FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26221

FusionGeneSummary for PCGF3_HTT

check button Fusion gene summary
Fusion gene informationFusion gene name: PCGF3_HTT
Fusion gene ID: 26221
HgeneTgene
Gene symbol

PCGF3

HTT

Gene ID

10336

6532

Gene namepolycomb group ring finger 3solute carrier family 6 member 4
SynonymsDONG1|RNF3|RNF3A5-HTT|5-HTTLPR|5HTT|HTT|OCD1|SERT|SERT1|hSERT
Cytomap

4p16.3

17q11.2

Type of geneprotein-codingprotein-coding
Descriptionpolycomb group RING finger protein 3RING finger protein 3Aring finger protein 3sodium-dependent serotonin transporter5-hydroxytryptamine (serotonin) transporter5HT transporterNa+/Cl- dependent serotonin transporterserotonin transporter 1solute carrier family 6 (neurotransmitter transporter), member 4solute carrier family 6 (ne
Modification date2018052320180527
UniProtAcc

Q3KNV8

P42858

Ensembl transtripts involved in fusion geneENST00000362003, ENST00000400151, 
ENST00000482726, ENST00000470161, 
ENST00000521023, ENST00000505655, 
ENST00000355072, ENST00000513806, 
Fusion gene scores* DoF score11 X 7 X 7=5397 X 8 X 4=224
# samples 118
** MAII scorelog2(11/539*10)=-2.29278174922785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/224*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PCGF3 [Title/Abstract] AND HTT [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneHTT

GO:0006837

serotonin transport

19270731

TgeneHTT

GO:0009636

response to toxic substance

17575980

TgeneHTT

GO:0015844

monoamine transport

16024787

TgeneHTT

GO:0051610

serotonin uptake

8987735|16870614|17506858|18227069|19270731


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-BR-8484-01APCGF3chr4

738476

+HTTchr4

3136128

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000362003ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
5CDS-intronENST00000362003ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+
intron-3CDSENST00000400151ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
intron-intronENST00000400151ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+
intron-3CDSENST00000482726ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
intron-intronENST00000482726ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+
In-frameENST00000470161ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
5CDS-intronENST00000470161ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+
In-frameENST00000521023ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
5CDS-intronENST00000521023ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+
In-frameENST00000505655ENST00000355072PCGF3chr4

738476

+HTTchr4

3136128

+
5CDS-intronENST00000505655ENST00000513806PCGF3chr4

738476

+HTTchr4

3136128

+

Top

FusionProtFeatures for PCGF3_HTT


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PCGF3

Q3KNV8

HTT

P42858

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility. Within the PRC1-likecomplex, regulates RNF2 ubiquitin ligase activity(PubMed:26151332). Plays a redundant role with PCGF5 as part of aPRC1-like complex that mediates monoubiquitination of histone H2A'Lys-119' on the X chromosome and is required for normal silencingof one copy of the X chromosome in XX females (By similarity).{ECO:0000250|UniProtKB:Q8BTQ0, ECO:0000269|PubMed:26151332}. May play a role in microtubule-mediated transport orvesicle function.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCGF3chr4:738476chr4:3136128ENST00000362003+81117_56154243Zinc fingerRING-type
HgenePCGF3chr4:738476chr4:3136128ENST00000470161+81117_56154243Zinc fingerRING-type
HgenePCGF3chr4:738476chr4:3136128ENST00000505655+6917_56154243Zinc fingerRING-type
TgeneHTTchr4:738476chr4:3136128ENST00000355072+17671437_14408313143Compositional biasNote=Poly-Thr
TgeneHTTchr4:738476chr4:3136128ENST00000355072+17672341_23458313143Compositional biasNote=Poly-Glu
TgeneHTTchr4:738476chr4:3136128ENST00000355072+17672638_26438313143Compositional biasNote=Poly-Glu
TgeneHTTchr4:738476chr4:3136128ENST00000355072+17672395_24048313143MotifNuclear export signal
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767902_9408313143RepeatNote=HEAT 5

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneHTTchr4:738476chr4:3136128ENST00000355072+176718_388313143Compositional biasNote=Poly-Gln
TgeneHTTchr4:738476chr4:3136128ENST00000355072+176739_498313143Compositional biasNote=Poly-Pro
TgeneHTTchr4:738476chr4:3136128ENST00000355072+176763_788313143Compositional biasNote=Poly-Pro
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767204_2418313143RepeatNote=HEAT 1
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767246_2838313143RepeatNote=HEAT 2
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767316_3608313143RepeatNote=HEAT 3
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767802_8398313143RepeatNote=HEAT 4


Top

FusionGeneSequence for PCGF3_HTT


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PCGF3_ENST00000362003_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_2466aa
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEM
RKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQNCVMSLCSSSYSELGLQLIIDVLTLR
NSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQA
DPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFP
VCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWP
ALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSG
PVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMM
ATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKV
STQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQF
RESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLR
LIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVS
TVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVT
KQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTD
YRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQ
DFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSS
MAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALL
EGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLND
LFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSS
TEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAF
LTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVT
QPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKREN
IATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPV
NSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATC
KAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAF
YLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMY
TGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVY
KVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEL

>In-frame_PCGF3_ENST00000470161_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_2466aa
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEM
RKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQNCVMSLCSSSYSELGLQLIIDVLTLR
NSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQA
DPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFP
VCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWP
ALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSG
PVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMM
ATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKV
STQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQF
RESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLR
LIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVS
TVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVT
KQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTD
YRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQ
DFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSS
MAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALL
EGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLND
LFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSS
TEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAF
LTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVT
QPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKREN
IATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPV
NSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATC
KAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAF
YLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMY
TGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVY
KVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEL

>In-frame_PCGF3_ENST00000521023_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_2432aa
MTVCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRN
GETKADDSSNKEAAEEKPEEDNDYHRSDEQNCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLETLAEIDFRLVSFLEAKAENLH
RGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTIT
RIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPPLSASDESRKSCTVGMATMIL
TLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAP
GPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYK
VTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGR
AQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIK
ALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKII
QLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIA
DIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSF
SPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGM
FRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSD
LAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQSRCENLSTPTMLK
KTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDR
FRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSL
GMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHL
PPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIYCVHFILEAVAVQPGEQLLSPER
RTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAFLTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWS
PKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVLAVQAITSLVL
SAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQI
NPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQFLLELYSRWILPSSSARR
TPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVG
ALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGVMLSGSEESTP
SIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMYTGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVL
FDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAM
ATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEELDRRAFQSVLEVVAAPGSPYHRLLTCLRNVHKVTT

>In-frame_PCGF3_ENST00000505655_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_2466aa
MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEM
RKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQNCVMSLCSSSYSELGLQLIIDVLTLR
NSSYWLVRTELLETLAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLNNVVIHLLGDEDPRVRHVAAASLIRLVPKLFYKCDQGQA
DPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLPSITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFP
VCIWSLGWHCGVPPLSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWASEEEANPAATKQEEVWP
ALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPSLTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSG
PVTTSKSSSLGSFYHLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKSCFSREPMM
ATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCFMAPYTHFTQALADASLRNMVQAEQENDTSGWFDVLQKV
STQLKTNLTSVTKNRADKNAIHNHIRLFEPLVIKALKQYTTTTCVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQFEYIEVGQF
RESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLR
LIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVTPNTMASVS
TVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCTVINRLRDGDSTSTLEEHSEGKQIKNLPEETFSRFLLQLVGILLEDIVT
KQLKVEMSEQQHTFYCQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPALVLLWCQILLLVNHTD
YRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNREIVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISLSHEPPVQ
DFISAVHRNSAASGLFIQAIQSRCENLSTPTMLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILACRRVEMLLAANLQSS
MAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSPSPPVSSHPLDGDGHVSLETVSPDKDWYVHLVKSQCWTRSDSALL
EGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLND
LFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFVVATLEALSWHLIHEQIPLSLDLQAGLDCCCLALQLPGLWSVVSS
TEFVTHACSLIYCVHFILEAVAVQPGEQLLSPERRTNTPKAISEEEEEVDPNTQNPKYITAACEMVAEMVESLQSVLALGHKRNSGVPAF
LTPLLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFPEIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVT
QPLVMEQEESPPEEDTERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAMVSKREN
IATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYKLGQVSIHSVWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPV
NSRKHRAGVDIHSCSQFLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPSEDEILAQYLVPATC
KAAAVLGMDKAVAEPVSRLLESTLRSSHLPSRVGALHGVLYVLECDLLDDTAKQLIPVISDYLLSNLKGIAHCVNIHSQQHVLVMCATAF
YLIENYPLDVGPEFSASIIQMCGVMLSGSEESTPSIIYHCALRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGLMLTCMY
TGKEKVSPGRTSDPNPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILPQFLDDFFPPQDIMNKVIGEFLSNQQPYPQFMATVVY
KVFQTLHSTGQSSMVRDWVMLSLSNFTQRAPVAMATWSLSCFFVSASTSPWVAAILPHVISRMGKLEQVDVNLFCLVATDFYRHQIEEEL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PCGF3_ENST00000362003_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_7398nt
ATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCCTGTGCAGCGGGTACCTCATCGACGCCACCACGGTG
ACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCACCTGCAGGATTGTGATCCAC
CAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATG
AGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGAT
TCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGC
AGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGGACTGCAGCTGATCATCGATGTGCTGACTCTGAGG
AACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCA
GAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACGAGTGCTCAATAATGTTGTCATCCATTTGCTTGGA
GATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCCAAAGCTGTTTTATAAATGTGACCAAGGACAAGCT
GATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCATGCATGAGACGCAGCCTCCATCTCATTTCTCCGTC
AGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGTCACTATGGAAAATAACCTTTCAAGAGTTATTGCA
GCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTGTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCA
GTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCC
ACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTT
GCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCA
GCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCTGAAGGTGATTAACATTTGTGCCCACGTCCTGGAT
GACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCCTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAG
AAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGCCAGTGCAGCTTCTAGACAATCTGATACCTCAGGT
CCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATACCTCAAACTGCATGATGTCCTGAAAGCTACACAC
GCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTTTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATA
CTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATACCTGAAATCCTGCTTTAGTCGAGAACCAATGATG
GCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTCCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAG
TCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCACTACTGCTTCATGGCCCCGTACACCCACTTCACC
CAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTG
TCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAATGCTATTCATAATCACATTCGTTTGTTTGAACCT
CTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAAGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAG
TTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATTGAAACAGTTTGAATACATTGAAGTGGGCCAGTTC
AGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTATGAACGCTATCATTCAAAACAGATCATTGGAATT
CCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGACACATGCCATACCGGCTCTGCAGCCCATAGTCCAC
GACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAACCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGA
CTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCT
CGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGACTCTCATGAAGCCCTTGGAGTGTTAAATACATTA
TTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTATGTTCGTCACTCCAAACACAATGGCGTCCGTGAGC
ACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCAGTCAACTGAAGATATTGTTCTTTCTCGTATTCAG
GAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGATGGGGACAGTACTTCAACGCTAGAAGAACACAGT
GAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACAACTGGTTGGTATTCTTTTAGAAGACATTGTTACA
AAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACTAGGCACACTGCTAATGTGTCTGATCCACATCTTC
AAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGC
TTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTGGTGTCAGATACTGCTGCTTGTCAACCACACCGAC
TACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCACAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAG
GAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAGAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGT
CAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAG
GACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGCAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCA
ACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGGAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTG
TGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGTAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGC
ATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAGCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCC
CTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCCAGTCTCTTCCCACCCGCTGGACGGGGATGGGCAC
GTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATCCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTG
GAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGATGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCA
TGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGAAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGC
GGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGCAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGAT
CTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGCACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGT
CATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAACCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAG
CAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCTGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCC
ACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGAGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTT
AGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGTAGATCCAAACACACAGAATCCTAAGTATATCACT
GCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTTGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTT
CTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAACAGCTACACACGTGTGCCCCCACTGGTGTGGAAG
CTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCCCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAG
GAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGAAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACG
CAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGACCCAGATCAACGTCCTGGCCGTGCAGGCCATCACC
TCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTGCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAA
GCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCAAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAAT
ATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGCTACTACAGGTGCCCTCATCAGCCACGAGAAGCTG
CTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCAGGTGTCCATACACTCCGTGTGGCTGGGGAACAGC
ATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGCCCCTGCACCTTCGTCACCACCCACGTCTCCAGTC
AACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCTTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGC
TCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGTGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTT
GAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGAGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGC
AAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCTGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCC
AGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGACGACACTGCCAAGCAGCTCATCCCGGTCATCAGC
GACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCAGCAGCACGTACTGGTCATGTGTGCCACTGCGTTT
TACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAATACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAG
GAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCTGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAA
TCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCATGGCGGCTCTGGGCCTGATGCTCACCTGCATGTAC
ACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCCCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGG
GTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGTGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTC
TTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCAGCCATACCCCCAGTTCATGGCCACCGTGGTGTAT
AAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGTCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCC
CCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAGCCCGTGGGTCGCGGCGATCCTCCCACATGTCATC
AGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCACAGACTTCTACAGACACCAGATAGAGGAGGAGCTC
GACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATATCACCGGCTGCTGACTTGTTTACGAAATGTCCAC

>In-frame_PCGF3_ENST00000470161_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_7398nt
ATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCCTGTGCAGCGGGTACCTCATCGACGCCACCACGGTG
ACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCACCTGCAGGATTGTGATCCAC
CAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATG
AGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGAT
TCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGC
AGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGGACTGCAGCTGATCATCGATGTGCTGACTCTGAGG
AACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCA
GAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACGAGTGCTCAATAATGTTGTCATCCATTTGCTTGGA
GATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCCAAAGCTGTTTTATAAATGTGACCAAGGACAAGCT
GATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCATGCATGAGACGCAGCCTCCATCTCATTTCTCCGTC
AGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGTCACTATGGAAAATAACCTTTCAAGAGTTATTGCA
GCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTGTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCA
GTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCC
ACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTT
GCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCA
GCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCTGAAGGTGATTAACATTTGTGCCCACGTCCTGGAT
GACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCCTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAG
AAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGCCAGTGCAGCTTCTAGACAATCTGATACCTCAGGT
CCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATACCTCAAACTGCATGATGTCCTGAAAGCTACACAC
GCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTTTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATA
CTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATACCTGAAATCCTGCTTTAGTCGAGAACCAATGATG
GCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTCCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAG
TCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCACTACTGCTTCATGGCCCCGTACACCCACTTCACC
CAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTG
TCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAATGCTATTCATAATCACATTCGTTTGTTTGAACCT
CTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAAGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAG
TTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATTGAAACAGTTTGAATACATTGAAGTGGGCCAGTTC
AGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTATGAACGCTATCATTCAAAACAGATCATTGGAATT
CCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGACACATGCCATACCGGCTCTGCAGCCCATAGTCCAC
GACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAACCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGA
CTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCT
CGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGACTCTCATGAAGCCCTTGGAGTGTTAAATACATTA
TTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTATGTTCGTCACTCCAAACACAATGGCGTCCGTGAGC
ACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCAGTCAACTGAAGATATTGTTCTTTCTCGTATTCAG
GAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGATGGGGACAGTACTTCAACGCTAGAAGAACACAGT
GAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACAACTGGTTGGTATTCTTTTAGAAGACATTGTTACA
AAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACTAGGCACACTGCTAATGTGTCTGATCCACATCTTC
AAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGC
TTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTGGTGTCAGATACTGCTGCTTGTCAACCACACCGAC
TACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCACAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAG
GAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAGAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGT
CAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAG
GACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGCAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCA
ACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGGAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTG
TGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGTAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGC
ATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAGCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCC
CTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCCAGTCTCTTCCCACCCGCTGGACGGGGATGGGCAC
GTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATCCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTG
GAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGATGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCA
TGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGAAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGC
GGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGCAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGAT
CTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGCACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGT
CATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAACCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAG
CAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCTGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCC
ACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGAGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTT
AGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGTAGATCCAAACACACAGAATCCTAAGTATATCACT
GCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTTGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTT
CTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAACAGCTACACACGTGTGCCCCCACTGGTGTGGAAG
CTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCCCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAG
GAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGAAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACG
CAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGACCCAGATCAACGTCCTGGCCGTGCAGGCCATCACC
TCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTGCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAA
GCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCAAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAAT
ATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGCTACTACAGGTGCCCTCATCAGCCACGAGAAGCTG
CTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCAGGTGTCCATACACTCCGTGTGGCTGGGGAACAGC
ATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGCCCCTGCACCTTCGTCACCACCCACGTCTCCAGTC
AACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCTTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGC
TCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGTGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTT
GAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGAGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGC
AAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCTGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCC
AGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGACGACACTGCCAAGCAGCTCATCCCGGTCATCAGC
GACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCAGCAGCACGTACTGGTCATGTGTGCCACTGCGTTT
TACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAATACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAG
GAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCTGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAA
TCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCATGGCGGCTCTGGGCCTGATGCTCACCTGCATGTAC
ACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCCCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGG
GTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGTGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTC
TTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCAGCCATACCCCCAGTTCATGGCCACCGTGGTGTAT
AAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGTCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCC
CCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAGCCCGTGGGTCGCGGCGATCCTCCCACATGTCATC
AGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCACAGACTTCTACAGACACCAGATAGAGGAGGAGCTC
GACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATATCACCGGCTGCTGACTTGTTTACGAAATGTCCAC

>In-frame_PCGF3_ENST00000521023_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_7296nt
ATGACAGTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCACCTGCAGGATTGTGATCCACCAGAGCCACCCC
CTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATGAGAAAGCAGAGG
GAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGATTCCCATCGGAAT
GGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGCAGCGACGAGCAG
AACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGGACTGCAGCTGATCATCGATGTGCTGACTCTGAGGAACAGTTCCTAT
TGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCAGAAAACTTACAC
AGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACGAGTGCTCAATAATGTTGTCATCCATTTGCTTGGAGATGAAGACCCC
AGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCCAAAGCTGTTTTATAAATGTGACCAAGGACAAGCTGATCCAGTAGTG
GCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCATGCATGAGACGCAGCCTCCATCTCATTTCTCCGTCAGCACAATAACC
AGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGTCACTATGGAAAATAACCTTTCAAGAGTTATTGCAGCAGTTTCTCAT
GAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTGTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCAGTTTGCATTTGG
AGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCCACAATGATTCTG
ACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTTGCAGCCAGTGCT
CCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCAGCCCTGGGGGAC
CGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCTGAAGGTGATTAACATTTGTGCCCACGTCCTGGATGACGTGGCTCCT
GGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCCTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAGAAAGAACCAGGA
GAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGCCAGTGCAGCTTCTAGACAATCTGATACCTCAGGTCCTGTTACAACA
AGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATACCTCAAACTGCATGATGTCCTGAAAGCTACACACGCTAACTACAAG
GTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTTTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATACTAGAGCTGGCC
ACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATACCTGAAATCCTGCTTTAGTCGAGAACCAATGATGGCAACTGTTTGT
GTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTCCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAGTCACAAGGCCGA
GCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCACTACTGCTTCATGGCCCCGTACACCCACTTCACCCAGGCCCTCGCT
GACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTGTCTACCCAGTTG
AAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAATGCTATTCATAATCACATTCGTTTGTTTGAACCTCTTGTTATAAAA
GCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAAGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAGTTACGGGTTAAT
TACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATTGAAACAGTTTGAATACATTGAAGTGGGCCAGTTCAGGGAATCAGAG
GCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTATGAACGCTATCATTCAAAACAGATCATTGGAATTCCTAAAATCATT
CAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGACACATGCCATACCGGCTCTGCAGCCCATAGTCCACGACCTCTTTGTA
TTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAACCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGACTCATCCAGTAC
CATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCTCGACAGATAGCT
GACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGACTCTCATGAAGCCCTTGGAGTGTTAAATACATTATTTGAGATTTTG
GCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTATGTTCGTCACTCCAAACACAATGGCGTCCGTGAGCACTGTTCAACTG
TGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCAGTCAACTGAAGATATTGTTCTTTCTCGTATTCAGGAGCTCTCCTTC
TCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGATGGGGACAGTACTTCAACGCTAGAAGAACACAGTGAAGGGAAACAA
ATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACAACTGGTTGGTATTCTTTTAGAAGACATTGTTACAAAACAGCTGAAG
GTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACTAGGCACACTGCTAATGTGTCTGATCCACATCTTCAAGTCTGGAATG
TTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGCTTGAACTTGCGG
GCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTGGTGTCAGATACTGCTGCTTGTCAACCACACCGACTACCGCTGGTGG
GCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCACAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAGGAGGATTCTGAC
TTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAGAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGTCAGAACCTCCAT
GACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAGGACTTCATCAGT
GCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGCAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCAACCATGCTGAAG
AAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGGAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTGTGCACCCCTTTC
CGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGTAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGCATGGCCCAGTTG
CCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAGCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCCCTGCTGGACAGG
TTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCCAGTCTCTTCCCACCCGCTGGACGGGGATGGGCACGTGTCACTGGAA
ACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATCCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTGGAAGGTGCAGAG
CTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGATGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCATGCTTAAGCCTA
GGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGAAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGCGGCACCGTGCAG
CAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGCAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGATCTGTTTGGGGAT
GCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGCACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGTCATTTGCACCTT
CCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAACCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAGCAGATCCCGCTG
AGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCTGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCCACAGAGTTTGTG
ACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGAGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTTAGTCCAGAAAGA
AGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGTAGATCCAAACACACAGAATCCTAAGTATATCACTGCAGCCTGTGAG
ATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTTGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTTCTCACGCCATTG
CTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAACAGCTACACACGTGTGCCCCCACTGGTGTGGAAGCTTGGATGGTCA
CCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCCCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAGGAGTTCATCTAC
CGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGAAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACGCAGCCCCTCGTG
ATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGACCCAGATCAACGTCCTGGCCGTGCAGGCCATCACCTCACTGGTGCTC
AGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTGCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAAGCTCTCGACACC
AGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCAAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAATATTGCCACCCAT
CATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGCTACTACAGGTGCCCTCATCAGCCACGAGAAGCTGCTGCTACAGATC
AACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCAGGTGTCCATACACTCCGTGTGGCTGGGGAACAGCATCACACCCCTG
AGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGCCCCTGCACCTTCGTCACCACCCACGTCTCCAGTCAACTCCAGGAAA
CACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCTTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGCTCAGCCAGGAGG
ACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGTGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTTGAGCTGATGTAT
GTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGAGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGCAAGGCAGCTGCC
GTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCTGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCCAGCAGGGTTGGA
GCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGACGACACTGCCAAGCAGCTCATCCCGGTCATCAGCGACTATCTCCTC
TCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCAGCAGCACGTACTGGTCATGTGTGCCACTGCGTTTTACCTCATTGAG
AACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAATACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAGGAGTCCACCCCC
TCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCTGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAATCGCTGGTCAAG
CTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCATGGCGGCTCTGGGCCTGATGCTCACCTGCATGTACACAGGAAAGGAG
AAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCCCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGGGTATCTGTTCTT
TTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGTGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTCTTCCCACCCCAG
GACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCAGCCATACCCCCAGTTCATGGCCACCGTGGTGTATAAGGTGTTTCAG
ACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGTCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCCCCGGTCGCCATG
GCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAGCCCGTGGGTCGCGGCGATCCTCCCACATGTCATCAGCAGGATGGGC
AAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCACAGACTTCTACAGACACCAGATAGAGGAGGAGCTCGACCGCAGGGCC
TTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATATCACCGGCTGCTGACTTGTTTACGAAATGTCCACAAGGTCACCACC

>In-frame_PCGF3_ENST00000505655_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_7398nt
ATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCCTGTGCAGCGGGTACCTCATCGACGCCACCACGGTG
ACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCACCTGCAGGATTGTGATCCAC
CAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATG
AGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGAT
TCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGC
AGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGGACTGCAGCTGATCATCGATGTGCTGACTCTGAGG
AACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCA
GAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACGAGTGCTCAATAATGTTGTCATCCATTTGCTTGGA
GATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCCAAAGCTGTTTTATAAATGTGACCAAGGACAAGCT
GATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCATGCATGAGACGCAGCCTCCATCTCATTTCTCCGTC
AGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGTCACTATGGAAAATAACCTTTCAAGAGTTATTGCA
GCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTGTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCA
GTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCC
ACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTT
GCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCA
GCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCTGAAGGTGATTAACATTTGTGCCCACGTCCTGGAT
GACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCCTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAG
AAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGCCAGTGCAGCTTCTAGACAATCTGATACCTCAGGT
CCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATACCTCAAACTGCATGATGTCCTGAAAGCTACACAC
GCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTTTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATA
CTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATACCTGAAATCCTGCTTTAGTCGAGAACCAATGATG
GCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTCCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAG
TCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCACTACTGCTTCATGGCCCCGTACACCCACTTCACC
CAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTG
TCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAATGCTATTCATAATCACATTCGTTTGTTTGAACCT
CTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAAGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAG
TTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATTGAAACAGTTTGAATACATTGAAGTGGGCCAGTTC
AGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTATGAACGCTATCATTCAAAACAGATCATTGGAATT
CCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGACACATGCCATACCGGCTCTGCAGCCCATAGTCCAC
GACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAACCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGA
CTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCT
CGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGACTCTCATGAAGCCCTTGGAGTGTTAAATACATTA
TTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTATGTTCGTCACTCCAAACACAATGGCGTCCGTGAGC
ACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCAGTCAACTGAAGATATTGTTCTTTCTCGTATTCAG
GAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGATGGGGACAGTACTTCAACGCTAGAAGAACACAGT
GAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACAACTGGTTGGTATTCTTTTAGAAGACATTGTTACA
AAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACTAGGCACACTGCTAATGTGTCTGATCCACATCTTC
AAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGC
TTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTGGTGTCAGATACTGCTGCTTGTCAACCACACCGAC
TACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCACAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAG
GAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAGAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGT
CAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAG
GACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGCAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCA
ACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGGAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTG
TGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGTAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGC
ATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAGCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCC
CTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCCAGTCTCTTCCCACCCGCTGGACGGGGATGGGCAC
GTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATCCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTG
GAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGATGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCA
TGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGAAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGC
GGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGCAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGAT
CTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGCACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGT
CATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAACCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAG
CAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCTGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCC
ACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGAGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTT
AGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGTAGATCCAAACACACAGAATCCTAAGTATATCACT
GCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTTGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTT
CTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAACAGCTACACACGTGTGCCCCCACTGGTGTGGAAG
CTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCCCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAG
GAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGAAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACG
CAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGACCCAGATCAACGTCCTGGCCGTGCAGGCCATCACC
TCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTGCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAA
GCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCAAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAAT
ATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGCTACTACAGGTGCCCTCATCAGCCACGAGAAGCTG
CTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCAGGTGTCCATACACTCCGTGTGGCTGGGGAACAGC
ATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGCCCCTGCACCTTCGTCACCACCCACGTCTCCAGTC
AACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCTTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGC
TCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGTGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTT
GAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGAGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGC
AAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCTGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCC
AGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGACGACACTGCCAAGCAGCTCATCCCGGTCATCAGC
GACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCAGCAGCACGTACTGGTCATGTGTGCCACTGCGTTT
TACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAATACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAG
GAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCTGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAA
TCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCATGGCGGCTCTGGGCCTGATGCTCACCTGCATGTAC
ACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCCCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGG
GTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGTGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTC
TTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCAGCCATACCCCCAGTTCATGGCCACCGTGGTGTAT
AAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGTCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCC
CCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAGCCCGTGGGTCGCGGCGATCCTCCCACATGTCATC
AGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCACAGACTTCTACAGACACCAGATAGAGGAGGAGCTC
GACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATATCACCGGCTGCTGACTTGTTTACGAAATGTCCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_PCGF3_ENST00000362003_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_11683nt
GCCCAGACGCACACCGCGCATGCTCCGAGCGCGGCGCCCCCGACGCGGCGCTCGGCTCGGCTCGGGCATTTCCGCCTCTTTGTTTTAAAC
TCCGGACGGGCTTTTTTCTCCTCCTCTTGGGGGGGACCCAGAGGGAGCGGCGCCCCCTCCCCCCTCCGGCGCGGACCCCGCGTGCGCCTT
GCTCGCCCGCAGCCCCGAGACCGCAGGCGTCACAATGTAGCAGGGACCCCAGGCGTCGTGCTCAGAAAATGGAAAAAGAGCCAGGGCCGG
AAGGAGGGTGCAGAAGCGAGTCCGCGTGCGGAGCCAGGAGGCAGCGTCGCGTGGGAGTGCTGGCCTGAAGCCTCCATGCCCCGGCAGAGG
GACGGACACGCGGACGTCTAGCGGAGAAGCCAAAGATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCC
TGTGCAGCGGGTACCTCATCGACGCCACCACGGTGACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGA
ACAACACCTGCCCCACCTGCAGGATTGTGATCCACCAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTT
ACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATGAGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCA
AGGGGGAGACCTGCTCTGCAAAACAGCACTTAGATTCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGG
AGGAGAAGCCGGAGGAGGACAACGACTACCACCGCAGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAG
GACTGCAGCTGATCATCGATGTGCTGACTCTGAGGAACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTG
ACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCAGAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAAC
GAGTGCTCAATAATGTTGTCATCCATTTGCTTGGAGATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCC
CAAAGCTGTTTTATAAATGTGACCAAGGACAAGCTGATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCA
TGCATGAGACGCAGCCTCCATCTCATTTCTCCGTCAGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACG
TCACTATGGAAAATAACCTTTCAAGAGTTATTGCAGCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCT
GTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCAGTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAG
ATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCCACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCC
ATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTTGCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCA
ACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCAGCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGC
TGAAGGTGATTAACATTTGTGCCCACGTCCTGGATGACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCC
CTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAGAAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGG
CCAGTGCAGCTTCTAGACAATCTGATACCTCAGGTCCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCAT
ACCTCAAACTGCATGATGTCCTGAAAGCTACACACGCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGT
TTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATACTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGAT
ACCTGAAATCCTGCTTTAGTCGAGAACCAATGATGGCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCT
CCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAGTCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACC
ACTACTGCTTCATGGCCCCGTACACCCACTTCACCCAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACG
ACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTGTCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGA
ATGCTATTCATAATCACATTCGTTTGTTTGAACCTCTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGA
AGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAGTTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTAT
TGAAACAGTTTGAATACATTGAAGTGGGCCAGTTCAGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTT
ATGAACGCTATCATTCAAAACAGATCATTGGAATTCCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGA
CACATGCCATACCGGCTCTGCAGCCCATAGTCCACGACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAA
CCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGACTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCC
ACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCTCGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTG
ACTCTCATGAAGCCCTTGGAGTGTTAAATACATTATTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTA
TGTTCGTCACTCCAAACACAATGGCGTCCGTGAGCACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCC
AGTCAACTGAAGATATTGTTCTTTCTCGTATTCAGGAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAG
ATGGGGACAGTACTTCAACGCTAGAAGAACACAGTGAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTAC
AACTGGTTGGTATTCTTTTAGAAGACATTGTTACAAAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAAC
TAGGCACACTGCTAATGTGTCTGATCCACATCTTCAAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTG
ATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGCTTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCT
GGTGTCAGATACTGCTGCTTGTCAACCACACCGACTACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCA
CAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAGGAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAA
GAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGTCAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAG
ATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAGGACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGG
CAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCAACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGG
GAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTGTGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGG
TAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGCATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCA
GCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCCCTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTC
CAGTCTCTTCCCACCCGCTGGACGGGGATGGGCACGTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAAT
CCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTGGAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGA
TGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCATGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTG
AAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGCGGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTG
CAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGATCTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGG
CACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGTCATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAA
CCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAGCAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCC
TGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCCACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGG
AGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTTAGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAG
TAGATCCAAACACACAGAATCCTAAGTATATCACTGCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCT
TGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTTCTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCA
ACAGCTACACACGTGTGCCCCCACTGGTGTGGAAGCTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCC
CCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAGGAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAG
AAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACGCAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGA
CCCAGATCAACGTCCTGGCCGTGCAGGCCATCACCTCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCT
GCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAAGCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGC
AAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAATATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGG
CTACTACAGGTGCCCTCATCAGCCACGAGAAGCTGCTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCC
AGGTGTCCATACACTCCGTGTGGCTGGGGAACAGCATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACG
CCCCTGCACCTTCGTCACCACCCACGTCTCCAGTCAACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGC
TTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGCTCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAG
TGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTTGAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACG
AGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGCAAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCC
TGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCCAGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGG
ACGACACTGCCAAGCAGCTCATCCCGGTCATCAGCGACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCC
AGCAGCACGTACTGGTCATGTGTGCCACTGCGTTTTACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAA
TACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAGGAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCC
TGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAATCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCA
TGGCGGCTCTGGGCCTGATGCTCACCTGCATGTACACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCC
CCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGGGTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGG
TGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTCTTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGC
AGCCATACCCCCAGTTCATGGCCACCGTGGTGTATAAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGG
TCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCCCCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCA
GCCCGTGGGTCGCGGCGATCCTCCCACATGTCATCAGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCA
CAGACTTCTACAGACACCAGATAGAGGAGGAGCTCGACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCAT
ATCACCGGCTGCTGACTTGTTTACGAAATGTCCACAAGGTCACCACCTGCTGAGCGCCATGGTGGGAGAGACTGTGAGGCGGCAGCTGGG
GCCGGAGCCTTTGGAAGTCTGCGCCCTTGTGCCCTGCCTCCACCGAGCCAGCTTGGTCCCTATGGGCTTCCGCACATGCCGCGGGCGGCC
AGGCAACGTGCGTGTCTCTGCCATGTGGCAGAAGTGCTCTTTGTGGCAGTGGCCAGGCAGGGAGTGTCTGCAGTCCTGGTGGGGCTGAGC
CTGAGGCCTTCCAGAAAGCAGGAGCAGCTGTGCTGCACCCCATGTGGGTGACCAGGTCCTTTCTCCTGATAGTCACCTGCTGGTTGTTGC
CAGGTTGCAGCTGCTCTTGCATCTGGGCCAGAAGTCCTCCCTCCTGCAGGCTGGCTGTTGGCCCCTCTGCTGTCCTGCAGTAGAAGGTGC
CGTGAGCAGGCTTTGGGAACACTGGCCTGGGTCTCCCTGGTGGGGTGTGCATGCCACGCCCCGTGTCTGGATGCACAGATGCCATGGCCT
GTGCTGGGCCAGTGGCTGGGGGTGCTAGACACCCGGCACCATTCTCCCTTCTCTCTTTTCTTCTCAGGATTTAAAATTTAATTATATCAG
TAAAGAGATTAATTTTAACGTAACTCTTTCTATGCCCGTGTAAAGTATGTGAATCGCAAGGCCTGTGCTGCATGCGACAGCGTCCGGGGT
GGTGGACAGGGCCCCCGGCCACGCTCCCTCTCCTGTAGCCACTGGCATAGCCCTCCTGAGCACCCGCTGACATTTCCGTTGTACATGTTC
CTGTTTATGCATTCACAAGGTGACTGGGATGTAGAGAGGCGTTAGTGGGCAGGTGGCCACAGCAGGACTGAGGACAGGCCCCCATTATCC
TAGGGGTGCGCTCACCTGCAGCCCCTCCTCCTCGGGCACAGACGACTGTCGTTCTCCACCCACCAGTCAGGGACAGCAGCCTCCCTGTCA
CTCAGCTGAGAAGGCCAGCCCTCCCTGGCTGTGAGCAGCCTCCACTGTGTCCAGAGACATGGGCCTCCCACTCCTGTTCCTTGCTAGCCC
TGGGGTGGCGTCTGCCTAGGAGCTGGCTGGCAGGTGTTGGGACCTGCTGCTCCATGGATGCATGCCCTAAGAGTGTCACTGAGCTGTGTT
TTGTCTGAGCCTCTCTCGGTCAACAGCAAAGCTTGGTGTCTTGGCACTGTTAGTGACAGAGCCCAGCATCCCTTCTGCCCCCGTTCCAGC
TGACATCTTGCACGGTGACCCCTTTTAGTCAGGAGAGTGCAGATCTGTGCTCATCGGAGACTGCCCCACGGCCCTGTCAGAGCCGCCACT
CCTATCCCCAGGCCAGGTCCCTGGACCAGCCTCCTGTTTGCAGGCCCAGAGGAGCCAAGTCATTAAAATGGAAGTGGATTCTGGATGGCC
GGGCTGCTGCTGATGTAGGAGCTGGATTTGGGAGCTCTGCTTGCCGACTGGCTGTGAGACGAGGCAGGGGCTCTGCTTCCTCAGCCCTAG
AGGCGAGCCAGGCAAGGTTGGCGACTGTCATGTGGCTTGGTTTGGTCATGCCCGTCGATGTTTTGGGTATTGAATGTGGTAAGTGGAGGA
AATGTTGGAACTCTGTGCAGGTGCTGCCTTGAGACCCCCAAGCTTCCACCTGTCCCTCTCCTATGTGGCAGCTGGGGAGCAGCTGAGATG
TGGACTTGTATGCTGCCCACATACGTGAGGGGGAGCTGAAAGGGAGCCCCTCCTCTGAGCAGCCTCTGCCAGGCCTGTATGAGGCTTTTC
CCACCAGCTCCCAACAGAGGCCTCCCCCAGCCAGGACCACCTCGTCCTCGTGGCGGGGCAGCAGGAGCGGTAGAAAGGGGTCCGATGTTT
GAGGAGGCCCTTAAGGGAAGCTACTGAATTATAACACGTAAGAAAATCACCATTCCGTATTGGTTGGGGGCTCCTGTTTCTCATCCTAGC
TTTTTCCTGGAAAGCCCGCTAGAAGGTTTGGGAACGAGGGGAAAGTTCTCAGAACTGTTGGCTGCTCCCCACCCGCCTCCCGCCTCCCCC
GCAGGTTATGTCAGCAGCTCTGAGACAGCAGTATCACAGGCCAGATGTTGTTCCTGGCTAGATGTTTACATTTGTAAGAAATAACACTGT
GAATGTAAAACAGAGCCATTCCCTTGGAATGCATATCGCTGGGCTCAACATAGAGTTTGTCTTCCTCTTGTTTACGACGTGATCTAAACC
AGTCCTTAGCAAGGGGCTCAGAACACCCCGCTCTGGCAGTAGGTGTCCCCCACCCCCAAAGACCTGCCTGTGTGCTCCGGAGATGAATAT
GAGCTCATTAGTAAAAATGACTTCACCCACGCATATACATAAAGTATCCATGCATGTGCATATAGACACATCTATAATTTTACACACACA
CCTCTCAAGACGGAGATGCATGGCCTCTAAGAGTGCCCGTGTCGGTTCTTCCTGGAAGTTGACTTTCCTTAGACCCGCCAGGTCAAGTTA
GCCGCGTGACGGACATCCAGGCGTGGGACGTGGTCAGGGCAGGGCTCATTCATTGCCCACTAGGATCCCACTGGCGAAGATGGTCTCCAT
ATCAGCTCTCTGCAGAAGGGAGGAAGACTTTATCATGTTCCTAAAAATCTGTGGCAAGCACCCATCGTATTATCCAAATTTTGTTGCAAA
TGTGATTAATTTGGTTGTCAAGTTTTGGGGGTGGGCTGTGGGGAGATTGCTTTTGTTTTCCTGCTGGTAATATCGGGAAAGATTTTAATG
AAACCAGGGTAGAATTGTTTGGCAATGCACTGAAGCGTGTTTCTTTCCCAAAATGTGCCTCCCTTCCGCTGCGGGCCCAGCTGAGTCTAT
GTAGGTGATGTTTCCAGCTGCCAAGTGCTCTTTGTTACTGTCCACCCTCATTTCTGCCAGCGCATGTGTCCTTTCAAGGGGAAAATGTGA
AGCTGAACCCCCTCCAGACACCCAGAATGTAGCATCTGAGAAGGCCCTGTGCCCTAAAGGACACCCCTCGCCCCCATCTTCATGGAGGGG
GTCATTTCAGAGCCCTCGGAGCCAATGAACAGCTCCTCCTCTTGGAGCTGAGATGAGCCCCACGTGGAGCTCGGGACGGATAGTAGACAG
CAATAACTCGGTGTGTGGCCGCCTGGCAGGTGGAACTTCCTCCCGTTGCGGGGTGGAGTGAGGTTAGTTCTGTGTGTCTGGTGGGTGGAG
TCAGGCTTCTCTTGCTACCTGTGAGCATCCTTCCCAGCAGACATCCTCATCGGGCTTTGTCCCTCCCCCGCTTCCTCCCTCTGCGGGGAG
GACCCGGGACCACAGCTGCTGGCCAGGGTAGACTTGGAGCTGTCCTCCAGAGGGGTCACGTGTAGGAGTGAGAAGAAGGAAGATCTTGAG
AGCTGCTGAGGGACCTTGGAGAGCTCAGGATGGCTCAGACGAGGACACTCGCTTGCCGGGCCTGGGCCTCCTGGGAAGGAGGGAGCTGCT
CAGAATGCCGCATGACAACTGAAGGCAACCTGGAAGGTTCAGGGGCCGCTCTTCCCCCATGTGCCTGTCACGCTCTGGTGCAGTCAAAGG
AACGCCTTCCCCTCAGTTGTTTCTAAGAGCAGAGTCTCCCGCTGCAATCTGGGTGGTAACTGCCAGCCTTGGAGGATCGTGGCCAACGTG
GACCTGCCTACGGAGGGTGGGCTCTGACCCAAGTGGGGCCTCCTTGTCCAGGTCTCACTGCTTTGCACCGTGGTCAGAGGGACTGTCAGC
TGAGCTTGAGCTCCCCTGGAGCCAGCAGGGCTGTGATGGGCGAGTCCCGGAGCCCCACCCAGACCTGAATGCTTCTGAGAGCAAAGGGAA

>In-frame_PCGF3_ENST00000470161_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_11682nt
ATGCTCCGAGCGCGGCGCCCCCGACGCGGCGCTCGGCTCGGCTCGGGCATTTCCGCCTCTTTGTTTTAAACTCCGGACGGGCTTTTTTCT
CCTCCTCTTGGGGGGGACCCAGAGGGAGCGGCGCCCCCTCCCCCCTCCGGCGCGGACCCCGCGTGCGCCTTGCTCGCCCGCAGCCCCGAG
ACCGCAGGCGTCACAATGTAGCAGGGACCCCAGGCGTCGTGCTCAGGTGCCGTTTCTGTGCTAGAAAATGGAAAAAGAGCCAGGGCCGGA
AGGAGGGTGCAGAAGCGAGTCCGCGTGCGGAGCCAGGAGGCAGCGTCGCGTGGGAGTGCTGGCCTGAAGCCTCCATGCCCCGGCAGAGGG
ACGGACACGCGGACGTCTAGCGGAGAAGCCAAAGATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCACCTGCCGCCT
GTGCAGCGGGTACCTCATCGACGCCACCACGGTGACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAA
CAACACCTGCCCCACCTGCAGGATTGTGATCCACCAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTA
CAAATTGGTACCAGGCCTCCAAGAAGCGGAAATGAGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAA
GGGGGAGACCTGCTCTGCAAAACAGCACTTAGATTCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGA
GGAGAAGCCGGAGGAGGACAACGACTACCACCGCAGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGG
ACTGCAGCTGATCATCGATGTGCTGACTCTGAGGAACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGA
CTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCAGAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACG
AGTGCTCAATAATGTTGTCATCCATTTGCTTGGAGATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCC
AAAGCTGTTTTATAAATGTGACCAAGGACAAGCTGATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCAT
GCATGAGACGCAGCCTCCATCTCATTTCTCCGTCAGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGT
CACTATGGAAAATAACCTTTCAAGAGTTATTGCAGCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTG
TGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCAGTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGA
TGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCCACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCA
TCAAGATGCTTTGATTTTGGCCGGAAACTTGCTTGCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAA
CCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCAGCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCT
GAAGGTGATTAACATTTGTGCCCACGTCCTGGATGACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCC
TTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAGAAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGC
CAGTGCAGCTTCTAGACAATCTGATACCTCAGGTCCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATA
CCTCAAACTGCATGATGTCCTGAAAGCTACACACGCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTT
TCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATACTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATA
CCTGAAATCCTGCTTTAGTCGAGAACCAATGATGGCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTC
CCAGTTTGATGGCTTATCTTCCAACCCCAGCAAGTCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCA
CTACTGCTTCATGGCCCCGTACACCCACTTCACCCAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGA
CACCTCGGGATGGTTTGATGTCCTCCAGAAAGTGTCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAA
TGCTATTCATAATCACATTCGTTTGTTTGAACCTCTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAA
GCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAGTTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATT
GAAACAGTTTGAATACATTGAAGTGGGCCAGTTCAGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTA
TGAACGCTATCATTCAAAACAGATCATTGGAATTCCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGAC
ACATGCCATACCGGCTCTGCAGCCCATAGTCCACGACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAAC
CCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGACTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCA
CAAGGAGAATGAAGACAAGTGGAAGCGACTGTCTCGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGA
CTCTCATGAAGCCCTTGGAGTGTTAAATACATTATTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTAT
GTTCGTCACTCCAAACACAATGGCGTCCGTGAGCACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCA
GTCAACTGAAGATATTGTTCTTTCTCGTATTCAGGAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGA
TGGGGACAGTACTTCAACGCTAGAAGAACACAGTGAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACA
ACTGGTTGGTATTCTTTTAGAAGACATTGTTACAAAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACT
AGGCACACTGCTAATGTGTCTGATCCACATCTTCAAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGA
TGGCTGTGGCGGCAGTTTCTACACCCTGGACAGCTTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTG
GTGTCAGATACTGCTGCTTGTCAACCACACCGACTACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCAC
AAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAGGAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAG
AGGGGCTCTCATTCTCTTCTGTGATTATGTCTGTCAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGA
TCTGATCAGCCTTTCCCACGAGCCTCCAGTACAGGACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGC
AATTCAGTCTCGTTGTGAAAACCTTTCAACTCCAACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGG
AGCTGTGCTCACGCTGTATGTGGACAGGCTTCTGTGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGT
AGAAATGCTTCTGGCTGCAAATTTACAGAGCAGCATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAG
CGGGCTCGCTCAGAGACACCAAAGGCTCTATTCCCTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCC
AGTCTCTTCCCACCCGCTGGACGGGGATGGGCACGTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATC
CCAGTGTTGGACCAGGTCAGATTCTGCACTGCTGGAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGAT
GAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCATGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGA
AGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGCGGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGC
AGAGCCGGCGGCCTACTGGAGCAAGTTGAATGATCTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGC
ACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGTCATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAAC
CCTTGAGGCCCTGTCCTGGCATTTGATCCATGAGCAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCT
GCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCCACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGA
GGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTTAGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGT
AGATCCAAACACACAGAATCCTAAGTATATCACTGCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTT
GGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTTCTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAA
CAGCTACACACGTGTGCCCCCACTGGTGTGGAAGCTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCC
CGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAGGAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGA
AACTTGGGCCACCCTCCTTGGTGTCCTGGTGACGCAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGAC
CCAGATCAACGTCCTGGCCGTGCAGGCCATCACCTCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTG
CTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAAGCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCA
AGAGATTCAAGCAATGGTTTCAAAGAGAGAGAATATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGC
TACTACAGGTGCCCTCATCAGCCACGAGAAGCTGCTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCA
GGTGTCCATACACTCCGTGTGGCTGGGGAACAGCATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGC
CCCTGCACCTTCGTCACCACCCACGTCTCCAGTCAACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCT
TGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGCTCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGT
GGTCTCAGACTTGTTCACCGAGCGCAACCAGTTTGAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGA
GATCCTCGCTCAGTACCTGGTGCCTGCCACCTGCAAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCT
GCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCCAGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGA
CGACACTGCCAAGCAGCTCATCCCGGTCATCAGCGACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCA
GCAGCACGTACTGGTCATGTGTGCCACTGCGTTTTACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAAT
ACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAGGAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCT
GCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAATCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCAT
GGCGGCTCTGGGCCTGATGCTCACCTGCATGTACACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCC
CGACAGCGAGTCAGTGATTGTTGCTATGGAGCGGGTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGT
GGCCAGGATCCTGCCCCAGTTTCTAGACGACTTCTTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCA
GCCATACCCCCAGTTCATGGCCACCGTGGTGTATAAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGT
CATGCTGTCCCTCTCCAACTTCACGCAGAGGGCCCCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAG
CCCGTGGGTCGCGGCGATCCTCCCACATGTCATCAGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCAC
AGACTTCTACAGACACCAGATAGAGGAGGAGCTCGACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATA
TCACCGGCTGCTGACTTGTTTACGAAATGTCCACAAGGTCACCACCTGCTGAGCGCCATGGTGGGAGAGACTGTGAGGCGGCAGCTGGGG
CCGGAGCCTTTGGAAGTCTGCGCCCTTGTGCCCTGCCTCCACCGAGCCAGCTTGGTCCCTATGGGCTTCCGCACATGCCGCGGGCGGCCA
GGCAACGTGCGTGTCTCTGCCATGTGGCAGAAGTGCTCTTTGTGGCAGTGGCCAGGCAGGGAGTGTCTGCAGTCCTGGTGGGGCTGAGCC
TGAGGCCTTCCAGAAAGCAGGAGCAGCTGTGCTGCACCCCATGTGGGTGACCAGGTCCTTTCTCCTGATAGTCACCTGCTGGTTGTTGCC
AGGTTGCAGCTGCTCTTGCATCTGGGCCAGAAGTCCTCCCTCCTGCAGGCTGGCTGTTGGCCCCTCTGCTGTCCTGCAGTAGAAGGTGCC
GTGAGCAGGCTTTGGGAACACTGGCCTGGGTCTCCCTGGTGGGGTGTGCATGCCACGCCCCGTGTCTGGATGCACAGATGCCATGGCCTG
TGCTGGGCCAGTGGCTGGGGGTGCTAGACACCCGGCACCATTCTCCCTTCTCTCTTTTCTTCTCAGGATTTAAAATTTAATTATATCAGT
AAAGAGATTAATTTTAACGTAACTCTTTCTATGCCCGTGTAAAGTATGTGAATCGCAAGGCCTGTGCTGCATGCGACAGCGTCCGGGGTG
GTGGACAGGGCCCCCGGCCACGCTCCCTCTCCTGTAGCCACTGGCATAGCCCTCCTGAGCACCCGCTGACATTTCCGTTGTACATGTTCC
TGTTTATGCATTCACAAGGTGACTGGGATGTAGAGAGGCGTTAGTGGGCAGGTGGCCACAGCAGGACTGAGGACAGGCCCCCATTATCCT
AGGGGTGCGCTCACCTGCAGCCCCTCCTCCTCGGGCACAGACGACTGTCGTTCTCCACCCACCAGTCAGGGACAGCAGCCTCCCTGTCAC
TCAGCTGAGAAGGCCAGCCCTCCCTGGCTGTGAGCAGCCTCCACTGTGTCCAGAGACATGGGCCTCCCACTCCTGTTCCTTGCTAGCCCT
GGGGTGGCGTCTGCCTAGGAGCTGGCTGGCAGGTGTTGGGACCTGCTGCTCCATGGATGCATGCCCTAAGAGTGTCACTGAGCTGTGTTT
TGTCTGAGCCTCTCTCGGTCAACAGCAAAGCTTGGTGTCTTGGCACTGTTAGTGACAGAGCCCAGCATCCCTTCTGCCCCCGTTCCAGCT
GACATCTTGCACGGTGACCCCTTTTAGTCAGGAGAGTGCAGATCTGTGCTCATCGGAGACTGCCCCACGGCCCTGTCAGAGCCGCCACTC
CTATCCCCAGGCCAGGTCCCTGGACCAGCCTCCTGTTTGCAGGCCCAGAGGAGCCAAGTCATTAAAATGGAAGTGGATTCTGGATGGCCG
GGCTGCTGCTGATGTAGGAGCTGGATTTGGGAGCTCTGCTTGCCGACTGGCTGTGAGACGAGGCAGGGGCTCTGCTTCCTCAGCCCTAGA
GGCGAGCCAGGCAAGGTTGGCGACTGTCATGTGGCTTGGTTTGGTCATGCCCGTCGATGTTTTGGGTATTGAATGTGGTAAGTGGAGGAA
ATGTTGGAACTCTGTGCAGGTGCTGCCTTGAGACCCCCAAGCTTCCACCTGTCCCTCTCCTATGTGGCAGCTGGGGAGCAGCTGAGATGT
GGACTTGTATGCTGCCCACATACGTGAGGGGGAGCTGAAAGGGAGCCCCTCCTCTGAGCAGCCTCTGCCAGGCCTGTATGAGGCTTTTCC
CACCAGCTCCCAACAGAGGCCTCCCCCAGCCAGGACCACCTCGTCCTCGTGGCGGGGCAGCAGGAGCGGTAGAAAGGGGTCCGATGTTTG
AGGAGGCCCTTAAGGGAAGCTACTGAATTATAACACGTAAGAAAATCACCATTCCGTATTGGTTGGGGGCTCCTGTTTCTCATCCTAGCT
TTTTCCTGGAAAGCCCGCTAGAAGGTTTGGGAACGAGGGGAAAGTTCTCAGAACTGTTGGCTGCTCCCCACCCGCCTCCCGCCTCCCCCG
CAGGTTATGTCAGCAGCTCTGAGACAGCAGTATCACAGGCCAGATGTTGTTCCTGGCTAGATGTTTACATTTGTAAGAAATAACACTGTG
AATGTAAAACAGAGCCATTCCCTTGGAATGCATATCGCTGGGCTCAACATAGAGTTTGTCTTCCTCTTGTTTACGACGTGATCTAAACCA
GTCCTTAGCAAGGGGCTCAGAACACCCCGCTCTGGCAGTAGGTGTCCCCCACCCCCAAAGACCTGCCTGTGTGCTCCGGAGATGAATATG
AGCTCATTAGTAAAAATGACTTCACCCACGCATATACATAAAGTATCCATGCATGTGCATATAGACACATCTATAATTTTACACACACAC
CTCTCAAGACGGAGATGCATGGCCTCTAAGAGTGCCCGTGTCGGTTCTTCCTGGAAGTTGACTTTCCTTAGACCCGCCAGGTCAAGTTAG
CCGCGTGACGGACATCCAGGCGTGGGACGTGGTCAGGGCAGGGCTCATTCATTGCCCACTAGGATCCCACTGGCGAAGATGGTCTCCATA
TCAGCTCTCTGCAGAAGGGAGGAAGACTTTATCATGTTCCTAAAAATCTGTGGCAAGCACCCATCGTATTATCCAAATTTTGTTGCAAAT
GTGATTAATTTGGTTGTCAAGTTTTGGGGGTGGGCTGTGGGGAGATTGCTTTTGTTTTCCTGCTGGTAATATCGGGAAAGATTTTAATGA
AACCAGGGTAGAATTGTTTGGCAATGCACTGAAGCGTGTTTCTTTCCCAAAATGTGCCTCCCTTCCGCTGCGGGCCCAGCTGAGTCTATG
TAGGTGATGTTTCCAGCTGCCAAGTGCTCTTTGTTACTGTCCACCCTCATTTCTGCCAGCGCATGTGTCCTTTCAAGGGGAAAATGTGAA
GCTGAACCCCCTCCAGACACCCAGAATGTAGCATCTGAGAAGGCCCTGTGCCCTAAAGGACACCCCTCGCCCCCATCTTCATGGAGGGGG
TCATTTCAGAGCCCTCGGAGCCAATGAACAGCTCCTCCTCTTGGAGCTGAGATGAGCCCCACGTGGAGCTCGGGACGGATAGTAGACAGC
AATAACTCGGTGTGTGGCCGCCTGGCAGGTGGAACTTCCTCCCGTTGCGGGGTGGAGTGAGGTTAGTTCTGTGTGTCTGGTGGGTGGAGT
CAGGCTTCTCTTGCTACCTGTGAGCATCCTTCCCAGCAGACATCCTCATCGGGCTTTGTCCCTCCCCCGCTTCCTCCCTCTGCGGGGAGG
ACCCGGGACCACAGCTGCTGGCCAGGGTAGACTTGGAGCTGTCCTCCAGAGGGGTCACGTGTAGGAGTGAGAAGAAGGAAGATCTTGAGA
GCTGCTGAGGGACCTTGGAGAGCTCAGGATGGCTCAGACGAGGACACTCGCTTGCCGGGCCTGGGCCTCCTGGGAAGGAGGGAGCTGCTC
AGAATGCCGCATGACAACTGAAGGCAACCTGGAAGGTTCAGGGGCCGCTCTTCCCCCATGTGCCTGTCACGCTCTGGTGCAGTCAAAGGA
ACGCCTTCCCCTCAGTTGTTTCTAAGAGCAGAGTCTCCCGCTGCAATCTGGGTGGTAACTGCCAGCCTTGGAGGATCGTGGCCAACGTGG
ACCTGCCTACGGAGGGTGGGCTCTGACCCAAGTGGGGCCTCCTTGTCCAGGTCTCACTGCTTTGCACCGTGGTCAGAGGGACTGTCAGCT
GAGCTTGAGCTCCCCTGGAGCCAGCAGGGCTGTGATGGGCGAGTCCCGGAGCCCCACCCAGACCTGAATGCTTCTGAGAGCAAAGGGAAG

>In-frame_PCGF3_ENST00000521023_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_12651nt
TTGCTCGCCCGCAGCCCCGAGACCGCAGGCGTCACAATGTAGCAGGGACCCCAGGCGTCGTGCTCAGAAAATGGAAAAAGAGCCAGGGCC
GGAAGGAGGGTGCAGAAGCGAGTCCGCGTGCGGAGCCAGGAGGCAGCGTCGCGTGGGAGTGCTGGCCTGAAGCCTCCATGCCCCGGCAGA
GGGACGGACACGCGGACGTCTAGCGGAGGCTCCCGTGTCCTCAGTATGCATCAGGTCTCCCGAACCTCACAGCCCCGCAGGGAGGAGGAG
AAGGGGAGGATTTGACTTTGGAAGTCTCTGTGACCAGAAGCCAAAGATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACAT
CACCTGCCGCCTGTGCAGCGGGTACCTCATCGACGCCACCACGGTGACCGAGTGTCTGCACACCTCTCAAGCCCGACAAAAGCAGGAACC
AGGACCAGGGGCAGAGACGATCTTGAAGATAAGTCAGAAAAGTCATTTCACGCTAAAGGTCCTGTGGGTGGTGTCAGAGCAGATGAGGCC
TCGCTTAGGAGAGCGAAACACAGGAGAGACCCCACATTCCTCCCACGGAGCAGCAAGGCCAGTAGCCGCTGTGACAGTGCTCACTGCTGG
CAGTTTCCAAATCTCCAGAGGAGTTCCTTAGATCCTTCAAAGGGGAACCTTCCAGTGTGTTCTTCACACCTGATGTGCGTCCTCACACCT
GATGAGTCTGTGCTTTGGTGTTAGAGGACTCACACCTGGGGCTGGACCTGAGTGTTTTTCTAAGTGTGGCTACCGCTGACGGGCAGGTGC
CATCCATCAGGCTGAGGCTCGGCTCTTATGCTAACCTGAGGCCCCATGGCTGGCGGCCCTGCTGGTGTGGACGACCGCTGTGTGCGTCTC
TTGATGGCTGGGGAGCATTTTGTTTAAACAGGATCTTTAAAATGAAGTGTACGCTTATAATACAAGTGATGCTTGTGTATTTCTCACTTT
AGGAAATAAAATATTTGCCAATTTGATAGAATTTTGACTTTAACGTTAATCGTATTTTTAGATATTGGTTAGCATATTTTATGTTAGGTT
ATTTTCATTTGATTTTATCTAGTTGTACGTAGAAGATACTGTCATCTTTTAGGACAAAGTATTGTAAAATTATCTGTTTTAGCCCATGTT
CTGATGACCCACAGCTCTGTCACCTTTGAGCATCATCTCCCCATTCTAAGTTTTTTTCCCACTTAATTCCTAACCCTGCCTCTTTGAGGA
AGCCCATTGACGGGGCAATTAAAACCTTCTCATTGCTCCTGAGACCAGAACGGCAAGATGTTTCCTTTCAGAAGCTGAGAGCCACAAGGA
GGACAGCAGTGAGCATCTGCACAGAAACGAGCTCAGAGACGCCCGTGTTCAGTGGAGCACGCCGATGGGGTGGGCGCCCTGGCTCTAGAC
GCTCTCCTAACACACCTGTGCTTTGATGACAGTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAACACCTGCCCCACCTGCAG
GATTGTGATCCACCAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAGATATTGTTTACAAATTGGTACCAGGCCTCCA
AGAAGCGGAAATGAGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGGGAGACATCAAGGGGGAGACCTGCTCTGCAAA
ACAGCACTTAGATTCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAGAGGCCGCGGAGGAGAAGCCGGAGGAGGACAA
CGACTACCACCGCAGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACAGTGAGTTAGGACTGCAGCTGATCATCGATGT
GCTGACTCTGAGGAACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTGCAGAGATTGACTTCAGGCTGGTGAGCTTTTT
GGAGGCAAAAGCAGAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAACTGCAAGAACGAGTGCTCAATAATGTTGTCAT
CCATTTGCTTGGAGATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTAGGCTTGTCCCAAAGCTGTTTTATAAATGTGA
CCAAGGACAAGCTGATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGAAACTTCTCATGCATGAGACGCAGCCTCCATC
TCATTTCTCCGTCAGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCATAACAGACGTCACTATGGAAAATAACCTTTC
AAGAGTTATTGCAGCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACATTTGGATGCTGTGAAGCTTTGTGTCTTCTTTC
CACTGCCTTCCCAGTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGAGTGCCTCAGATGAGTCTAGGAAGAGCTGTAC
CGTTGGGATGGCCACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATCTCTCAGCCCATCAAGATGCTTTGATTTTGGC
CGGAAACTTGCTTGCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAGAAGAAGCCAACCCAGCAGCCACCAAGCAAGA
GGAGGTCTGGCCAGCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCTCTCACCTGCTGAAGGTGATTAACATTTGTGC
CCACGTCCTGGATGACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAACAAACCCCCCTTCTCTAAGTCCCATCCGACG
AAAGGGGAAGGAGAAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAGGCAGTGAGGCCAGTGCAGCTTCTAGACAATC
TGATACCTCAGGTCCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATCTTCCTTCATACCTCAAACTGCATGATGTCCT
GAAAGCTACACACGCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGTTTGGAGGGTTTCTCCGCTCAGCCTTGGATGT
TCTTTCTCAGATACTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGATCCTAGGATACCTGAAATCCTGCTTTAGTCG
AGAACCAATGATGGCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAAACTTGGCCTCCCAGTTTGATGGCTTATCTTC
CAACCCCAGCAAGTCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAGGCTTGTACCACTACTGCTTCATGGCCCCGTA
CACCCACTTCACCCAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGCAGGAGAACGACACCTCGGGATGGTTTGATGT
CCTCCAGAAAGTGTCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTGCAGATAAGAATGCTATTCATAATCACATTCG
TTTGTTTGAACCTCTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGCAGTTACAGAAGCAGGTTTTAGATTTGCTGGC
GCAGCTGGTTCAGTTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTGGCTTTGTATTGAAACAGTTTGAATACATTGA
AGTGGGCCAGTTCAGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTATTACTATCTTATGAACGCTATCATTCAAAACA
GATCATTGGAATTCCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGAAGGCTGTGACACATGCCATACCGGCTCTGCA
GCCCATAGTCCACGACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAGAGCTTGAAACCCAAAAAGAGGTGGTGGTGTC
AATGTTACTGAGACTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGCAGCAGTGCCACAAGGAGAATGAAGACAAGTG
GAAGCGACTGTCTCGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGATGCACATTGACTCTCATGAAGCCCTTGGAGT
GTTAAATACATTATTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTTTACGGAGTATGTTCGTCACTCCAAACACAAT
GGCGTCCGTGAGCACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTCTGATTTCCCAGTCAACTGAAGATATTGTTCT
TTCTCGTATTCAGGAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATAGGTTAAGAGATGGGGACAGTACTTCAACGCT
AGAAGAACACAGTGAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGTTTCTATTACAACTGGTTGGTATTCTTTTAGA
AGACATTGTTACAAAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATTGCCAGGAACTAGGCACACTGCTAATGTGTCT
GATCCACATCTTCAAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGTTCCGCAGTGATGGCTGTGGCGGCAGTTTCTA
CACCCTGGACAGCTTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGGTGCTGCTCTGGTGTCAGATACTGCTGCTTGT
CAACCACACCGACTACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTCTGTCCAGCACAAAGTTACTTAGTCCCCAGAT
GTCTGGAGAAGAGGAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAATAGTACGAAGAGGGGCTCTCATTCTCTTCTG
TGATTATGTCTGTCAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATCACATTCAAGATCTGATCAGCCTTTCCCACGA
GCCTCCAGTACAGGACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGTTCATCCAGGCAATTCAGTCTCGTTGTGAAAA
CCTTTCAACTCCAACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCAGCCAGTCGGGAGCTGTGCTCACGCTGTATGT
GGACAGGCTTCTGTGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTTGTCGCCGGGTAGAAATGCTTCTGGCTGCAAA
TTTACAGAGCAGCATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACCTTCAGAGCAGCGGGCTCGCTCAGAGACACCA
AAGGCTCTATTCCCTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTCCCTCTCCTCCAGTCTCTTCCCACCCGCTGGA
CGGGGATGGGCACGTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATCTTGTCAAATCCCAGTGTTGGACCAGGTCAGA
TTCTGCACTGCTGGAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATGCCTTCATGATGAACTCGGAGTTCAACCTAAG
CCTGCTAGCTCCATGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTGCCCTTTTTGAAGCAGCCCGTGAGGTGACTCT
GGCCCGTGTGAGCGGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCGAGCTGCCTGCAGAGCCGGCGGCCTACTGGAG
CAAGTTGAATGATCTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCCGGGCCCTGGCACAGTACCTGGTGGTGGTCTC
CAAACTGCCCAGTCATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCGTGGTGGCAACCCTTGAGGCCCTGTCCTGGCA
TTTGATCCATGAGCAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCTGCCTGGCCCTGCAGCTGCCTGGCCTCTGGAG
CGTGGTCTCCTCCACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACTTCATCCTGGAGGCCGTTGCAGTGCAGCCTGG
AGAGCAGCTTCTTAGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGGAGGAGGAAGTAGATCCAAACACACAGAATCC
TAAGTATATCACTGCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGGTGTTGGCCTTGGGTCATAAAAGGAATAGCGG
CGTGCCGGCGTTTCTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGCCCCTTGTCAACAGCTACACACGTGTGCCCCC
ACTGGTGTGGAAGCTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCCCTGAGATCCCCGTGGAGTTCCTCCAGGAAAA
GGAAGTCTTTAAGGAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTCAGTTTGAAGAAACTTGGGCCACCCTCCTTGG
TGTCCTGGTGACGCAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACACAGAGAGGACCCAGATCAACGTCCTGGCCGT
GCAGGCCATCACCTCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAGCTGTAAGCTGCTTGGAGCAGCAGCCCCGGAA
CAAGCCTCTGAAAGCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGATTGTGGAGCAAGAGATTCAAGCAATGGTTTC
AAAGAGAGAGAATATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTCTGTCTCCGGCTACTACAGGTGCCCTCATCAG
CCACGAGAAGCTGCTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACAAACTCGGCCAGGTGTCCATACACTCCGTGTG
GCTGGGGAACAGCATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGGAGGCCGACGCCCCTGCACCTTCGTCACCACC
CACGTCTCCAGTCAACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGCAGTTTTTGCTTGAGTTGTACAGCCGCTGGAT
CCTGCCGTCCAGCTCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGATCCCTTCTAGTGGTCTCAGACTTGTTCACCGA
GCGCAACCAGTTTGAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTTCAGAAGACGAGATCCTCGCTCAGTACCTGGT
GCCTGCCACCTGCAAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTGTCAGCCGCCTGCTGGAGAGCACGCTCAGGAG
CAGCCACCTGCCCAGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCGACCTGCTGGACGACACTGCCAAGCAGCTCAT
CCCGGTCATCAGCGACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACATTCACAGCCAGCAGCACGTACTGGTCATGTG
TGCCACTGCGTTTTACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAGCATCAATAATACAGATGTGTGGGGTGATGCT
GTCTGGAAGTGAGGAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGGAGCGCCTCCTGCTCTCTGAGCAGCTCTCCCG
CCTGGATGCAGAATCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGCACCGGGCCATGGCGGCTCTGGGCCTGATGCT
CACCTGCATGTACACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATCCTGCAGCCCCCGACAGCGAGTCAGTGATTGT
TGCTATGGAGCGGGTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAGCCAGAGTGGTGGCCAGGATCCTGCCCCAGTT
TCTAGACGACTTCTTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGTCCAACCAGCAGCCATACCCCCAGTTCATGGC
CACCGTGGTGTATAAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCCGGGACTGGGTCATGCTGTCCCTCTCCAACTT
CACGCAGAGGGCCCCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCGCGTCCACCAGCCCGTGGGTCGCGGCGATCCT
CCCACATGTCATCAGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCCTGGTCGCCACAGACTTCTACAGACACCAGAT
AGAGGAGGAGCTCGACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAGGAAGCCCATATCACCGGCTGCTGACTTGTTT
ACGAAATGTCCACAAGGTCACCACCTGCTGAGCGCCATGGTGGGAGAGACTGTGAGGCGGCAGCTGGGGCCGGAGCCTTTGGAAGTCTGC
GCCCTTGTGCCCTGCCTCCACCGAGCCAGCTTGGTCCCTATGGGCTTCCGCACATGCCGCGGGCGGCCAGGCAACGTGCGTGTCTCTGCC
ATGTGGCAGAAGTGCTCTTTGTGGCAGTGGCCAGGCAGGGAGTGTCTGCAGTCCTGGTGGGGCTGAGCCTGAGGCCTTCCAGAAAGCAGG
AGCAGCTGTGCTGCACCCCATGTGGGTGACCAGGTCCTTTCTCCTGATAGTCACCTGCTGGTTGTTGCCAGGTTGCAGCTGCTCTTGCAT
CTGGGCCAGAAGTCCTCCCTCCTGCAGGCTGGCTGTTGGCCCCTCTGCTGTCCTGCAGTAGAAGGTGCCGTGAGCAGGCTTTGGGAACAC
TGGCCTGGGTCTCCCTGGTGGGGTGTGCATGCCACGCCCCGTGTCTGGATGCACAGATGCCATGGCCTGTGCTGGGCCAGTGGCTGGGGG
TGCTAGACACCCGGCACCATTCTCCCTTCTCTCTTTTCTTCTCAGGATTTAAAATTTAATTATATCAGTAAAGAGATTAATTTTAACGTA
ACTCTTTCTATGCCCGTGTAAAGTATGTGAATCGCAAGGCCTGTGCTGCATGCGACAGCGTCCGGGGTGGTGGACAGGGCCCCCGGCCAC
GCTCCCTCTCCTGTAGCCACTGGCATAGCCCTCCTGAGCACCCGCTGACATTTCCGTTGTACATGTTCCTGTTTATGCATTCACAAGGTG
ACTGGGATGTAGAGAGGCGTTAGTGGGCAGGTGGCCACAGCAGGACTGAGGACAGGCCCCCATTATCCTAGGGGTGCGCTCACCTGCAGC
CCCTCCTCCTCGGGCACAGACGACTGTCGTTCTCCACCCACCAGTCAGGGACAGCAGCCTCCCTGTCACTCAGCTGAGAAGGCCAGCCCT
CCCTGGCTGTGAGCAGCCTCCACTGTGTCCAGAGACATGGGCCTCCCACTCCTGTTCCTTGCTAGCCCTGGGGTGGCGTCTGCCTAGGAG
CTGGCTGGCAGGTGTTGGGACCTGCTGCTCCATGGATGCATGCCCTAAGAGTGTCACTGAGCTGTGTTTTGTCTGAGCCTCTCTCGGTCA
ACAGCAAAGCTTGGTGTCTTGGCACTGTTAGTGACAGAGCCCAGCATCCCTTCTGCCCCCGTTCCAGCTGACATCTTGCACGGTGACCCC
TTTTAGTCAGGAGAGTGCAGATCTGTGCTCATCGGAGACTGCCCCACGGCCCTGTCAGAGCCGCCACTCCTATCCCCAGGCCAGGTCCCT
GGACCAGCCTCCTGTTTGCAGGCCCAGAGGAGCCAAGTCATTAAAATGGAAGTGGATTCTGGATGGCCGGGCTGCTGCTGATGTAGGAGC
TGGATTTGGGAGCTCTGCTTGCCGACTGGCTGTGAGACGAGGCAGGGGCTCTGCTTCCTCAGCCCTAGAGGCGAGCCAGGCAAGGTTGGC
GACTGTCATGTGGCTTGGTTTGGTCATGCCCGTCGATGTTTTGGGTATTGAATGTGGTAAGTGGAGGAAATGTTGGAACTCTGTGCAGGT
GCTGCCTTGAGACCCCCAAGCTTCCACCTGTCCCTCTCCTATGTGGCAGCTGGGGAGCAGCTGAGATGTGGACTTGTATGCTGCCCACAT
ACGTGAGGGGGAGCTGAAAGGGAGCCCCTCCTCTGAGCAGCCTCTGCCAGGCCTGTATGAGGCTTTTCCCACCAGCTCCCAACAGAGGCC
TCCCCCAGCCAGGACCACCTCGTCCTCGTGGCGGGGCAGCAGGAGCGGTAGAAAGGGGTCCGATGTTTGAGGAGGCCCTTAAGGGAAGCT
ACTGAATTATAACACGTAAGAAAATCACCATTCCGTATTGGTTGGGGGCTCCTGTTTCTCATCCTAGCTTTTTCCTGGAAAGCCCGCTAG
AAGGTTTGGGAACGAGGGGAAAGTTCTCAGAACTGTTGGCTGCTCCCCACCCGCCTCCCGCCTCCCCCGCAGGTTATGTCAGCAGCTCTG
AGACAGCAGTATCACAGGCCAGATGTTGTTCCTGGCTAGATGTTTACATTTGTAAGAAATAACACTGTGAATGTAAAACAGAGCCATTCC
CTTGGAATGCATATCGCTGGGCTCAACATAGAGTTTGTCTTCCTCTTGTTTACGACGTGATCTAAACCAGTCCTTAGCAAGGGGCTCAGA
ACACCCCGCTCTGGCAGTAGGTGTCCCCCACCCCCAAAGACCTGCCTGTGTGCTCCGGAGATGAATATGAGCTCATTAGTAAAAATGACT
TCACCCACGCATATACATAAAGTATCCATGCATGTGCATATAGACACATCTATAATTTTACACACACACCTCTCAAGACGGAGATGCATG
GCCTCTAAGAGTGCCCGTGTCGGTTCTTCCTGGAAGTTGACTTTCCTTAGACCCGCCAGGTCAAGTTAGCCGCGTGACGGACATCCAGGC
GTGGGACGTGGTCAGGGCAGGGCTCATTCATTGCCCACTAGGATCCCACTGGCGAAGATGGTCTCCATATCAGCTCTCTGCAGAAGGGAG
GAAGACTTTATCATGTTCCTAAAAATCTGTGGCAAGCACCCATCGTATTATCCAAATTTTGTTGCAAATGTGATTAATTTGGTTGTCAAG
TTTTGGGGGTGGGCTGTGGGGAGATTGCTTTTGTTTTCCTGCTGGTAATATCGGGAAAGATTTTAATGAAACCAGGGTAGAATTGTTTGG
CAATGCACTGAAGCGTGTTTCTTTCCCAAAATGTGCCTCCCTTCCGCTGCGGGCCCAGCTGAGTCTATGTAGGTGATGTTTCCAGCTGCC
AAGTGCTCTTTGTTACTGTCCACCCTCATTTCTGCCAGCGCATGTGTCCTTTCAAGGGGAAAATGTGAAGCTGAACCCCCTCCAGACACC
CAGAATGTAGCATCTGAGAAGGCCCTGTGCCCTAAAGGACACCCCTCGCCCCCATCTTCATGGAGGGGGTCATTTCAGAGCCCTCGGAGC
CAATGAACAGCTCCTCCTCTTGGAGCTGAGATGAGCCCCACGTGGAGCTCGGGACGGATAGTAGACAGCAATAACTCGGTGTGTGGCCGC
CTGGCAGGTGGAACTTCCTCCCGTTGCGGGGTGGAGTGAGGTTAGTTCTGTGTGTCTGGTGGGTGGAGTCAGGCTTCTCTTGCTACCTGT
GAGCATCCTTCCCAGCAGACATCCTCATCGGGCTTTGTCCCTCCCCCGCTTCCTCCCTCTGCGGGGAGGACCCGGGACCACAGCTGCTGG
CCAGGGTAGACTTGGAGCTGTCCTCCAGAGGGGTCACGTGTAGGAGTGAGAAGAAGGAAGATCTTGAGAGCTGCTGAGGGACCTTGGAGA
GCTCAGGATGGCTCAGACGAGGACACTCGCTTGCCGGGCCTGGGCCTCCTGGGAAGGAGGGAGCTGCTCAGAATGCCGCATGACAACTGA
AGGCAACCTGGAAGGTTCAGGGGCCGCTCTTCCCCCATGTGCCTGTCACGCTCTGGTGCAGTCAAAGGAACGCCTTCCCCTCAGTTGTTT
CTAAGAGCAGAGTCTCCCGCTGCAATCTGGGTGGTAACTGCCAGCCTTGGAGGATCGTGGCCAACGTGGACCTGCCTACGGAGGGTGGGC
TCTGACCCAAGTGGGGCCTCCTTGTCCAGGTCTCACTGCTTTGCACCGTGGTCAGAGGGACTGTCAGCTGAGCTTGAGCTCCCCTGGAGC
CAGCAGGGCTGTGATGGGCGAGTCCCGGAGCCCCACCCAGACCTGAATGCTTCTGAGAGCAAAGGGAAGGACTGACGAGAGATGTATATT

>In-frame_PCGF3_ENST00000505655_chr4_738476_+_HTT_ENST00000355072_chr4_3136128_+_11332nt
CGGCAGAGGGACGGACACGCGGACGTCTAGCGGAGAAGCCAAAGATGTTGACCAGGAAGATCAAGCTGTGGGACATCAACGCCCACATCA
CCTGCCGCCTGTGCAGCGGGTACCTCATCGACGCCACCACGGTGACCGAGTGTCTGCACACCTTCTGCAGGAGCTGCCTGGTGAAGTACC
TGGAGGAGAACAACACCTGCCCCACCTGCAGGATTGTGATCCACCAGAGCCACCCCCTGCAGTACATCGGTCATGACAGAACCATGCAAG
ATATTGTTTACAAATTGGTACCAGGCCTCCAAGAAGCGGAAATGAGAAAGCAGAGGGAGTTCTATCACAAATTGGGCATGGAGGTGCCGG
GAGACATCAAGGGGGAGACCTGCTCTGCAAAACAGCACTTAGATTCCCATCGGAATGGTGAAACCAAAGCAGACGACAGTTCAAACAAAG
AGGCCGCGGAGGAGAAGCCGGAGGAGGACAACGACTACCACCGCAGCGACGAGCAGAACTGTGTCATGAGTCTCTGCAGCAGCAGCTACA
GTGAGTTAGGACTGCAGCTGATCATCGATGTGCTGACTCTGAGGAACAGTTCCTATTGGCTGGTGAGGACAGAGCTTCTGGAAACCCTTG
CAGAGATTGACTTCAGGCTGGTGAGCTTTTTGGAGGCAAAAGCAGAAAACTTACACAGAGGGGCTCATCATTATACAGGGCTTTTAAAAC
TGCAAGAACGAGTGCTCAATAATGTTGTCATCCATTTGCTTGGAGATGAAGACCCCAGGGTGCGACATGTTGCCGCAGCATCACTAATTA
GGCTTGTCCCAAAGCTGTTTTATAAATGTGACCAAGGACAAGCTGATCCAGTAGTGGCCGTGGCAAGAGATCAAAGCAGTGTTTACCTGA
AACTTCTCATGCATGAGACGCAGCCTCCATCTCATTTCTCCGTCAGCACAATAACCAGAATATATAGAGGCTATAACCTACTACCAAGCA
TAACAGACGTCACTATGGAAAATAACCTTTCAAGAGTTATTGCAGCAGTTTCTCATGAACTAATCACATCAACCACCAGAGCACTCACAT
TTGGATGCTGTGAAGCTTTGTGTCTTCTTTCCACTGCCTTCCCAGTTTGCATTTGGAGTTTAGGTTGGCACTGTGGAGTGCCTCCACTGA
GTGCCTCAGATGAGTCTAGGAAGAGCTGTACCGTTGGGATGGCCACAATGATTCTGACCCTGCTCTCGTCAGCTTGGTTCCCATTGGATC
TCTCAGCCCATCAAGATGCTTTGATTTTGGCCGGAAACTTGCTTGCAGCCAGTGCTCCCAAATCTCTGAGAAGTTCATGGGCCTCTGAAG
AAGAAGCCAACCCAGCAGCCACCAAGCAAGAGGAGGTCTGGCCAGCCCTGGGGGACCGGGCCCTGGTGCCCATGGTGGAGCAGCTCTTCT
CTCACCTGCTGAAGGTGATTAACATTTGTGCCCACGTCCTGGATGACGTGGCTCCTGGACCCGCAATAAAGGCAGCCTTGCCTTCTCTAA
CAAACCCCCCTTCTCTAAGTCCCATCCGACGAAAGGGGAAGGAGAAAGAACCAGGAGAACAAGCATCTGTACCGTTGAGTCCCAAGAAAG
GCAGTGAGGCCAGTGCAGCTTCTAGACAATCTGATACCTCAGGTCCTGTTACAACAAGTAAATCCTCATCACTGGGGAGTTTCTATCATC
TTCCTTCATACCTCAAACTGCATGATGTCCTGAAAGCTACACACGCTAACTACAAGGTCACGCTGGATCTTCAGAACAGCACGGAAAAGT
TTGGAGGGTTTCTCCGCTCAGCCTTGGATGTTCTTTCTCAGATACTAGAGCTGGCCACACTGCAGGACATTGGGAAGTGTGTTGAAGAGA
TCCTAGGATACCTGAAATCCTGCTTTAGTCGAGAACCAATGATGGCAACTGTTTGTGTTCAACAATTGTTGAAGACTCTCTTTGGCACAA
ACTTGGCCTCCCAGTTTGATGGCTTATCTTCCAACCCCAGCAAGTCACAAGGCCGAGCACAGCGCCTTGGCTCCTCCAGTGTGAGGCCAG
GCTTGTACCACTACTGCTTCATGGCCCCGTACACCCACTTCACCCAGGCCCTCGCTGACGCCAGCCTGAGGAACATGGTGCAGGCGGAGC
AGGAGAACGACACCTCGGGATGGTTTGATGTCCTCCAGAAAGTGTCTACCCAGTTGAAGACAAACCTCACGAGTGTCACAAAGAACCGTG
CAGATAAGAATGCTATTCATAATCACATTCGTTTGTTTGAACCTCTTGTTATAAAAGCTTTAAAACAGTACACGACTACAACATGTGTGC
AGTTACAGAAGCAGGTTTTAGATTTGCTGGCGCAGCTGGTTCAGTTACGGGTTAATTACTGTCTTCTGGATTCAGATCAGGTGTTTATTG
GCTTTGTATTGAAACAGTTTGAATACATTGAAGTGGGCCAGTTCAGGGAATCAGAGGCAATCATTCCAAACATCTTTTTCTTCTTGGTAT
TACTATCTTATGAACGCTATCATTCAAAACAGATCATTGGAATTCCTAAAATCATTCAGCTCTGTGATGGCATCATGGCCAGTGGAAGGA
AGGCTGTGACACATGCCATACCGGCTCTGCAGCCCATAGTCCACGACCTCTTTGTATTAAGAGGAACAAATAAAGCTGATGCAGGAAAAG
AGCTTGAAACCCAAAAAGAGGTGGTGGTGTCAATGTTACTGAGACTCATCCAGTACCATCAGGTGTTGGAGATGTTCATTCTTGTCCTGC
AGCAGTGCCACAAGGAGAATGAAGACAAGTGGAAGCGACTGTCTCGACAGATAGCTGACATCATCCTCCCAATGTTAGCCAAACAGCAGA
TGCACATTGACTCTCATGAAGCCCTTGGAGTGTTAAATACATTATTTGAGATTTTGGCCCCTTCCTCCCTCCGTCCGGTAGACATGCTTT
TACGGAGTATGTTCGTCACTCCAAACACAATGGCGTCCGTGAGCACTGTTCAACTGTGGATATCGGGAATTCTGGCCATTTTGAGGGTTC
TGATTTCCCAGTCAACTGAAGATATTGTTCTTTCTCGTATTCAGGAGCTCTCCTTCTCTCCGTATTTAATCTCCTGTACAGTAATTAATA
GGTTAAGAGATGGGGACAGTACTTCAACGCTAGAAGAACACAGTGAAGGGAAACAAATAAAGAATTTGCCAGAAGAAACATTTTCAAGGT
TTCTATTACAACTGGTTGGTATTCTTTTAGAAGACATTGTTACAAAACAGCTGAAGGTGGAAATGAGTGAGCAGCAACATACTTTCTATT
GCCAGGAACTAGGCACACTGCTAATGTGTCTGATCCACATCTTCAAGTCTGGAATGTTCCGGAGAATCACAGCAGCTGCCACTAGGCTGT
TCCGCAGTGATGGCTGTGGCGGCAGTTTCTACACCCTGGACAGCTTGAACTTGCGGGCTCGTTCCATGATCACCACCCACCCGGCCCTGG
TGCTGCTCTGGTGTCAGATACTGCTGCTTGTCAACCACACCGACTACCGCTGGTGGGCAGAAGTGCAGCAGACCCCGAAAAGACACAGTC
TGTCCAGCACAAAGTTACTTAGTCCCCAGATGTCTGGAGAAGAGGAGGATTCTGACTTGGCAGCCAAACTTGGAATGTGCAATAGAGAAA
TAGTACGAAGAGGGGCTCTCATTCTCTTCTGTGATTATGTCTGTCAGAACCTCCATGACTCCGAGCACTTAACGTGGCTCATTGTAAATC
ACATTCAAGATCTGATCAGCCTTTCCCACGAGCCTCCAGTACAGGACTTCATCAGTGCCGTTCATCGGAACTCTGCTGCCAGCGGCCTGT
TCATCCAGGCAATTCAGTCTCGTTGTGAAAACCTTTCAACTCCAACCATGCTGAAGAAAACTCTTCAGTGCTTGGAGGGGATCCATCTCA
GCCAGTCGGGAGCTGTGCTCACGCTGTATGTGGACAGGCTTCTGTGCACCCCTTTCCGTGTGCTGGCTCGCATGGTCGACATCCTTGCTT
GTCGCCGGGTAGAAATGCTTCTGGCTGCAAATTTACAGAGCAGCATGGCCCAGTTGCCAATGGAAGAACTCAACAGAATCCAGGAATACC
TTCAGAGCAGCGGGCTCGCTCAGAGACACCAAAGGCTCTATTCCCTGCTGGACAGGTTTCGTCTCTCCACCATGCAAGACTCACTTAGTC
CCTCTCCTCCAGTCTCTTCCCACCCGCTGGACGGGGATGGGCACGTGTCACTGGAAACAGTGAGTCCGGACAAAGACTGGTACGTTCATC
TTGTCAAATCCCAGTGTTGGACCAGGTCAGATTCTGCACTGCTGGAAGGTGCAGAGCTGGTGAATCGGATTCCTGCTGAAGATATGAATG
CCTTCATGATGAACTCGGAGTTCAACCTAAGCCTGCTAGCTCCATGCTTAAGCCTAGGGATGAGTGAAATTTCTGGTGGCCAGAAGAGTG
CCCTTTTTGAAGCAGCCCGTGAGGTGACTCTGGCCCGTGTGAGCGGCACCGTGCAGCAGCTCCCTGCTGTCCATCATGTCTTCCAGCCCG
AGCTGCCTGCAGAGCCGGCGGCCTACTGGAGCAAGTTGAATGATCTGTTTGGGGATGCTGCACTGTATCAGTCCCTGCCCACTCTGGCCC
GGGCCCTGGCACAGTACCTGGTGGTGGTCTCCAAACTGCCCAGTCATTTGCACCTTCCTCCTGAGAAAGAGAAGGACATTGTGAAATTCG
TGGTGGCAACCCTTGAGGCCCTGTCCTGGCATTTGATCCATGAGCAGATCCCGCTGAGTCTGGATCTCCAGGCAGGGCTGGACTGCTGCT
GCCTGGCCCTGCAGCTGCCTGGCCTCTGGAGCGTGGTCTCCTCCACAGAGTTTGTGACCCACGCCTGCTCCCTCATCTACTGTGTGCACT
TCATCCTGGAGGCCGTTGCAGTGCAGCCTGGAGAGCAGCTTCTTAGTCCAGAAAGAAGGACAAATACCCCAAAAGCCATCAGCGAGGAGG
AGGAGGAAGTAGATCCAAACACACAGAATCCTAAGTATATCACTGCAGCCTGTGAGATGGTGGCAGAAATGGTGGAGTCTCTGCAGTCGG
TGTTGGCCTTGGGTCATAAAAGGAATAGCGGCGTGCCGGCGTTTCTCACGCCATTGCTAAGGAACATCATCATCAGCCTGGCCCGCCTGC
CCCTTGTCAACAGCTACACACGTGTGCCCCCACTGGTGTGGAAGCTTGGATGGTCACCCAAACCGGGAGGGGATTTTGGCACAGCATTCC
CTGAGATCCCCGTGGAGTTCCTCCAGGAAAAGGAAGTCTTTAAGGAGTTCATCTACCGCATCAACACACTAGGCTGGACCAGTCGTACTC
AGTTTGAAGAAACTTGGGCCACCCTCCTTGGTGTCCTGGTGACGCAGCCCCTCGTGATGGAGCAGGAGGAGAGCCCACCAGAAGAAGACA
CAGAGAGGACCCAGATCAACGTCCTGGCCGTGCAGGCCATCACCTCACTGGTGCTCAGTGCAATGACTGTGCCTGTGGCCGGCAACCCAG
CTGTAAGCTGCTTGGAGCAGCAGCCCCGGAACAAGCCTCTGAAAGCTCTCGACACCAGGTTTGGGAGGAAGCTGAGCATTATCAGAGGGA
TTGTGGAGCAAGAGATTCAAGCAATGGTTTCAAAGAGAGAGAATATTGCCACCCATCATTTATATCAGGCATGGGATCCTGTCCCTTCTC
TGTCTCCGGCTACTACAGGTGCCCTCATCAGCCACGAGAAGCTGCTGCTACAGATCAACCCCGAGCGGGAGCTGGGGAGCATGAGCTACA
AACTCGGCCAGGTGTCCATACACTCCGTGTGGCTGGGGAACAGCATCACACCCCTGAGGGAGGAGGAATGGGACGAGGAAGAGGAGGAGG
AGGCCGACGCCCCTGCACCTTCGTCACCACCCACGTCTCCAGTCAACTCCAGGAAACACCGGGCTGGAGTTGACATCCACTCCTGTTCGC
AGTTTTTGCTTGAGTTGTACAGCCGCTGGATCCTGCCGTCCAGCTCAGCCAGGAGGACCCCGGCCATCCTGATCAGTGAGGTGGTCAGAT
CCCTTCTAGTGGTCTCAGACTTGTTCACCGAGCGCAACCAGTTTGAGCTGATGTATGTGACGCTGACAGAACTGCGAAGGGTGCACCCTT
CAGAAGACGAGATCCTCGCTCAGTACCTGGTGCCTGCCACCTGCAAGGCAGCTGCCGTCCTTGGGATGGACAAGGCCGTGGCGGAGCCTG
TCAGCCGCCTGCTGGAGAGCACGCTCAGGAGCAGCCACCTGCCCAGCAGGGTTGGAGCCCTGCACGGCGTCCTCTATGTGCTGGAGTGCG
ACCTGCTGGACGACACTGCCAAGCAGCTCATCCCGGTCATCAGCGACTATCTCCTCTCCAACCTGAAAGGGATCGCCCACTGCGTGAACA
TTCACAGCCAGCAGCACGTACTGGTCATGTGTGCCACTGCGTTTTACCTCATTGAGAACTATCCTCTGGACGTAGGGCCGGAATTTTCAG
CATCAATAATACAGATGTGTGGGGTGATGCTGTCTGGAAGTGAGGAGTCCACCCCCTCCATCATTTACCACTGTGCCCTCAGAGGCCTGG
AGCGCCTCCTGCTCTCTGAGCAGCTCTCCCGCCTGGATGCAGAATCGCTGGTCAAGCTGAGTGTGGACAGAGTGAACGTGCACAGCCCGC
ACCGGGCCATGGCGGCTCTGGGCCTGATGCTCACCTGCATGTACACAGGAAAGGAGAAAGTCAGTCCGGGTAGAACTTCAGACCCTAATC
CTGCAGCCCCCGACAGCGAGTCAGTGATTGTTGCTATGGAGCGGGTATCTGTTCTTTTTGATAGGATCAGGAAAGGCTTTCCTTGTGAAG
CCAGAGTGGTGGCCAGGATCCTGCCCCAGTTTCTAGACGACTTCTTCCCACCCCAGGACATCATGAACAAAGTCATCGGAGAGTTTCTGT
CCAACCAGCAGCCATACCCCCAGTTCATGGCCACCGTGGTGTATAAGGTGTTTCAGACTCTGCACAGCACCGGGCAGTCGTCCATGGTCC
GGGACTGGGTCATGCTGTCCCTCTCCAACTTCACGCAGAGGGCCCCGGTCGCCATGGCCACGTGGAGCCTCTCCTGCTTCTTTGTCAGCG
CGTCCACCAGCCCGTGGGTCGCGGCGATCCTCCCACATGTCATCAGCAGGATGGGCAAGCTGGAGCAGGTGGACGTGAACCTTTTCTGCC
TGGTCGCCACAGACTTCTACAGACACCAGATAGAGGAGGAGCTCGACCGCAGGGCCTTCCAGTCTGTGCTTGAGGTGGTTGCAGCCCCAG
GAAGCCCATATCACCGGCTGCTGACTTGTTTACGAAATGTCCACAAGGTCACCACCTGCTGAGCGCCATGGTGGGAGAGACTGTGAGGCG
GCAGCTGGGGCCGGAGCCTTTGGAAGTCTGCGCCCTTGTGCCCTGCCTCCACCGAGCCAGCTTGGTCCCTATGGGCTTCCGCACATGCCG
CGGGCGGCCAGGCAACGTGCGTGTCTCTGCCATGTGGCAGAAGTGCTCTTTGTGGCAGTGGCCAGGCAGGGAGTGTCTGCAGTCCTGGTG
GGGCTGAGCCTGAGGCCTTCCAGAAAGCAGGAGCAGCTGTGCTGCACCCCATGTGGGTGACCAGGTCCTTTCTCCTGATAGTCACCTGCT
GGTTGTTGCCAGGTTGCAGCTGCTCTTGCATCTGGGCCAGAAGTCCTCCCTCCTGCAGGCTGGCTGTTGGCCCCTCTGCTGTCCTGCAGT
AGAAGGTGCCGTGAGCAGGCTTTGGGAACACTGGCCTGGGTCTCCCTGGTGGGGTGTGCATGCCACGCCCCGTGTCTGGATGCACAGATG
CCATGGCCTGTGCTGGGCCAGTGGCTGGGGGTGCTAGACACCCGGCACCATTCTCCCTTCTCTCTTTTCTTCTCAGGATTTAAAATTTAA
TTATATCAGTAAAGAGATTAATTTTAACGTAACTCTTTCTATGCCCGTGTAAAGTATGTGAATCGCAAGGCCTGTGCTGCATGCGACAGC
GTCCGGGGTGGTGGACAGGGCCCCCGGCCACGCTCCCTCTCCTGTAGCCACTGGCATAGCCCTCCTGAGCACCCGCTGACATTTCCGTTG
TACATGTTCCTGTTTATGCATTCACAAGGTGACTGGGATGTAGAGAGGCGTTAGTGGGCAGGTGGCCACAGCAGGACTGAGGACAGGCCC
CCATTATCCTAGGGGTGCGCTCACCTGCAGCCCCTCCTCCTCGGGCACAGACGACTGTCGTTCTCCACCCACCAGTCAGGGACAGCAGCC
TCCCTGTCACTCAGCTGAGAAGGCCAGCCCTCCCTGGCTGTGAGCAGCCTCCACTGTGTCCAGAGACATGGGCCTCCCACTCCTGTTCCT
TGCTAGCCCTGGGGTGGCGTCTGCCTAGGAGCTGGCTGGCAGGTGTTGGGACCTGCTGCTCCATGGATGCATGCCCTAAGAGTGTCACTG
AGCTGTGTTTTGTCTGAGCCTCTCTCGGTCAACAGCAAAGCTTGGTGTCTTGGCACTGTTAGTGACAGAGCCCAGCATCCCTTCTGCCCC
CGTTCCAGCTGACATCTTGCACGGTGACCCCTTTTAGTCAGGAGAGTGCAGATCTGTGCTCATCGGAGACTGCCCCACGGCCCTGTCAGA
GCCGCCACTCCTATCCCCAGGCCAGGTCCCTGGACCAGCCTCCTGTTTGCAGGCCCAGAGGAGCCAAGTCATTAAAATGGAAGTGGATTC
TGGATGGCCGGGCTGCTGCTGATGTAGGAGCTGGATTTGGGAGCTCTGCTTGCCGACTGGCTGTGAGACGAGGCAGGGGCTCTGCTTCCT
CAGCCCTAGAGGCGAGCCAGGCAAGGTTGGCGACTGTCATGTGGCTTGGTTTGGTCATGCCCGTCGATGTTTTGGGTATTGAATGTGGTA
AGTGGAGGAAATGTTGGAACTCTGTGCAGGTGCTGCCTTGAGACCCCCAAGCTTCCACCTGTCCCTCTCCTATGTGGCAGCTGGGGAGCA
GCTGAGATGTGGACTTGTATGCTGCCCACATACGTGAGGGGGAGCTGAAAGGGAGCCCCTCCTCTGAGCAGCCTCTGCCAGGCCTGTATG
AGGCTTTTCCCACCAGCTCCCAACAGAGGCCTCCCCCAGCCAGGACCACCTCGTCCTCGTGGCGGGGCAGCAGGAGCGGTAGAAAGGGGT
CCGATGTTTGAGGAGGCCCTTAAGGGAAGCTACTGAATTATAACACGTAAGAAAATCACCATTCCGTATTGGTTGGGGGCTCCTGTTTCT
CATCCTAGCTTTTTCCTGGAAAGCCCGCTAGAAGGTTTGGGAACGAGGGGAAAGTTCTCAGAACTGTTGGCTGCTCCCCACCCGCCTCCC
GCCTCCCCCGCAGGTTATGTCAGCAGCTCTGAGACAGCAGTATCACAGGCCAGATGTTGTTCCTGGCTAGATGTTTACATTTGTAAGAAA
TAACACTGTGAATGTAAAACAGAGCCATTCCCTTGGAATGCATATCGCTGGGCTCAACATAGAGTTTGTCTTCCTCTTGTTTACGACGTG
ATCTAAACCAGTCCTTAGCAAGGGGCTCAGAACACCCCGCTCTGGCAGTAGGTGTCCCCCACCCCCAAAGACCTGCCTGTGTGCTCCGGA
GATGAATATGAGCTCATTAGTAAAAATGACTTCACCCACGCATATACATAAAGTATCCATGCATGTGCATATAGACACATCTATAATTTT
ACACACACACCTCTCAAGACGGAGATGCATGGCCTCTAAGAGTGCCCGTGTCGGTTCTTCCTGGAAGTTGACTTTCCTTAGACCCGCCAG
GTCAAGTTAGCCGCGTGACGGACATCCAGGCGTGGGACGTGGTCAGGGCAGGGCTCATTCATTGCCCACTAGGATCCCACTGGCGAAGAT
GGTCTCCATATCAGCTCTCTGCAGAAGGGAGGAAGACTTTATCATGTTCCTAAAAATCTGTGGCAAGCACCCATCGTATTATCCAAATTT
TGTTGCAAATGTGATTAATTTGGTTGTCAAGTTTTGGGGGTGGGCTGTGGGGAGATTGCTTTTGTTTTCCTGCTGGTAATATCGGGAAAG
ATTTTAATGAAACCAGGGTAGAATTGTTTGGCAATGCACTGAAGCGTGTTTCTTTCCCAAAATGTGCCTCCCTTCCGCTGCGGGCCCAGC
TGAGTCTATGTAGGTGATGTTTCCAGCTGCCAAGTGCTCTTTGTTACTGTCCACCCTCATTTCTGCCAGCGCATGTGTCCTTTCAAGGGG
AAAATGTGAAGCTGAACCCCCTCCAGACACCCAGAATGTAGCATCTGAGAAGGCCCTGTGCCCTAAAGGACACCCCTCGCCCCCATCTTC
ATGGAGGGGGTCATTTCAGAGCCCTCGGAGCCAATGAACAGCTCCTCCTCTTGGAGCTGAGATGAGCCCCACGTGGAGCTCGGGACGGAT
AGTAGACAGCAATAACTCGGTGTGTGGCCGCCTGGCAGGTGGAACTTCCTCCCGTTGCGGGGTGGAGTGAGGTTAGTTCTGTGTGTCTGG
TGGGTGGAGTCAGGCTTCTCTTGCTACCTGTGAGCATCCTTCCCAGCAGACATCCTCATCGGGCTTTGTCCCTCCCCCGCTTCCTCCCTC
TGCGGGGAGGACCCGGGACCACAGCTGCTGGCCAGGGTAGACTTGGAGCTGTCCTCCAGAGGGGTCACGTGTAGGAGTGAGAAGAAGGAA
GATCTTGAGAGCTGCTGAGGGACCTTGGAGAGCTCAGGATGGCTCAGACGAGGACACTCGCTTGCCGGGCCTGGGCCTCCTGGGAAGGAG
GGAGCTGCTCAGAATGCCGCATGACAACTGAAGGCAACCTGGAAGGTTCAGGGGCCGCTCTTCCCCCATGTGCCTGTCACGCTCTGGTGC
AGTCAAAGGAACGCCTTCCCCTCAGTTGTTTCTAAGAGCAGAGTCTCCCGCTGCAATCTGGGTGGTAACTGCCAGCCTTGGAGGATCGTG
GCCAACGTGGACCTGCCTACGGAGGGTGGGCTCTGACCCAAGTGGGGCCTCCTTGTCCAGGTCTCACTGCTTTGCACCGTGGTCAGAGGG
ACTGTCAGCTGAGCTTGAGCTCCCCTGGAGCCAGCAGGGCTGTGATGGGCGAGTCCCGGAGCCCCACCCAGACCTGAATGCTTCTGAGAG


Top

FusionGenePPI for PCGF3_HTT


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCGF3RNF2, RING1, RYBP, YAF2, CBX4, MGA, BCORL1, KDM2B, USP7, AUTS2, FBRS, FBRSL1, CSNK2A1, CSNK2A2, CSNK2B, HSP90AA1, CBX8, CBX7, CBX6, BCOR, BMI1, TRIM9, DZIP3, UBE2C, PHC2, PCGF3, UBE2D3, DCAF7, UBE2E3, KIAA0430, HELZ, CREBBP, EIF4ENIF1, ARID3A, SOWAHA, PAN2, NISCH, RB1, TRIM25HTTSETD2, HAP1, ZDHHC17, HYPK, TRIP10, NEUROD1, PRPF40A, PRPF40B, MAGEA3, FICD, UBE2K, AP2A2, OPTN, HYPM, CREBBP, SH3GL3, SP1, MAP3K10, HIP1, EGFR, GRB2, RASA1, TCERG1, TP53, PACSIN1, F8A1, NCOR1, CTBP1, AGO2, KAT2B, SYVN1, AMFR, VCP, CHUK, IKBKB, HSPA8, TRAF6, UBQLN1, IKBKG, AXIN1, CTNNB1, GAPDH, SIAH1, MED31, CRMP1, FEZ1, GIT1, CHD3, ECH1, IKBKAP, XRCC6, PFN2, PIAS4, GPRASP2, UTP14A, DNALI1, GRM1, HSP90AB1, DNAJB1, DNAJA1, HBS1L, TUBA1A, TUBB, PSMC5, ATG5, SQSTM1, NBR1, MAP1LC3A, HTT, TAF4, PIAS1, ZNF451, HOXC4, EVL, UBAC1, HMG20A, ERCC6L, FTL, TTC23, RNF20, HEY2, ZNF655, PIK3R1, ZFYVE19, GOLPH3L, MAGEB18, MRFAP1, UBE2E3, ZMAT2, DUSP10, MRFAP1L1, GGA2, ING5, IFT20, HEYL, TACC1, MBD4, DPPA4, ETV4, MAGEB6, MED21, HIST1H3H, PEX11B, MBD1, TRAFD1, HOXC11, OSTF1, NUPL1, XAGE3, PTGES2, MIPEP, PSMB7, NME4, RPL4, ZFC3H1, UPF3A, CCDC126, HMGA1, FAM71F1, RCN2, USP8, MGRN1, PML, ITCH, USP14, MID1, RPS6KB1, PPP2CA, CREB1, HLA-B, PRMT2, ULK1, RFXANK, LLGL1, MAPK3, KIF23, BAG3, RAPGEF2, HUWE1, MORC3, UBQLN2, RAB30, SNX21, SYT12, MPP1, NPY2R, OPRM1, CRYL1, IL17RA, C5AR2, TKT, RHEB, MTOR


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneHTTchr4:738476chr4:3136128ENST00000355072+1767491_5028313143ZDHHC17


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PCGF3_HTT


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PCGF3_HTT


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneHTTC0020179Huntington Disease9CTD_human;ORPHANET
TgeneHTTC0011570Mental Depression4PSYGENET
TgeneHTTC0011581Depressive disorder4HPO;PSYGENET
TgeneHTTC0525045Mood Disorders2PSYGENET
TgeneHTTC0006635Cadmium poisoning1CTD_human
TgeneHTTC0026650Movement Disorders1CTD_human;HPO
TgeneHTTC0677050Manganese Poisoning1CTD_human