAATAAAACATGTAATATTTTTAAGAAGGATTCCTGCA
GCATCATCTTTTTTTATTTCTCCTGTGTCTGTCCTCCACCTTCTAGGAGAGCCAGGGCAGAGCTAGCACTGTCTTAAGCTGTCAACGTGG
ACTAGCTCGTGTCATCTGCTCGAGAAGGGCTGTCGCTGTTCTTGTTTCTGAGTGAGGAGTACGCAGGCCAGAGTGGTCACCCGGCCGTGA
GCAGTGAGGGCCAGAGACTAGCCCCAGACAGGTGGATGCCAGAGAGAGTGGCACCCATGCCAGGCAAGGCCTAGGGAGGTGGTCTTGCTC
AGCAACCCTGCCCTGAGCAGCAGGTGCGCCCATCCGGAGATCCTAGGAGAAGGTGGCCACCTCCATCCACTAAGGAAGAGAAGGAAGACA
GTGGCTTGAGGCAGGGAGCTCGCAGGACAGAGCCTGAGCCACCCTGTCCCTCCCACCTGGCTCACCTGTCTGTGGGTCAGGCAGATGACC
CCCTCACCCCCATCCAGGTGCTGGCTGCAGTGGCCTGTGCAGAGAGGGGCAGGGTGAGTGCCCACCAGTCCCCGTACCCCTTCCCCCCAT
GCCCCACCATGCCGGGGTGGTACTCACAGAAGATGCAGGTGAGGTGGGCCACACAGGACACGAACCGCTCGAAGTCCACACGCAGACGGC
TATCCCGGTAGCGGCTGGTGAGGGTCTGGGTCAGCTGGTTGTTCAGGTGGAAGCCTAGGGGGAGGCTGCTTCTGAGCCCAGTGGCCCACA
GGGAACCCACCTTGGCATTGCATCCCCACCCCACCTCCTCAGGGAGGACATGAATGCCACAGGGTGTCACACCCCAACTCTGCCCCATCC
CGGCAGGGTGAGTACAGGCTGATCCCTTCAATCCTCTGGGCCTGTTTCCTCATCCATCAAACGGACTAAGACAGCCCCGACCCCATAGGG
TGTGTGAAGACAGAACGCTCAGGACAGCGTCTGACACGTGACTCGATGTGTGGGTACTGTTACTCCTTAAATCCTGTGGGGCTTTCTCCT

>In-frame_PC_ENST00000393955_chr11_66631245_-_ACTN4_ENST00000424234_chr19_39191240_+_2853nt
CAGGCAGCAGGCCTCAGGCCCAGACTTGGGTGTTACAGGAACAGTGTGGCCTCTCTGGAACTCTGCAGACCAACTGCCGTGATGCTGAAG
TTCCGAACAGTCCATGGGGGCCTGAGGCTCCTGGGAATCCGCCGAACCTCCACCGCCCCCGCTGCCTCCCCAAATGTCCGGCGCCTGGAG
TATAAGCCCATCAAGAAAGTCATGGTGGCCAACAGAGGTGAGATTGCCATCCGTGTGTTCCGGGCCTGCACGGAGCTGGGCATCCGCACC
GTAGCCATCTACTCTGAGCAGGACACGGGCCAGATGCACCGGCAGAAAGCAGATGAAGCCTATCTCATCGGCCGCGGCCTGGCCCCCGTG
CAGGCCTACCTGCACATCCCAGACATCATCAAGGTGGCCAAGGAGAACAACGTAGATGCAGTGCACCCTGGCTACGGGTTCCTCTCTGAG
CGAGCGGACTTCGCCCAGGCCTGCCAGGATGCAGGGGTCCGGTTTATTGGGCCAAGCCCAGAAGTGGTCCGCAAGATGGGAGACAAGGTG
GAGGCCCGGGCCATCGCCATTGCTGCGGGTGTTCCCGTTGTCCCTGGCACAGATGCCCCCATCACGTCCCTGCATGAGGCCCACGAGTTC
TCCAACACCTACGGCTTCCCCATCATCTTCAAGGCGGCCTATGGGGGTGGAGGGCGTGGCATGAGGGTGGTGCACAGCTACGAGGAGCTG
GAGGAGAATTACACCCGGGCCTACTCAGAGGCTCTGGCCGCCTTTGGGAATGGGGCGCTGTTTGTGGAGAAGTTCATCGAGAAGCCACGG
CACATCGAGGTGCAGATCTTGGGGGACCAGTATGGGAACATCCTGCACCTGTACGAGCGAGACTGCTCCATCCAGCGGCGGCACCAGAAG
GTGGTCGAGATTGCCCCCGCCGCCCACCTGGACCCGCAGCTTCGGACTCGGCTCACCAGCGACTCTGTGAAACTCGCTAAACAGGTGGGC
TACGAGAACGCAGGCACCGTGGAGTTCCTGGTGGACAGGCACGGCAAGCACTACTTCATCGAGGTCAACTCCCGCCTGCAGGTGGAGCAC
ACGGTCACAGAGGAGATCACCGACGTAGACCTGGTCCATGCTCAGATCCACGTGGCTGAGGGCAGGAGCCTACCCGACCTGGGCCTGCGG
CAGGAGAACATCCGCATCAACGGGTGTGCCATCCAGTGCCGGGTCACCACCGAGGACCCCGCGCGCAGCTTCCAGCCGGACACCGGCCGC
ATTGAGGTGTTCCGGAGCGGAGAGGGCATGGGCATCCGCCTGGATAATGCTTCCGCCTTCCAAGGAGCCGTCATCTCGCCCCACTACGAC
TCCCTGCTGGTCAAAGTCATTGCCCACGGCAAAGACCACCCCACGGCCGCCACCAAGATGAGCAGGGCCCTTGCGGAGTTCCGCGTCCGA
GGTGTGAAGACCTTCACGGCATGGTGCAACTCCCACCTGCGGAAGGCAGGCACACAGATCGAGAACATTGATGAGGACTTCCGAGACGGG
CTCAAGCTCATGCTGCTCCTGGAGGTTCACGAGCTGGATTACTACGACTCCCACAATGTCAACACCCGGTGCCAGAAGATCTGTGACCAG
TGGGACGCCCTCGGCTCTCTGACACATAGTCGCAGGGAAGCCCTGGAGAAAACAGAGAAGCAGCTGGAGGCCATCGACCAGCTGCACCTG
GAATACGCCAAGCGCGCGGCCCCCTTCAACAACTGGATGGAGAGCGCCATGGAGGACCTCCAGGACATGTTCATCGTCCATACCATCGAG
GAGATTGAGGGCCTGATCTCAGCCCATGACCAGTTCAAGTCCACCCTGCCGGACGCCGATAGGGAGCGCGAGGCCATCCTGGCCATCCAC
AAGGAGGCCCAGAGGATCGCTGAGAGCAACCACATCAAGCTGTCGGGCAGCAACCCCTACACCACCGTCACCCCGCAAATCATCAACTCC
AAGTGGGAGAAGGTGCAGCAGCTGGTGCCAAAACGGGACCATGCCCTCCTGGAGGAGCAGAGCAAGCAGCAGTCCAACGAGCACCTGCGC
CGCCAGTTCGCCAGCCAGGCCAATGTTGTGGGGCCCTGGATCCAGACCAAGATGGAGGAGATCGGGCGCATCTCCATTGAGATGAACGGG
ACCCTGGAGGACCAGCTGAGCCACCTGAAGCAGTATGAACGCAGCATCGTGGACTACAAGCCCAACCTGGACCTGCTGGAGCAGCAGCAC
CAGCTCATCCAGGAGGCCCTCATCTTCGACAACAAGCACACCAACTATACCATGGAGCACATCCGCGTGGGCTGGGAGCAGCTGCTCACC
ACCATTGCCCGCACCATCAACGAGGTGGAGAACCAGATCCTCACCCGCGACGCCAAGGGCATCAGCCAGGAGCAGATGCAGGAGTTCCGG
GCGTCCTTCAACCACTTCGACAAGGATCATGGCGGGGCGCTGGGGCCCGAGGAGTTCAAGGCCTGCCTCATCAGCCTGGGCTACGACGTG
GAGAACGACCGGCAGGGTGAGGCCGAGTTCAACCGCATCATGAGCCTGGTCGACCCCAACCATAGCGGCCTTGTGACCTTCCAAGCCTTC
ATCGACTTCATGTCGCGGGAGACCACCGACACGGACACGGCTGACCAGGTCATCGCTTCCTTCAAGGTCTTAGCAGGGGACAAGAACTTC
ATCACAGCTGAGGAGCTGCGGAGAGAGCTGCCCCCCGACCAGGCCGAGTACTGCATCGCCCGCATGGCGCCATACCAGGGCCCTGACGCC


Top

FusionGenePPI for PC_ACTN4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCMDH2, GOT1, NPM1, UBE2N, ILF2, ILF3, MTHFD1, CDH2, RPS3A, NACA, PPT2, PRKCDBP, TUFM, IFIT1, ADRB2, HECW2, HUWE1, EGFR, TSHR, KLK5, DTWD2, ANTXR1, DNASE2B, CBWD1, PSG1, THBS3, CAD, CCT6A, COPB1, CYP27A1, FASN, KPNA4, ATP1A1, CANX, CCT3, GNB2, PPP2R1A, RPN1, RPN2, SLC25A3, PFAS, UQCRC2, NTRK1, PTEN, ERBB2, XRCC3, RAB7A, DYNLL1, WWP2, ZNF746, PTPN9, STRAP, DEFA5, ASS1, HSD3B2, BPNT1, SLAMF1, LRP1, TPSB2, YBEY, EPHA7, TESACTN4MYOZ2, MYOZ1, PDLIM1, USP6NL, SLC9A3R2, COL17A1, TRIM3, MAGI1, GSN, CAMK2A, CAMK2B, INO80, UBTF, STAT1, HDAC7, MEF2A, UCHL5, TJP1, ATXN7, HDAC5, VDR, ESR1, PSMA3, ELAVL1, SIRT7, SLC2A4, ISG15, COIL, SACS, HGS, UBASH3B, SHC1, NOS3, ACTN2, ACTN1, FMNL1, TRAF3IP1, FN1, VCAM1, CDH1, ITGA4, SVIL, CD81, IGSF8, ICAM1, TXN, RPS27, POT1, KPNA2, MAPK7, CDKN2A, VCP, SF3A3, GNB2, HUWE1, ACTN3, BMP7, ALK, CUL7, OBSL1, CCDC8, EGFR, LUZP4, RARA, HSPB1, AHNAK, ALDOA, ALDOC, IDH3A, MYH15, MYH2, MYH7B, NCAPG2, PSMA6, PSMB5, PUS7, TPM2, TSG101, CKB, CYC1, ECSIT, MCFD2, PSMB8, TPM1, TPM3, TPM4, NTRK1, CAPZA2, DBN1, FLNA, MYH9, MYO1C, PPP1CB, IQGAP1, PDLIM7, SYNPO, MAPRE1, SIN3B, MYEF2, LIMA1, ANLN, MYO5C, MYO19, MYO18A, CTNNB1, MCM2, NFYA, CDC73, DDIAS, SSH1, NCL, DLD, DNM1L, PDHA1, SOD1, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PC_ACTN4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePCP11498DB00121BiotinPyruvate carboxylase, mitochondrialsmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for PC_ACTN4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePCC0006413Burkitt Lymphoma1CTD_human
HgenePCC0023893Liver Cirrhosis, Experimental1CTD_human
HgenePCC0034341Pyruvate Carboxylase Deficiency Disease1CTD_human;UNIPROT
TgeneACTN4C0333497Segmental glomerulosclerosis3UNIPROT
TgeneACTN4C0024667Animal Mammary Neoplasms1CTD_human
TgeneACTN4C0024668Mammary Neoplasms, Experimental1CTD_human