FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26234

FusionGeneSummary for PCID2_SNRPA

check button Fusion gene summary
Fusion gene informationFusion gene name: PCID2_SNRPA
Fusion gene ID: 26234
HgeneTgene
Gene symbol

PCID2

SNRPA

Gene ID

55795

6626

Gene namePCI domain containing 2small nuclear ribonucleoprotein polypeptide A
SynonymsF10Mud1|U1-A|U1A
Cytomap

13q34

19q13.2

Type of geneprotein-codingprotein-coding
DescriptionPCI domain-containing protein 2CSN12-like proteinU1 small nuclear ribonucleoprotein AU1 small nuclear RNP-specific AU1 snRNP AU1 snRNP-specific protein A
Modification date2018052320180523
UniProtAcc

Q5JVF3

P09012

Ensembl transtripts involved in fusion geneENST00000337344, ENST00000375477, 
ENST00000375479, ENST00000493650, 
ENST00000375459, ENST00000246505, 
ENST00000375457, 
ENST00000243563, 
ENST00000599570, 
Fusion gene scores* DoF score5 X 3 X 4=602 X 2 X 2=8
# samples 42
** MAII scorelog2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: PCID2 [Title/Abstract] AND SNRPA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-E1-A7Z2-01APCID2chr13

113862913

-SNRPAchr19

41265336

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337344ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
5CDS-3UTRENST00000337344ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
In-frameENST00000375477ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
5CDS-3UTRENST00000375477ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
In-frameENST00000375479ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
5CDS-3UTRENST00000375479ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3CDSENST00000493650ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3UTRENST00000493650ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3CDSENST00000375459ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3UTRENST00000375459ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
In-frameENST00000246505ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
5CDS-3UTRENST00000246505ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3CDSENST00000375457ENST00000243563PCID2chr13

113862913

-SNRPAchr19

41265336

+
intron-3UTRENST00000375457ENST00000599570PCID2chr13

113862913

-SNRPAchr19

41265336

+

Top

FusionProtFeatures for PCID2_SNRPA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PCID2

Q5JVF3

SNRPA

P09012

Component of the spliceosomal U1 snRNP, which isessential for recognition of the pre-mRNA 5' splice-site and thesubsequent assembly of the spliceosome. U1 snRNP is the firstsnRNP to interact with pre-mRNA. This interaction is required forthe subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP.SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A)may be involved in coupled pre-mRNA splicing and polyadenylationprocess. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.{ECO:0000269|PubMed:9848648}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSNRPAchr13:113862913chr19:41265336ENST00000243563+16140_20682283Compositional biasNote=Pro-rich
TgeneSNRPAchr13:113862913chr19:41265336ENST00000243563+16208_28282283DomainRRM 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCID2chr13:113862913chr19:41265336ENST00000246505-115210_39112560DomainPCI
HgenePCID2chr13:113862913chr19:41265336ENST00000337344-114210_39112400DomainPCI
HgenePCID2chr13:113862913chr19:41265336ENST00000375457-114210_391-199398DomainPCI
HgenePCID2chr13:113862913chr19:41265336ENST00000375459-115210_391-18510DomainPCI
HgenePCID2chr13:113862913chr19:41265336ENST00000375477-115210_39112518DomainPCI
HgenePCID2chr13:113862913chr19:41265336ENST00000375479-115210_39112491DomainPCI
TgeneSNRPAchr13:113862913chr19:41265336ENST00000243563+1610_8982283DomainRRM 1


Top

FusionGeneSequence for PCID2_SNRPA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PCID2_ENST00000337344_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_213aa
MAHITINQYLQQRIQTAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVE

>In-frame_PCID2_ENST00000375477_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_213aa
MAHITINQYLQQRIQTAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVE

>In-frame_PCID2_ENST00000375479_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_213aa
MAHITINQYLQQRIQTAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVE

>In-frame_PCID2_ENST00000246505_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_213aa
MAHITINQYLQQRIQTAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQ
PPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PCID2_ENST00000337344_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_639nt
ATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACC
TTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCC
ACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAG
CCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTT
ATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAAC
GAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAG
TTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC

>In-frame_PCID2_ENST00000375477_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_639nt
ATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACC
TTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCC
ACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAG
CCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTT
ATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAAC
GAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAG
TTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC

>In-frame_PCID2_ENST00000375479_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_639nt
ATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACC
TTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCC
ACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAG
CCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTT
ATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAAC
GAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAG
TTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC

>In-frame_PCID2_ENST00000246505_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_639nt
ATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACC
TTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCC
ACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAG
CCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTT
ATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAAC
GAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAG
TTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PCID2_ENST00000337344_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_938nt
GGACCGAGGGCCGGAAGTGACGCCAGCTGGCCCGCTTGAGGCGTAGGGGGTGGCGCTCTCCGTTCGGCGGCGCTCCCATGGCGCACATTA
CCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACCTTCGTGGAGCGGG
ACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTGGTGG
GGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAGCCGCCCTACATGC
CGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTTATGCCAGGACAGA
TGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAACGAGCTCATGCTGT
CCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAATGAGG
TACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCCAAGAAGTAGCACC
TTTTCCCCCCATGCCTGCCCCTTCCCCTGTTCTGGGGCCACCCCTTTCCCCCTTGGCTCAGCCCCCTGAAGGTAAGTCCCCCCTTGGGGG
CCTTCTTGGAGCCGTGTGTGAGTGAGTGGTCGCCACACAGCATTGTACCCAGAGTCTGTCCCCAGACATTGCACCTGGCGCTGTTAGGCC

>In-frame_PCID2_ENST00000375477_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_893nt
GGGGGTGGCGCTCTCCGTTCGGCGGCGCTCCCATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCG
ACTCAGATATCATTGCCAAGATGAAAGGCACCTTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGG
CCACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGG
CGCCCCGCATTATGCACCACATGCCGGGCCAGCCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGA
TCCCACCAGGGGCCATGCCCCCGCAGCAGCTTATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCT
TGTTCCTCACCAACCTGCCAGAGGAGACCAACGAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGG
TACCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCA
CGCAGAACAACGCCATGAAGATCTCCTTTGCCAAGAAGTAGCACCTTTTCCCCCCATGCCTGCCCCTTCCCCTGTTCTGGGGCCACCCCT
TTCCCCCTTGGCTCAGCCCCCTGAAGGTAAGTCCCCCCTTGGGGGCCTTCTTGGAGCCGTGTGTGAGTGAGTGGTCGCCACACAGCATTG

>In-frame_PCID2_ENST00000375479_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_942nt
AGACGGACCGAGGGCCGGAAGTGACGCCAGCTGGCCCGCTTGAGGCGTAGGGGGTGGCGCTCTCCGTTCGGCGGCGCTCCCATGGCGCAC
ATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGACCGACTCAGATATCATTGCCAAGATGAAAGGCACCTTCGTGGAG
CGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCCCGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTG
GTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTCAGGCGCCCCGCATTATGCACCACATGCCGGGCCAGCCGCCCTAC
ATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCCAGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTTATGCCAGGA
CAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACATCTTGTTCCTCACCAACCTGCCAGAGGAGACCAACGAGCTCATG
CTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTCTGGTACCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAAT
GAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGATCACGCAGAACAACGCCATGAAGATCTCCTTTGCCAAGAAGTAG
CACCTTTTCCCCCCATGCCTGCCCCTTCCCCTGTTCTGGGGCCACCCCTTTCCCCCTTGGCTCAGCCCCCTGAAGGTAAGTCCCCCCTTG
GGGGCCTTCTTGGAGCCGTGTGTGAGTGAGTGGTCGCCACACAGCATTGTACCCAGAGTCTGTCCCCAGACATTGCACCTGGCGCTGTTA

>In-frame_PCID2_ENST00000246505_chr13_113862913_-_SNRPA_ENST00000243563_chr19_41265336_+_896nt
GTAGGGGGTGGCGCTCTCCGTTCGGCGGCGCTCCCATGGCGCACATTACCATTAACCAGTACCTGCAGCAGCGTATCCAGTATGCCAAGA
CCGACTCAGATATCATTGCCAAGATGAAAGGCACCTTCGTGGAGCGGGACCGCAAGCGGGAGAAGAGGAAGCCCAAGAGCCAGGAGACCC
CGGCCACCAAGAAGGCTGTGCAAGGCGGGGGAGCCACCCCCGTGGTGGGGGCTGTCCAGGGGCCTGTCCCGGGCATGCCGCCGATGACTC
AGGCGCCCCGCATTATGCACCACATGCCGGGCCAGCCGCCCTACATGCCGCCCCCTGGTATGATCCCCCCGCCAGGCCTTGCACCTGGCC
AGATCCCACCAGGGGCCATGCCCCCGCAGCAGCTTATGCCAGGACAGATGCCCCCTGCCCAGCCTCTTTCTGAGAATCCACCGAATCACA
TCTTGTTCCTCACCAACCTGCCAGAGGAGACCAACGAGCTCATGCTGTCCATGCTTTTCAATCAGTTCCCTGGCTTCAAGGAGGTCCGTC
TGGTACCCGGGCGGCATGACATCGCCTTCGTGGAGTTTGACAATGAGGTACAGGCAGGGGCAGCTCGCGATGCCCTGCAGGGCTTTAAGA
TCACGCAGAACAACGCCATGAAGATCTCCTTTGCCAAGAAGTAGCACCTTTTCCCCCCATGCCTGCCCCTTCCCCTGTTCTGGGGCCACC
CCTTTCCCCCTTGGCTCAGCCCCCTGAAGGTAAGTCCCCCCTTGGGGGCCTTCTTGGAGCCGTGTGTGAGTGAGTGGTCGCCACACAGCA


Top

FusionGenePPI for PCID2_SNRPA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCID2SHFM1, NEK6, UBC, CUL3, SMAD2, EID1, TUBGCP3, IKZF3, SHMT2, MOV10, NXF1, CAPZB, DDX3X, IMPDH2, LSM1, ADPRHL2, TTC4, PSMD6, SNX2, SNX6, UBE4B, VPS35, IFI16, KIF11, TMEM63B, ZFC3H1, CETN1, TRIM25SNRPASNRPA, PTBP1, C19orf43, ATIC, RNPS1, CDC5L, TADA2A, NONO, SFPQ, SF3A2, CUL3, CUL4A, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, CAND1, SF3A1, SNRPA1, SF3A3, SF3B1, SF3B3, PRPF19, SRSF11, SF3B5, HNRNPU, GTF2F1, PABPC1, EEF1A1, TST, AHCYL1, EEF1B2, CPLX1, TRIM24, AGMAT, HNRNPH3, TIMM13, TNPO1, SMURF1, FN1, U2AF2, HNRNPK, RBM42, PTBP2, TP63, IFIT1, IFIT2, IFIT3, SMAD5, IL7R, SRPK2, SRPK3, CDKN2A, WBP4, PRKDC, GIT1, LIN28A, LIN28B, CIRBP, GABPB1, PCBP1, PCBP2, RBM3, TRIM27, QKI, ENOX2, MTUS2, NDUFAF3, RBMX, METTL13, LENG8, CUL7, OBSL1, UBC, EZH2, SUZ12, EED, RNF2, PRPF6, YARS, SFN, NTRK1, EWSR1, XPO1, MATR3, SNRPF, SNRPN, SNRNP70, SNRPG, SNRPE


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PCID2_SNRPA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PCID2_SNRPA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource