FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26207

FusionGeneSummary for PCDHGC3_QKI

check button Fusion gene summary
Fusion gene informationFusion gene name: PCDHGC3_QKI
Fusion gene ID: 26207
HgeneTgene
Gene symbol

PCDHGC3

QKI

Gene ID

5098

9444

Gene nameprotocadherin gamma subfamily C, 3QKI, KH domain containing RNA binding
SynonymsPC43|PCDH-GAMMA-C3|PCDH2Hqk|QK|QK1|QK3|hqkI
Cytomap

5q31.3

6q26

Type of geneprotein-codingprotein-coding
Descriptionprotocadherin gamma-C3cadherin-like 2protocadherin 43protocadherin-2protein quakingQKI/LOC100132735 fusionRNA binding protein HQKhomolog of mouse quaking QKI (KH domain RNA binding protein)quaking homolog, KH domain RNA binding
Modification date2018052320180522
UniProtAcc

Q9UN70

Q96PU8

Ensembl transtripts involved in fusion geneENST00000308177, ENST00000275262, 
ENST00000392127, ENST00000453779, 
ENST00000361752, ENST00000361195, 
ENST00000424802, 
Fusion gene scores* DoF score1 X 1 X 1=113 X 14 X 6=1092
# samples 118
** MAII scorelog2(1/1*10)=3.32192809488736log2(18/1092*10)=-2.60090404459018
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PCDHGC3 [Title/Abstract] AND QKI [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0129-01APCDHGC3chr5

140858113

+QKIchr6

163956014

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308177ENST00000275262PCDHGC3chr5

140858113

+QKIchr6

163956014

+
In-frameENST00000308177ENST00000392127PCDHGC3chr5

140858113

+QKIchr6

163956014

+
In-frameENST00000308177ENST00000453779PCDHGC3chr5

140858113

+QKIchr6

163956014

+
In-frameENST00000308177ENST00000361752PCDHGC3chr5

140858113

+QKIchr6

163956014

+
In-frameENST00000308177ENST00000361195PCDHGC3chr5

140858113

+QKIchr6

163956014

+
In-frameENST00000308177ENST00000424802PCDHGC3chr5

140858113

+QKIchr6

163956014

+

Top

FusionProtFeatures for PCDHGC3_QKI


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PCDHGC3

Q9UN70

QKI

Q96PU8

Potential calcium-dependent cell-adhesion protein. Maybe involved in the establishment and maintenance of specificneuronal connections in the brain.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14136_244810935DomainCadherin 2
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14245_352810935DomainCadherin 3
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+1432_135810935DomainCadherin 1
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14353_457810935DomainCadherin 4
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14458_567810935DomainCadherin 5
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14572_685810935DomainCadherin 6
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+1432_693810935Topological domainExtracellular
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14694_714810935TransmembraneHelical
TgeneQKIchr5:140858113chr6:163956014ENST00000275262+27276_279134326MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000275262+27324_330134326MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000361195+28276_279134334MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000361195+28324_330134334MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000361752+28276_279134342MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000361752+28324_330134342MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000392127+26276_279134320MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000392127+26324_330134320MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000424802+27276_279134318MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000424802+27324_330134318MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000453779+27276_279134320MotifNote=SH3-binding
TgeneQKIchr5:140858113chr6:163956014ENST00000453779+27324_330134320MotifNuclear localization signal
TgeneQKIchr5:140858113chr6:163956014ENST00000275262+27182_213134326RegionQua2 domain%3B involved in RNA binding
TgeneQKIchr5:140858113chr6:163956014ENST00000361195+28182_213134334RegionQua2 domain%3B involved in RNA binding
TgeneQKIchr5:140858113chr6:163956014ENST00000361752+28182_213134342RegionQua2 domain%3B involved in RNA binding
TgeneQKIchr5:140858113chr6:163956014ENST00000392127+26182_213134320RegionQua2 domain%3B involved in RNA binding
TgeneQKIchr5:140858113chr6:163956014ENST00000424802+27182_213134318RegionQua2 domain%3B involved in RNA binding
TgeneQKIchr5:140858113chr6:163956014ENST00000453779+27182_213134320RegionQua2 domain%3B involved in RNA binding

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCDHGC3chr5:140858113chr6:163956014ENST00000308177+14715_934810935Topological domainCytoplasmic
TgeneQKIchr5:140858113chr6:163956014ENST00000275262+2787_153134326DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000361195+2887_153134334DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000361752+2887_153134342DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000392127+2687_153134320DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000424802+2787_153134318DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000453779+2787_153134320DomainNote=KH
TgeneQKIchr5:140858113chr6:163956014ENST00000275262+2711_82134326RegionQua1 domain%3B involved in homodimerization
TgeneQKIchr5:140858113chr6:163956014ENST00000361195+2811_82134334RegionQua1 domain%3B involved in homodimerization
TgeneQKIchr5:140858113chr6:163956014ENST00000361752+2811_82134342RegionQua1 domain%3B involved in homodimerization
TgeneQKIchr5:140858113chr6:163956014ENST00000392127+2611_82134320RegionQua1 domain%3B involved in homodimerization
TgeneQKIchr5:140858113chr6:163956014ENST00000424802+2711_82134318RegionQua1 domain%3B involved in homodimerization
TgeneQKIchr5:140858113chr6:163956014ENST00000453779+2711_82134320RegionQua1 domain%3B involved in homodimerization


Top

FusionGeneSequence for PCDHGC3_QKI


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000275262_chr6_163956014_+_1002aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQA
APRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWI

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000392127_chr6_163956014_+_996aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQA
APRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGKF

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000453779_chr6_163956014_+_996aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQA
APRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMA

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361752_chr6_163956014_+_1018aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQA
APRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAV

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361195_chr6_163956014_+_1010aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPTAQAAPRIITGP
APVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHD

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000424802_chr6_163956014_+_994aa
MVPEAWRSGLVSTGRVVGVLLLLGALNKASTVIHYEIPEEREKGFAVGNVVANLGLDLGSLSARRFRVVSGASRRFFEVNRETGEMFVND
RLDREELCGTLPSCTVTLELVVENPLELFSVEVVIQDINDNNPAFPTQEMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYF
ALRVQTREDSTKYAELVLERALDREREPSLQLVLTALDGGTPALSASLPIHIKVLDANDNAPVFNQSLYRARVLEDAPSGTRVVQVLATD
LDEGPNGEIIYSFGSHNRAGVRQLFALDLVTGMLTIKGRLDFEDTKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSVYSP
VPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLKNYFTLKTSADLDRETVPEYNLSITARDAGTPSLSALTIVRVQVSDI
NDNPPQSSQSSYDVYIEENNLPGAPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDNGIVSSLVPLDYEDRREFELTAHIS
DGGTPVLATNISVNIFVTDRNDNAPQVLYPRPGGSSVEMLPRGTSAGHLVSRVVGWDADAGHNAWLSYSLLGSPNQSLFAIGLHTGQIST
ARPVQDTDSPRQTLTVLIKDNGEPSLSTTATLTVSVTEDSPEARAEFPSGSAPREQKKNLTFYLLLSLILVSVGFVVTVFGVIIFKVYKW
KQSRDLYRAPVSSLYRTPGPSLHADAVRGGLMSPHLYHQVYLTTDSRRSDPLLKKPGAASPLASRQNTLRSCDPVFYRQVLGAESAPPGQ
EEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPTAQAAPRIITGP
APVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLEWIEMPVMPDI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000275262_chr6_163956014_+_3006nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAGCAACAGCCCAGGCT
GCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTG
ATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATC
TATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGAGTGGATT

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000392127_chr6_163956014_+_2988nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAGCAACAGCCCAGGCT
GCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTG
ATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATC
TATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGGTAAGTTC

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000453779_chr6_163956014_+_2988nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAGCAACAGCCCAGGCT
GCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTG
ATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATC
TATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGGTATGGCT

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361752_chr6_163956014_+_3054nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAGCAACAGCCCAGGCT
GCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTG
ATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATC
TATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGGTGCGGTG

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361195_chr6_163956014_+_3030nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCT
GCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTGATCAGACAAATACAGACCGCTGTC
ATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATCTATACACCCTATGAGTACCCCTAC
ACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGGTGCGGTGGCTACTAAAGTTCGAAGGCACGAT

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000424802_chr6_163956014_+_2982nt
ATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCTTGAACAAGGCTTCC
ACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTTTGGATCTCGGTAGC
CTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGATGTTTGTGAACGAC
CGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGCTGGAGCTGTTCAGC
GTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCGAGGCCGTGGCTCCG
GGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCCGAAATGAATACTTT
GCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAACGGGAGCCTAGTCTC
CAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGGACGCGAATGACAAT
GCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAGTCCTTGCAACGGAT
CTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCGCCTTAGACCTTGTA
ACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAGACAAGGGCGCCAAT
CCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCTCCGTGTACAGCCCA
GTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGCTGGTGACCTGCGAA
GTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGGATCGGGAGACTGTG
CCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTCAAGTGTCCGACATC
AATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAATACTAAACCTAAGT
GTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAGTGGGTCGCTATTTC
ACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAACAGCTCATATCAGC
GATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCCAGGTCCTATATCCT
CGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCTGGGACGCGGATGCA
GGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTGGTCAAATCAGTACT
GCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGCTCTCCACCACTGCT
ACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGCAGAAAAAAAATCTC
ACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCAAAGTTTACAAGTGG
AAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACGCCGTGCGGGGAGGC
CTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAACCTGGTGCAGCCAGT
CCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCGCCCCTCCCGGACAG
GAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATGCTCAGAACAGAGCA
GAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGAAGAAGATGCAGCTG
ATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCT
GCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTGATCAGACAAATACAGACCGCTGTC
ATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATCTATACACCCTATGAGTACCCCTAC
ACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGAGTGGATTGAAATGCCAGTCATGCCTGATATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000275262_chr6_163956014_+_8545nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAG
CAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTA
CCATAATGCCTTTGATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCG
AAGCTGGTTTAATCTATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTG
TATTAGAGTGGATTGAAATGCCAGTCATGCCTGATATTTCAGCCCATTGACTTGCTGGATGAAGGACTAGAATACAGCAGCTGTTATAAC
ACGACCAGTCAATGTGGAACAAACTGTTTCTGTGCAACCCCTTTGTTTTACCAGACAAAATTTGAATACTTTTTTTCCTGAATTGTATAT
GACCTTGGTGCTGCATGCATGCTGTTGACTTTTAGGACTTTGATCTTTTAAGGTTTTTTTTCCCCAGCATTAATATTGATTTATAAAGAT
TTGAAAATCTTTAATGAACTGGAGAACACTAAGATTTAAACTCGAAAATTCGTTGTTCAAGTAAAGAAAGCCATGATGCTCTGTATGTTA
TCTGTGTGTGTGCATGCACTCAGGTGCCCTTTGTTTCATGAACAAATACATTTCATTGTACATGTTTTCTGTTTAAATCATTGTATAAAG
TAATTGCAGGTCAGAATTATACCACAGAACTGTTTATGAGAGGCTTGTGTCTGTTGCACATTTCTTGAAGCATTTTTAAAATAACATGTA
ACCTGTAACCTTGTTGTTTAAGTTTTCTTTTCTATTAATACTCTGTCCTGTGGTCCCGTGCATGCTCCTTTTCCCAGAACTCCTCTCTGC
TGCACCCACAGCATCTGTTCCCGAGGAGTTATGACTCTTGACTTCCTGCAGGGCTGGGGCTCTTAGCCACCAGCTGCTGTTCCAGCACTT
TCAGCGCAAGATCTCCCTGATTTTGCCACGTGGAATTGTACTTGTATATGATTACCTTATCTAAAATGAATAAGAGGTGATGGACCAGTT
TACTGCTTAGAAATAGCAAGAGGCACTGCAGTAAAACTTGTTTCTCATTGTAAAGCTTCATGTCTTTTGTTTGTTGGAAAATTTTTACTT
ATAGAAACTTAATTATTAGACTGGTAAAATAAAGACCAAAATATGCAGATTTCTAATTGGCATTCATAAGGTGAATAATAATAAGTGCCC
AATGAAAAAATCTATTATGGTTAATTTCATTTCTTGCTTTGCCACCTAAGCAGTAAAACATGATATTGACCACTTGGAGAACTCAGAAAA
TTATTTTAAATTTCTAAGTTATAATAAATTTGCACACAGATAACATGCATGCTATTTATGTCACATCTCACATTAAATTATTTTAAAATA
AGCAGTGCCCTTCAAAACAGATGCAGACATGTGTGTTGGTAGTAGTGAGGAGATTGGTATTAGCATCAAGTCTTCATTGATGACTAATTT
TTAATTCCCTTCCTTTTATCTTTAGGTATGGCTTTCCCAACGAAAGGCTAAGAATTCAAGAACGGTCTTAACTGAACCCTCATCAGATCT
GAATTTAACAAATGCTTAGTCTCAGCAGCCTCCGGGGGAAAAAAGCTTAGCCTAGCAGTCAGTGACTTACTTGCACTTTTTGCACATAGA
TATAAAGTAAAATTATGTTATTAATTTGGTTTAGTCTGTAATATTACACAGTAATGGTAATTTATAAAGGAGTGTATAGTAGTATACTGA
CTGCTAAGTGTACTATACTGTTTGCTTTACTAATCACCTAATTCATTGCAGTTCATACTTATTGACTCAGAGTTTAAAACCACAATCTGT
AGGCTTTAAGAATTGCTTTTAAACCTTTTTAAGTGATAAACTCTTGAAGTGGTCTTAAGGTTAGCAAATAATTGTCTGTATTAAACATGG
CGTTATTTAAGTAGTCCTGCTGCAAGAAAGGCACTTCAGTGAATATGTGACTAGTAAAGCTTAAATATGTTTGGATCTAATAGAGCTCAT
GAAATACTGTAACTTGGGGATTGTAAATGAATGGATACAATAGGTTAAGGCCCAAGATGTTTGAAATGAATGCAATATTAATAGATGCAT
ATATACATGACATATTGTGGTTAATTTTAAAACTACTGTGCCTTAACGTGTTTCTTAAACTTTTGTAGTAAATGAACATTTGAAATCCAT
TTTGATAAACCTGCTGTTAATGTTTTTTCCCCCCTTGTGAATGTTTTCTAACTTTGTCTTGGTAATTGCAATTTAACTAGGTGCGGTGGC
TACTAAAGTTCGAAGGCACGATATGCGTGTCCATCCTTACCAAAGGATTGTGACCGCAGACCGAGGTTAGTTTAGTTCTGCAGTTCTTGT
CTATAAGAAATGCGTTGGGTGTCCATAAAATTTGCAACACCACACCTGATGGAAAAATGTAATTGCTTACCTGCACACAGTTTTTTTTCC
TTTTCTAAATTTGTTTGTGATCATTGACAGATTTAAGGGTTGGGTTTTTTGTTTTGGTTTGGTTTTTTCTCCCTTCATATTTTAACTTAT
TAAATCTTCTATTATTATGTACTATGATTTATTCCTACTAAAACATAAATTAGTCAATTTGGGGAGCTATTAAATTTTGATGTTGCCTCA
GTTATTTTCATTAATAACTTTTGCTAAAATTTACCTTTTAAAAGTTCTGAAATTTGGGGTTGGTATTGCAAAATGAATTGAACGGATGGT
GCTTTAATGAGAGAAGTAAAGGAATATATGCCTCCTGTGTACTTTTGGAGAAAACTGAAGATTTAGTTTCCATTTTTCTTTATAATAAAA
TATTTGAGCCACTGTATAAACATGAGGGTGCACATGTCAAGTACTTAGCTAAAATCAACAAAGTGAGGACTGTGAAGATAACTTTCATGT
AGTTGGATTTTTTTATATAAATTAGAGCGTCAATTCCCTTTTATTCTTACATTCTCTTGCCAAAATGGATCCTTTGATTTTTGTCATTTG
CTGCTAAAATATATTATCTGAAGGTAAACTGTCTCTTGAAGTTCTGTGGTGGTATGAGATCCAGCTGTGTGAATATAATTTTTGACTAAC
CTGTGACTGGAAAATAAGTCTTCATTTTTCTCCTTTACAACTTTTATAATTTGTGTCCTGTATATGCCCTTGGACCCTTTTATAAATTAT
TTTTGCTTATTGAGGAATGGTATTTTCGGTTTATTGACATTGAATTGTTTTCTAAGTTTTTCCATCACAAGATAGGAATATCAAGCATGG
TAGTAAAAAAGGATTTTTTACAAGTTTCTATTATGGCACATTTGTTTCCTACAAATTAAATTGATCAAAGTCTCAAATATTAGTGGAGGA
AAAAGTGCTGGATTTGTACTTCAATTGTACATCTTCTATGAATTTATGAAGGACCTACCTGCTTTATGTGATTACCTTGAGTACTGATGA
TAAATACTAGACACAGCTGTTGTCCACATCAGAAATAACATGCCTTTCCCAAAGACATTGTTAATATTTGTTTAGCATAATCCATAAAGA
ACGTTGAAGACTTTTAAACTAATGTATTCATCACTAACAGTGATTGTTCAGTGAACAAAATAGACCCCAGCTCCGTGGTCGTCTATGAGG
ATGGTATTCCTTGTAAGTGTTCTGTATGAGCACGTCTCATAGGGATGGGGAAGTTTTTTGGAAAGTCACTTGAGTTTTAAAGAAACTGGA
CAATTCCATGAATAATTTGAGGTTTTATTCATATTGCTAATGTCTACAATTGTTCTAAAGAGTATTTTAAAGTAGTTTTTTTCCCCCAGC
TAATCTTTCCCTATGTATGCCCCCTTTTAGGAGATTTCTCACCATTTTGCTTTAACACAATAATTATTGGCCTACTTAATACTCCAGTGC
CTTGAGATAGTTGGACATATTTTAGGAAGATTTTATTGTATTTGGAAAATTACGACACATTCCATGCATGGATCTTTTGTAGTTACGTGT
TTTGATTAGTCCTGTCACTGTTTTTATTTAAAATGCAGTGTCAGCAAACCGAAATGCTCATTTCTTTTTTAGTAACAGAGTACTCGTATA
CTTATCACTGTATGCACTCATTGGGTCTAAGGGAGATGTCTGAAGTCCTTCACTTAAATTATTTTATGATACTACTGTTTTCTCTATTTT
TGAGGTTAAAATTATTTTAAAAAAATATTTTGAAGAGAAGTTTATTAGTATAAGCATTCATTTAATGCAAAAAAACTCAGCCCTTGGACA
TATAACCATGTAATTCTATATGAACGTTTAGAGTACTACATGGTTGACCAATATCTAGTTCTTTACTAAAAGTAAACTCACCTCTTTATA
TATATTTCAAAACTGAATTTGAAGCCTATTAGAGACCAACTGACCTTTTAGTTGTAATGAACTGTATGGTCTTGCATGGTGACACACCTG
TGTAGGAGGCCAAGACTTGGCAGAGGATGTAGTCTAGGTGTCCTGGTATATATAAATGGTCACTCACTTCGTTTATATATTCCACACTCA
GAAAAGAAGTCAGAGTTTTTTCTGAGTAATACAAAAACCATCACTTACATAATTTGTATAAGAAACTTTAAACAGTTTTAATCAAAACTA
TGAGTAACATCAAAAATGCTTTAAGATTCTATATTTTGGAATACCTGTGAAGTAGTATGACTACATCATGTTAAATATTTATTTTCTTCT
ATGATTTTGGAGCAGCAATTTTTATTTTAAATAAAATTCCACTTTTAAGAAATTCAGGGAAGATTTGGTCACATTGAAGATACAGTATTT
TTGTAGTATTTATAAACTGTTCTAAATGATAGACTATAGAAAACATTTTTGTCATATGAAGGTAAATCAGTCCATTATTTTGGATCATTT
AAACTGAACATTACACCTTCTGGGCTTTGATTTATGAAGTGGCACAGAATCTAACTTTGCACTGAATATCTTTTCATTCACATCTCCTCT
GCCTTAGTCACAATGGCAACAGTACAGAAAATTCTATCAAACCTCAGAATATAGTAGAAATAATTAAGCTGTTGAATGAGTCTTAAAAAT
TATACTACTGTTAAGTGGACCAAGTTTGGTGAAGCAGAATGTGACAAAGGTTGATTAAGGAAGGAACAACTCAAGGACATTGGGAATGAT
AACTTTTCCACTTGAGAACTACTTTATGTTTTACTGTAATTTTTAAAGTTTTTTTGTCCTTTTTGTTATTTTGCAAAAGAAAATAGTATT
TACAGGTGGCTTCTTTTAAAATATAAAAATATAAAGCAGGAATGTATATGAAATGTCAGATTTTATTGTATTTGCAGAGTATTAGCTTTG
AAATTGAATAAAGAAAGCTGTTTGTAGTTTTAAAATGCCTTATTGGTATCAATTAGAAATTTCTTCTATTTTTTGATGTACTTAGAGCTT
TTTGAGTGTAGAATTTTAAATGGCAGGATTTTACAGTGTTTACATGCAAGTGCATTTTATAAGTGTTCTATATGTGTAAAATAGTATTTT
CAACTGGAAAGTGTTGGCTAGTGCAAAAGGCCTGGCCATTTTCTGGTTCCCATGATGTTGCCTACACTGCTAGACTACAGTTTAGTATCG

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000392127_chr6_163956014_+_9492nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAG
CAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTA
CCATAATGCCTTTGATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCG
AAGCTGGTTTAATCTATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTG
TATTAGGTAAGTTCTTCTCCCCATGGGGTTAACAACATTCTCTTTATAAATATTTTTGCTCCCTCAGATTTTGAAATGATTTTATCAGTT
TTAGAGAGGCAAGACAAGTTTGCATTAGGGAAGACCGAAAACTAAATTTTGTTTTATTTCAGCCTCTCATAAGGGTTCCCCTTTGAAATA
ATTGCACCTTAAATTTATTCAGATCCACTTTGGTAACTGAGGTTCAGTTTGGTTGGGTAAATCTGTTGTGTACATTTCAACAAATACTTT
TACATTTGACATTACTGAGGTCATTCTGAGTTTTAGGTCCCACCCCATTGGCCCGTCACCTCCATCAGCTCCACTTCTCAAACTTTATTT
GAGATTTATTTTATCTCACAGGTTTGTGTAATTGTTGGAAAATTTTTAAACTTCTAAGTGAAAGTAGTCTGAGCGCTTTATAAAATTCAT
ATTATTGTGTGTGTTTTGTAATATTTGCGATCACTTAAAATATCAGATAAATACAGTCATGCATCGCTTAACAACGGGGATACAGTCTAA
GAATTGCCTTGTCTGGCAGTTTCATCATTTGGTGTACATCATAGAGTGTACTTACACAGACATAGATGATATCGTTTACTACACACCTAG
GCTGTGTGGTATAGCCATTATAATCTTATGGGACCACATAGTATAAGTGGTCCGTTGTTGACCAAAATGTTGTTATGCAGGCATGACTGT
AGTTGTATTCTTAAGATTTTTCAGTTCTTGTGTTTTGGAGTCCTAGTCATATTAAACATGAGAGATACTCTTAATTTCAGTAGTACAGTA
TGGAATAGTTAAATAAATAGCAAATCACTGAATTCAGAATCTCACTTAAGGCAGAAATTAAAATCATAATATAAACGCTTGGTTTTACAT
GAACAAAAAGTGGTGTGCTCGAAAAAGACATTACTGATGCCTTTTTTTTATAGAGTGGATTGAAATGCCAGTCATGCCTGATATTTCAGC
CCATTGACTTGCTGGATGAAGGACTAGAATACAGCAGCTGTTATAACACGACCAGTCAATGTGGAACAAACTGTTTCTGTGCAACCCCTT
TGTTTTACCAGACAAAATTTGAATACTTTTTTTCCTGAATTGTATATGACCTTGGTGCTGCATGCATGCTGTTGACTTTTAGGACTTTGA
TCTTTTAAGGTTTTTTTTCCCCAGCATTAATATTGATTTATAAAGATTTGAAAATCTTTAATGAACTGGAGAACACTAAGATTTAAACTC
GAAAATTCGTTGTTCAAGTAAAGAAAGCCATGATGCTCTGTATGTTATCTGTGTGTGTGCATGCACTCAGGTGCCCTTTGTTTCATGAAC
AAATACATTTCATTGTACATGTTTTCTGTTTAAATCATTGTATAAAGTAATTGCAGGTCAGAATTATACCACAGAACTGTTTATGAGAGG
CTTGTGTCTGTTGCACATTTCTTGAAGCATTTTTAAAATAACATGTAACCTGTAACCTTGTTGTTTAAGTTTTCTTTTCTATTAATACTC
TGTCCTGTGGTCCCGTGCATGCTCCTTTTCCCAGAACTCCTCTCTGCTGCACCCACAGCATCTGTTCCCGAGGAGTTATGACTCTTGACT
TCCTGCAGGGCTGGGGCTCTTAGCCACCAGCTGCTGTTCCAGCACTTTCAGCGCAAGATCTCCCTGATTTTGCCACGTGGAATTGTACTT
GTATATGATTACCTTATCTAAAATGAATAAGAGGTGATGGACCAGTTTACTGCTTAGAAATAGCAAGAGGCACTGCAGTAAAACTTGTTT
CTCATTGTAAAGCTTCATGTCTTTTGTTTGTTGGAAAATTTTTACTTATAGAAACTTAATTATTAGACTGGTAAAATAAAGACCAAAATA
TGCAGATTTCTAATTGGCATTCATAAGGTGAATAATAATAAGTGCCCAATGAAAAAATCTATTATGGTTAATTTCATTTCTTGCTTTGCC
ACCTAAGCAGTAAAACATGATATTGACCACTTGGAGAACTCAGAAAATTATTTTAAATTTCTAAGTTATAATAAATTTGCACACAGATAA
CATGCATGCTATTTATGTCACATCTCACATTAAATTATTTTAAAATAAGCAGTGCCCTTCAAAACAGATGCAGACATGTGTGTTGGTAGT
AGTGAGGAGATTGGTATTAGCATCAAGTCTTCATTGATGACTAATTTTTAATTCCCTTCCTTTTATCTTTAGGTATGGCTTTCCCAACGA
AAGGCTAAGAATTCAAGAACGGTCTTAACTGAACCCTCATCAGATCTGAATTTAACAAATGCTTAGTCTCAGCAGCCTCCGGGGGAAAAA
AGCTTAGCCTAGCAGTCAGTGACTTACTTGCACTTTTTGCACATAGATATAAAGTAAAATTATGTTATTAATTTGGTTTAGTCTGTAATA
TTACACAGTAATGGTAATTTATAAAGGAGTGTATAGTAGTATACTGACTGCTAAGTGTACTATACTGTTTGCTTTACTAATCACCTAATT
CATTGCAGTTCATACTTATTGACTCAGAGTTTAAAACCACAATCTGTAGGCTTTAAGAATTGCTTTTAAACCTTTTTAAGTGATAAACTC
TTGAAGTGGTCTTAAGGTTAGCAAATAATTGTCTGTATTAAACATGGCGTTATTTAAGTAGTCCTGCTGCAAGAAAGGCACTTCAGTGAA
TATGTGACTAGTAAAGCTTAAATATGTTTGGATCTAATAGAGCTCATGAAATACTGTAACTTGGGGATTGTAAATGAATGGATACAATAG
GTTAAGGCCCAAGATGTTTGAAATGAATGCAATATTAATAGATGCATATATACATGACATATTGTGGTTAATTTTAAAACTACTGTGCCT
TAACGTGTTTCTTAAACTTTTGTAGTAAATGAACATTTGAAATCCATTTTGATAAACCTGCTGTTAATGTTTTTTCCCCCCTTGTGAATG
TTTTCTAACTTTGTCTTGGTAATTGCAATTTAACTAGGTGCGGTGGCTACTAAAGTTCGAAGGCACGATATGCGTGTCCATCCTTACCAA
AGGATTGTGACCGCAGACCGAGGTTAGTTTAGTTCTGCAGTTCTTGTCTATAAGAAATGCGTTGGGTGTCCATAAAATTTGCAACACCAC
ACCTGATGGAAAAATGTAATTGCTTACCTGCACACAGTTTTTTTTCCTTTTCTAAATTTGTTTGTGATCATTGACAGATTTAAGGGTTGG
GTTTTTTGTTTTGGTTTGGTTTTTTCTCCCTTCATATTTTAACTTATTAAATCTTCTATTATTATGTACTATGATTTATTCCTACTAAAA
CATAAATTAGTCAATTTGGGGAGCTATTAAATTTTGATGTTGCCTCAGTTATTTTCATTAATAACTTTTGCTAAAATTTACCTTTTAAAA
GTTCTGAAATTTGGGGTTGGTATTGCAAAATGAATTGAACGGATGGTGCTTTAATGAGAGAAGTAAAGGAATATATGCCTCCTGTGTACT
TTTGGAGAAAACTGAAGATTTAGTTTCCATTTTTCTTTATAATAAAATATTTGAGCCACTGTATAAACATGAGGGTGCACATGTCAAGTA
CTTAGCTAAAATCAACAAAGTGAGGACTGTGAAGATAACTTTCATGTAGTTGGATTTTTTTATATAAATTAGAGCGTCAATTCCCTTTTA
TTCTTACATTCTCTTGCCAAAATGGATCCTTTGATTTTTGTCATTTGCTGCTAAAATATATTATCTGAAGGTAAACTGTCTCTTGAAGTT
CTGTGGTGGTATGAGATCCAGCTGTGTGAATATAATTTTTGACTAACCTGTGACTGGAAAATAAGTCTTCATTTTTCTCCTTTACAACTT
TTATAATTTGTGTCCTGTATATGCCCTTGGACCCTTTTATAAATTATTTTTGCTTATTGAGGAATGGTATTTTCGGTTTATTGACATTGA
ATTGTTTTCTAAGTTTTTCCATCACAAGATAGGAATATCAAGCATGGTAGTAAAAAAGGATTTTTTACAAGTTTCTATTATGGCACATTT
GTTTCCTACAAATTAAATTGATCAAAGTCTCAAATATTAGTGGAGGAAAAAGTGCTGGATTTGTACTTCAATTGTACATCTTCTATGAAT
TTATGAAGGACCTACCTGCTTTATGTGATTACCTTGAGTACTGATGATAAATACTAGACACAGCTGTTGTCCACATCAGAAATAACATGC
CTTTCCCAAAGACATTGTTAATATTTGTTTAGCATAATCCATAAAGAACGTTGAAGACTTTTAAACTAATGTATTCATCACTAACAGTGA
TTGTTCAGTGAACAAAATAGACCCCAGCTCCGTGGTCGTCTATGAGGATGGTATTCCTTGTAAGTGTTCTGTATGAGCACGTCTCATAGG
GATGGGGAAGTTTTTTGGAAAGTCACTTGAGTTTTAAAGAAACTGGACAATTCCATGAATAATTTGAGGTTTTATTCATATTGCTAATGT
CTACAATTGTTCTAAAGAGTATTTTAAAGTAGTTTTTTTCCCCCAGCTAATCTTTCCCTATGTATGCCCCCTTTTAGGAGATTTCTCACC
ATTTTGCTTTAACACAATAATTATTGGCCTACTTAATACTCCAGTGCCTTGAGATAGTTGGACATATTTTAGGAAGATTTTATTGTATTT
GGAAAATTACGACACATTCCATGCATGGATCTTTTGTAGTTACGTGTTTTGATTAGTCCTGTCACTGTTTTTATTTAAAATGCAGTGTCA
GCAAACCGAAATGCTCATTTCTTTTTTAGTAACAGAGTACTCGTATACTTATCACTGTATGCACTCATTGGGTCTAAGGGAGATGTCTGA
AGTCCTTCACTTAAATTATTTTATGATACTACTGTTTTCTCTATTTTTGAGGTTAAAATTATTTTAAAAAAATATTTTGAAGAGAAGTTT
ATTAGTATAAGCATTCATTTAATGCAAAAAAACTCAGCCCTTGGACATATAACCATGTAATTCTATATGAACGTTTAGAGTACTACATGG
TTGACCAATATCTAGTTCTTTACTAAAAGTAAACTCACCTCTTTATATATATTTCAAAACTGAATTTGAAGCCTATTAGAGACCAACTGA
CCTTTTAGTTGTAATGAACTGTATGGTCTTGCATGGTGACACACCTGTGTAGGAGGCCAAGACTTGGCAGAGGATGTAGTCTAGGTGTCC
TGGTATATATAAATGGTCACTCACTTCGTTTATATATTCCACACTCAGAAAAGAAGTCAGAGTTTTTTCTGAGTAATACAAAAACCATCA
CTTACATAATTTGTATAAGAAACTTTAAACAGTTTTAATCAAAACTATGAGTAACATCAAAAATGCTTTAAGATTCTATATTTTGGAATA
CCTGTGAAGTAGTATGACTACATCATGTTAAATATTTATTTTCTTCTATGATTTTGGAGCAGCAATTTTTATTTTAAATAAAATTCCACT
TTTAAGAAATTCAGGGAAGATTTGGTCACATTGAAGATACAGTATTTTTGTAGTATTTATAAACTGTTCTAAATGATAGACTATAGAAAA
CATTTTTGTCATATGAAGGTAAATCAGTCCATTATTTTGGATCATTTAAACTGAACATTACACCTTCTGGGCTTTGATTTATGAAGTGGC
ACAGAATCTAACTTTGCACTGAATATCTTTTCATTCACATCTCCTCTGCCTTAGTCACAATGGCAACAGTACAGAAAATTCTATCAAACC
TCAGAATATAGTAGAAATAATTAAGCTGTTGAATGAGTCTTAAAAATTATACTACTGTTAAGTGGACCAAGTTTGGTGAAGCAGAATGTG
ACAAAGGTTGATTAAGGAAGGAACAACTCAAGGACATTGGGAATGATAACTTTTCCACTTGAGAACTACTTTATGTTTTACTGTAATTTT
TAAAGTTTTTTTGTCCTTTTTGTTATTTTGCAAAAGAAAATAGTATTTACAGGTGGCTTCTTTTAAAATATAAAAATATAAAGCAGGAAT
GTATATGAAATGTCAGATTTTATTGTATTTGCAGAGTATTAGCTTTGAAATTGAATAAAGAAAGCTGTTTGTAGTTTTAAAATGCCTTAT
TGGTATCAATTAGAAATTTCTTCTATTTTTTGATGTACTTAGAGCTTTTTGAGTGTAGAATTTTAAATGGCAGGATTTTACAGTGTTTAC
ATGCAAGTGCATTTTATAAGTGTTCTATATGTGTAAAATAGTATTTTCAACTGGAAAGTGTTGGCTAGTGCAAAAGGCCTGGCCATTTTC
TGGTTCCCATGATGTTGCCTACACTGCTAGACTACAGTTTAGTATCGCTTTGTATCATGAGGCCAAGAAATTCCATGTTGTTTGTAAATA

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000453779_chr6_163956014_+_7266nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAG
CAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTA
CCATAATGCCTTTGATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCG
AAGCTGGTTTAATCTATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTG
TATTAGGTATGGCTTTCCCAACGAAAGGCTAAGAATTCAAGAACGGTCTTAACTGAACCCTCATCAGATCTGAATTTAACAAATGCTTAG
TCTCAGCAGCCTCCGGGGGAAAAAAGCTTAGCCTAGCAGTCAGTGACTTACTTGCACTTTTTGCACATAGATATAAAGTAAAATTATGTT
ATTAATTTGGTTTAGTCTGTAATATTACACAGTAATGGTAATTTATAAAGGAGTGTATAGTAGTATACTGACTGCTAAGTGTACTATACT
GTTTGCTTTACTAATCACCTAATTCATTGCAGTTCATACTTATTGACTCAGAGTTTAAAACCACAATCTGTAGGCTTTAAGAATTGCTTT
TAAACCTTTTTAAGTGATAAACTCTTGAAGTGGTCTTAAGGTTAGCAAATAATTGTCTGTATTAAACATGGCGTTATTTAAGTAGTCCTG
CTGCAAGAAAGGCACTTCAGTGAATATGTGACTAGTAAAGCTTAAATATGTTTGGATCTAATAGAGCTCATGAAATACTGTAACTTGGGG
ATTGTAAATGAATGGATACAATAGGTTAAGGCCCAAGATGTTTGAAATGAATGCAATATTAATAGATGCATATATACATGACATATTGTG
GTTAATTTTAAAACTACTGTGCCTTAACGTGTTTCTTAAACTTTTGTAGTAAATGAACATTTGAAATCCATTTTGATAAACCTGCTGTTA
ATGTTTTTTCCCCCCTTGTGAATGTTTTCTAACTTTGTCTTGGTAATTGCAATTTAACTAGGTGCGGTGGCTACTAAAGTTCGAAGGCAC
GATATGCGTGTCCATCCTTACCAAAGGATTGTGACCGCAGACCGAGGTTAGTTTAGTTCTGCAGTTCTTGTCTATAAGAAATGCGTTGGG
TGTCCATAAAATTTGCAACACCACACCTGATGGAAAAATGTAATTGCTTACCTGCACACAGTTTTTTTTCCTTTTCTAAATTTGTTTGTG
ATCATTGACAGATTTAAGGGTTGGGTTTTTTGTTTTGGTTTGGTTTTTTCTCCCTTCATATTTTAACTTATTAAATCTTCTATTATTATG
TACTATGATTTATTCCTACTAAAACATAAATTAGTCAATTTGGGGAGCTATTAAATTTTGATGTTGCCTCAGTTATTTTCATTAATAACT
TTTGCTAAAATTTACCTTTTAAAAGTTCTGAAATTTGGGGTTGGTATTGCAAAATGAATTGAACGGATGGTGCTTTAATGAGAGAAGTAA
AGGAATATATGCCTCCTGTGTACTTTTGGAGAAAACTGAAGATTTAGTTTCCATTTTTCTTTATAATAAAATATTTGAGCCACTGTATAA
ACATGAGGGTGCACATGTCAAGTACTTAGCTAAAATCAACAAAGTGAGGACTGTGAAGATAACTTTCATGTAGTTGGATTTTTTTATATA
AATTAGAGCGTCAATTCCCTTTTATTCTTACATTCTCTTGCCAAAATGGATCCTTTGATTTTTGTCATTTGCTGCTAAAATATATTATCT
GAAGGTAAACTGTCTCTTGAAGTTCTGTGGTGGTATGAGATCCAGCTGTGTGAATATAATTTTTGACTAACCTGTGACTGGAAAATAAGT
CTTCATTTTTCTCCTTTACAACTTTTATAATTTGTGTCCTGTATATGCCCTTGGACCCTTTTATAAATTATTTTTGCTTATTGAGGAATG
GTATTTTCGGTTTATTGACATTGAATTGTTTTCTAAGTTTTTCCATCACAAGATAGGAATATCAAGCATGGTAGTAAAAAAGGATTTTTT
ACAAGTTTCTATTATGGCACATTTGTTTCCTACAAATTAAATTGATCAAAGTCTCAAATATTAGTGGAGGAAAAAGTGCTGGATTTGTAC
TTCAATTGTACATCTTCTATGAATTTATGAAGGACCTACCTGCTTTATGTGATTACCTTGAGTACTGATGATAAATACTAGACACAGCTG
TTGTCCACATCAGAAATAACATGCCTTTCCCAAAGACATTGTTAATATTTGTTTAGCATAATCCATAAAGAACGTTGAAGACTTTTAAAC
TAATGTATTCATCACTAACAGTGATTGTTCAGTGAACAAAATAGACCCCAGCTCCGTGGTCGTCTATGAGGATGGTATTCCTTGTAAGTG
TTCTGTATGAGCACGTCTCATAGGGATGGGGAAGTTTTTTGGAAAGTCACTTGAGTTTTAAAGAAACTGGACAATTCCATGAATAATTTG
AGGTTTTATTCATATTGCTAATGTCTACAATTGTTCTAAAGAGTATTTTAAAGTAGTTTTTTTCCCCCAGCTAATCTTTCCCTATGTATG
CCCCCTTTTAGGAGATTTCTCACCATTTTGCTTTAACACAATAATTATTGGCCTACTTAATACTCCAGTGCCTTGAGATAGTTGGACATA
TTTTAGGAAGATTTTATTGTATTTGGAAAATTACGACACATTCCATGCATGGATCTTTTGTAGTTACGTGTTTTGATTAGTCCTGTCACT
GTTTTTATTTAAAATGCAGTGTCAGCAAACCGAAATGCTCATTTCTTTTTTAGTAACAGAGTACTCGTATACTTATCACTGTATGCACTC
ATTGGGTCTAAGGGAGATGTCTGAAGTCCTTCACTTAAATTATTTTATGATACTACTGTTTTCTCTATTTTTGAGGTTAAAATTATTTTA
AAAAAATATTTTGAAGAGAAGTTTATTAGTATAAGCATTCATTTAATGCAAAAAAACTCAGCCCTTGGACATATAACCATGTAATTCTAT
ATGAACGTTTAGAGTACTACATGGTTGACCAATATCTAGTTCTTTACTAAAAGTAAACTCACCTCTTTATATATATTTCAAAACTGAATT
TGAAGCCTATTAGAGACCAACTGACCTTTTAGTTGTAATGAACTGTATGGTCTTGCATGGTGACACACCTGTGTAGGAGGCCAAGACTTG
GCAGAGGATGTAGTCTAGGTGTCCTGGTATATATAAATGGTCACTCACTTCGTTTATATATTCCACACTCAGAAAAGAAGTCAGAGTTTT
TTCTGAGTAATACAAAAACCATCACTTACATAATTTGTATAAGAAACTTTAAACAGTTTTAATCAAAACTATGAGTAACATCAAAAATGC
TTTAAGATTCTATATTTTGGAATACCTGTGAAGTAGTATGACTACATCATGTTAAATATTTATTTTCTTCTATGATTTTGGAGCAGCAAT
TTTTATTTTAAATAAAATTCCACTTTTAAGAAATTCAGGGAAGATTTGGTCACATTGAAGATACAGTATTTTTGTAGTATTTATAAACTG
TTCTAAATGATAGACTATAGAAAACATTTTTGTCATATGAAGGTAAATCAGTCCATTATTTTGGATCATTTAAACTGAACATTACACCTT
CTGGGCTTTGATTTATGAAGTGGCACAGAATCTAACTTTGCACTGAATATCTTTTCATTCACATCTCCTCTGCCTTAGTCACAATGGCAA
CAGTACAGAAAATTCTATCAAACCTCAGAATATAGTAGAAATAATTAAGCTGTTGAATGAGTCTTAAAAATTATACTACTGTTAAGTGGA
CCAAGTTTGGTGAAGCAGAATGTGACAAAGGTTGATTAAGGAAGGAACAACTCAAGGACATTGGGAATGATAACTTTTCCACTTGAGAAC
TACTTTATGTTTTACTGTAATTTTTAAAGTTTTTTTGTCCTTTTTGTTATTTTGCAAAAGAAAATAGTATTTACAGGTGGCTTCTTTTAA
AATATAAAAATATAAAGCAGGAATGTATATGAAATGTCAGATTTTATTGTATTTGCAGAGTATTAGCTTTGAAATTGAATAAAGAAAGCT
GTTTGTAGTTTTAAAATGCCTTATTGGTATCAATTAGAAATTTCTTCTATTTTTTGATGTACTTAGAGCTTTTTGAGTGTAGAATTTTAA
ATGGCAGGATTTTACAGTGTTTACATGCAAGTGCATTTTATAAGTGTTCTATATGTGTAAAATAGTATTTTCAACTGGAAAGTGTTGGCT
AGTGCAAAAGGCCTGGCCATTTTCTGGTTCCCATGATGTTGCCTACACTGCTAGACTACAGTTTAGTATCGCTTTGTATCATGAGGCCAA

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361752_chr6_163956014_+_11044nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAGCCCTTGCCTTTTCTCTTGCAG
CAACAGCCCAGGCTGCTCCAAGGATCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTA
CCATAATGCCTTTGATCAGACAAATACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCG
AAGCTGGTTTAATCTATACACCCTATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTG
TATTAGGTGCGGTGGCTACTAAAGTTCGAAGGCACGATATGCGTGTCCATCCTTACCAAAGGATTGTGACCGCAGACCGAGCCGCCACCG
GCAACTAACCTATGACCTTCTGACCTCTGAACTCTTCACCCAATGATGACCTGACCATGCCTGCCTGCTGATCAGTTAACTGGTAATCGC
CTTTGCTTGCCTGTCGTCAGTGCAGCGAGCTGAGGCACTTGTCCGTTCGTCTTACCATCTAACCAAACAAAAGACAAAGAAATTGTTGTC
CTCCAACTCAGCTTTTTTTTTTTTTTTTTCCTGTTTGGGTGAAAGTGGTTCTAGAAACTGCACTGAATAGTAGTAAAGCAATAAGGCCCA
ATTCATCCCACAGCACTGATCATCTTTTAATATCCCACCCTAAGCGAACGGTAAGAAGGCCTCTCTTAAGAAGGGGAGACAGATGGTCCT
TAACTACTCAATGACAGAGGCAGTTACTGTGAGAGACTTCTAGGAATCTTTTTCTTCTCATAGCGAAGTCAAAGCTCTCTCTGAATGTAC
TGTGTGATGATGCATCATGCATGAACCTTCGGTCAGGGATATCATTGGTGAAGTGATTTCAAAAAGTATTCAAAATTTGATATGCTGTTT
AGTCACTACAGTGCCCTCAAAGGGCAGAAGTTGCAGCCTTTTTTATATTGCCTGCCAAAATTTGAAGTATTAGAAGAAAGTGTGCCATGA
GAGAAAAACTTAAGGAGTTTTGAAAAGTAATGCAAATAACAAAACTGCAACACTATTTTTAAAAAGATAAATATCTGAGTTAAAATTACT
GAATCTTTATTTTACACCTAAAAAAATATGAGAACAAGGTACATGCATTATGTGTCACATTACTGGGCAAACTGTTCAAGTATTTTTTTT
TAAACCTCCCTGTATAGAAAAAAATCATTAAGGATGTAAAAGCCATGCTTGCCTATTTGCTGTATACATGTAATGAAATTGTAGATAAAG
TGTAGTGCATTGAAACAAATGAACAAAAAGTAGATACTTTTACTATACAAGGGTGCTGGTGCAGAAAAAAATATATATATTTTTGGAAAT
GTAGCATTTTATACTTTCAAGTGTTATAAAAAAAAAGAAAAAGAACAAAGAAACCCTTTATTTCATTAAATGATTTTTTCTGGTGGTTGT
CAAGAAACAAAAGACCAAAAGAGCCTTTTTGTCTTTCTTTTTTATTTTTTAAGTATTGGAATAAGTCTAAAGAAAAGAAAGTGCCTTATT
TTCCTTCATGGTCATTCAGTCAAGTGTCTCATAAAGATCAGCTCCTCCCTCAGAATACAAGTTAATGCATGTTACTCAGTCGCCCAGTAT
GTGAAAGAAGATATGAGGGAGACAAATGAGTTGATAGTTTGAATTATAGGATTTTTGCCACGTTACCTTGATGCAAATTTGCCAAATCTG
ATACTGTGAAAAGATTTGATAACTTTTCTAATGCCTGACTAGTAAGTTTTAAAACATCATTCTTTAAAAGAATAGTTTAATACTTTTGGT
TATTCCAATCTTCAATGTTAACCCAAAGGATTCTGAGATAAAAATTATGTGTCATCTAAACTTCAGTTTACAGACAAAATTAGAGCTTTG
TTTTATTTGGAGAAGGGGGATGCATTCATTTGATTTTGTTTTTTGTTTTTAATTAATTGAATATAATAGGATACCTAGCAAATGTTTTCA
CAAAAGTGAATCTTTGTGATTTTCATTCTAGAAAACAATGTTTTAAATCACCCAAATTTAATCACATGTCTTTATATCATACCAGATAAC
TGGTGTAGTGTATCCTTTTACTGTTTCAATAACCTCTGCCTCCCCCACCCCTTAACTTTAAAAGAATGTGAAAAACTAGCATCATAGTGC
ATATAAATACTCAACCACATTTCAGCTTAAGCTTCTAATTTCTCAAGAAGTTGAAACAGTTAGTTATGTAGTTGAAGCAATTTGTGTGCA
AAGCCTACATCTAAACACTTGAGTGAATAATCATTAACTGCTCAGTACCAGACGTGGCAAATCTCAAGTGACAGTGGACCCCCCCCCCCG
CCCAGCTTATCAACTCGTCCCCTCTTCCACACCTTCCCAGCATCACAGTCAGAGGTCAGCAGGAAGCTGAGTCATTACCTTCTTGGTGAC
CTCCCCCACCATCTTGTCTCACTTGGAAACCGTTGTCAGTTTATTTACTATGCAATAGACATTCATTGTTTTGTATCCAGCTAGCTTTGG
TTTAATATGCCACTGCTTTGTCTTTCTGTTACACATACAGTTTTGATTTATTTACAATATATGCTGTGCCATTTTGATTTTTATATTGTT
TGGTTGGTTGAATAAATTTGCGACACTCAAACACTTGAGGTGATAGTTGTTAAAAACAATACCAGTATTTGATCCAGTTTCATCTCAACT
ATGTTATACCTGGACATTTTAGATGTTTATCAAAGGTCTTTTATGGGGAAGAAAGTAAATGTATGAAATAATAAATGTGTGACATTTATA
GGGAATGTTGGCTCTGAACAAACTTTTGAAAACTTGGTTGACAAAATTTTGGATCAACTGAAAAAAGCATGACTTTTGAAATCTCTGAAT
GCCTTGGTTCTCAGTATTATCATTCTTTATTGAATTTATTTCTTATTAAAATATGTAGTTTTTAAGACTTTTTTTCTGACAGTATTATGT
AATTTTTTAGCGTGGGTAGATGGGAGTGTCGCTTGTATGTTATCGTACAGCTGACATGTATTTTTGTCTATTCTTTATTATCTTAGTTTC
ATGCTATGTATGTACCATAACCAACCTATTGCCTATGAGAAACATGTAAGATAATGTATTTACAGCCATTGTTACAAGTTTATAATGTAT
TTTTCTATCTTGTTTTATATGTATGTTATATAACATTCAAAAAGAATTTTTTTCTTGATTGAGAAAAGGATACAAAATGCAAAATCCACA
ATTTTGATAACTGAAAATTGCCAATTGTTTTGCAGTACTTTATTATATTGGGTGTCTTGTCTTTTTTGGGCTTTTAGTTAGCTAATGAAT
GAATACATTAGACACTTTTGGGTTTTAGTTGGGATTTTACATAGCTTGCATTTTAATTCTTTGGTTCTTTGCTGTTTCTATTAACCCACA
GCATTATTTTAATAAATGTTATAATACCAACCTACTAACTCTGGACTTTGTCTGTTTATTAACCTTTATATGTTTAATTAAAATAAACAA
ATAAAGACAAAAGAATGTAAAGTCTTGAGTTACTGGACTAACCCTGAAGAACGTGACCACAGATAACATAGTGTGACTTGTTTTTATGTT
GTTTGTCAGCTGACAGTTTTGCACACTACTGTTAAAATGGCTTTGGTTATTCTGGTCTTTTAGCTTGGGGGCCGGGGCGGGTGTGGGTGT
AGGTGCAGTAGAGATGGGAACAAAGTAGCCTTTGTTTGAGGCATTCTTCTCTTGCCACTTGCCTTTCAGCATCTGCATTACTAATTCCAC
ACCTTATTTTTCCTTCTCCAAAATAATCACTGTCTGCTCACAGCATCGAGTAAAAAGATACATTGTCATGGTATATACCTGGAGAAACCA
GTTTGATTCTTTGTTGAACCATTTCTTTTAATTTCTGTAAATAAGTAATTTTATGGTCACATTGTAAAGCAGAGAAACTGTTGATATTTT
ACCTTTATTTAGATTTTTGTTTTAACTTGACCTTTTTCCTTTGGAAAGCGTTGAACTTGTTTAGCTAACTACTCCTATTAGGGGAGCTTA
ACTTGGGTAAAGTCAAAGGCCCACTGGCTGTTTCTCATGGTGGCCTGAAGCCCCGCTGCTTTCCAGTGAGGAAAAGAACCCTCAGCACGT
TACTGAGCTTTCCTCAGGTATTTTTTTCTCTGTCACCTACTTTACAAATACAGTCAGACTAAAACATTAAACAAGAAGTTTAAGGGGGAA
TAACATTGGGATTTGAAAAGTTGTATGTGATTAATTTCTTGCATGCAAATCAATTTAAGATTTCTTAAATATCTTCATGCTTTTCTTGGC
TGGAACTTGGGTAAATTAACCTGTAATTATGAATTATTTAGTTTAACTCAAGGTGCATTTTTATTTCACAGATTGATACTTGCTTTTTTC
TGTGAAACAGTTCTCCTAGATACCAAAATCCTCAGGATGAATTTTTGCATTTGTAAATAACAATTTATCTTTGTAAATTACATTTTATTT
ATTTAGAGTTCTAAAATTGAGGGCTGAAATGAATGACATGTAATAGAAGACAAAACTGTACCAATACGCTGTTAACCAATCAGACTGTCC
AGGTATTCTCATTTCATAAATATGTATACACACATATAAATACACAGAGTAGTGTTAGCTGATGTGAGTGATAACAGCGAATCACCATTG
AGATGGTCATTTGGATCATGTAAACAAACCGTGTCATGTCTCTGATGGGAGCGGTGGGTAGTGTACTGTTAGGTGGACAGGTCTTTTAAC
ATGCTACTATTTGTAAAAGTTTCCGTTGCCATAACAGTTCATGTAGTAGTCTGTGAAAATTCGAAGCTGTCTGTCAAGCTGCTAATATAC
AAGTTGTCATGGTACCATGTAACTTAAATTGATGAATTTCTATGCAATTTACTATTCTCTGAAGCCTATGAATGCAGCCTCATCTCATTT
TCAGTTAAGGGTACTTTATGTATAATTATGTCATTGCTGCCTTTTATGTAGGAAATGTAAAAAAGTTTTAAAAGGCGAAAATAACATTAC
AGATTTCATTTTTATACAGGTTACAATATTAAACATGAAACTACCAAATTCCAAGAATAGTAAAATTCTAGAGTCAGTTGATTGATTGAA
ACTATTTGACAAAACAGTTGAAAGCTGAGCTTTCAGTCAAGAAGTTGGTGAAATTAATGTCCTTAAACTTTTCCTTTAGGCAAAATGTCA
GGGAAAACTTAACATGAAAGTAGTTACTCCCATACGCACCAGTGCAGTAGCTCCAGGTGTAAGAGGTCACGAAGGCACCCTGCCCATAAA
ACCAGGATGTGCATACGTACACACAATCGGTGTCTGGTTATGGTTTTCTAAACACTACATAAGGATCTGAATTTTTTAGTGTGCCAAAAG
CAAACGATAGGTTTAAATGAAATTGCTCACTACCAAATCAAGACTCTTCATATATATACGTGTGTGTATATATATATGTCATAACACTTT
CACGTGTGACAGCCTAAGGTTTCTTTAGTTTTAGGATGGGGTGGGGTGGGAGTGGTTTTGCATGTTTGACCAGGATGTGATGCCTGTCTT
TATTCCTTGATAAGAAGTAGCTGTTACAGCATTTCAAGCAAATTATTTTAGGTAGAATAGAACTTACTGCCAAATGATTATTTATTTAGC
AAAAATTATTCTCCAACTTTTCGAATTCACAATTTTTCTAAGTGCATAGAGTAGTTTTTTACATTGTCACGAATTCCTTAATACCTTTAT
TTAAAATGGAAAAAATATGGACAATATTTTAGAAATATGTGCTACACATCTAATTTTATCTGTAGTTTAAGTGATCTAAATTGAGATGCC
TTTGATATGAAGAGATTTACCAACATTATATGCACTCGTGCCTTCAATGTGGAATCAAACTGGTTAACCTCAGCACAGTCCTCTCGTTTC
TGTGTTTCTGCTGCACTAATTGCCAGGGGGTGGGGGAGAAGGCGAATGAATTAATTCATAGTAGAAGGAGGCGATAGGTGCAGCAAAGGG
CAGCCACAGTGTTGATTCCACATTATAATGTTGTTGCCTCTTCTTGGCAAAAGACACCACATTGTGGGAAGATCTCAGCTTCCAGGGTAA
AAGTTAATTTATAACTTAAAAGTGCTATTAAGTTTTTATTACCAAATATATCTTTTATGGTTTATATTGTAGTGGTATGTATGAAACATT
TAAAATTTTACTGTGGAAATTGTGTATATATATATATATAGTCGAAATAGGTGTTCACAGGTCACATGTGAACGGAGAACTGCATGACCG
TACATGAAATGCAATAAACCAACTGGAAAAAGTGCATGTGCTTCATCCTCTCAAGCCAACTGCAGCTGGAAAGTGCTGCTTATCCTCCAC
CCCCAGAAAATGCATGTATCAATATGAGAATAAAGAACGCACACTTTCAATTTTATTGAGGCTTTCAACACTATTTAAAAGAAAATGTAA
GAATTTGACATTCTGGAGTTATTATAACATTAGAAAATGAGCATAACATTCACTCTGATTTTAGCCATTAAGGGAGATTAGTAAACAGAC
TGCTACAGTGTTCCATAGTTGGACTGTGCATCCAAAACATTTTTTTATCTTTAATAAATGGTACAGTTTTTATGTAGTTTTCGAATGTAA
GAAGAAAGGAATGCTGACCAAAACTTGATTTCATCAGCTTCATGAAAAGGACTAGTGTCATTAACCTGTTGAACAGAATTGGTTTATTAA
AAAAATCATTTCCAGTAGTGTGAAACCTTTACGAGTCTTTAACATCTAAATGTTATGACTCCTTGTACCTTAAGTTTTCCAGTCTTTCTT
ATTTATATCATCTCCAAGTACCTCTGGCTCCTTTCCTCTTGCTCACCGGAACCTTAGTTTTCCTCAACAGAATGCTTTGTTAAAGTAGCC
CACAGTTGCAGGATCCATAGCACCGTCGTGCAGACTAGCAGCCCAAAGGTGTGTTTGGTTTGGCTTATACGGTGTTTTGCTTTTTAAACT
ACTTGCCATAATTTAAAAGTGGCAACACTAGACTTAAAAAAAAAAAAGTCTGATTGCCCATATTAGATTTTTTTTTTAATTCTTCACAAA
ATCTGCTCTTCCTGAAAGATCAAAGTGTCTAGAAAGCCCAAACATGTATTCTTAACATAGTAGGCACCAGCTGAAACTGAGTAATTAAAC
GGTCCCCTGAAGCCAAGTATTCCCTGGTTAGTCGCCACCCCACCACTCCTTCCTGTCTCTAGTGTCACACTTGGGCTGTTGATTTTCTTA
CTCTTCTCTTGCTTTAATCCTTCCCCCCGGCTCTCTGGCTCCTGTGGATATCTGTGCTTGTTTCCTGGTCCAGGATGGTGATCTGACTTT
CAAACCAGCTTCTCAAAAGGGGTGACATAAAATCAGTTTTGATGTTTTTCCTCCTGAAAAATCAGATGAATATTTTAGTCACTGTTACTC
ATGCACATTGTGTTCTTATGTTTACAGAAGTGCTTAAGTGAATGGAAGCACTAGACATTTGGATTTCCTTCCTAACGTAATTTTTAATGA
TTACCCCTTTTATACAGTAATTTGTGGTCTTTAGAAAGCAGTTAAACTAATTGACCATCTAATAGTTGTACTATACATATGTCTAAAATA
ATAGTCATGGTAAGTTTGGCATCATATCTTCCCCAAAAAATGTTTATTAAAATTAGATTATTCCAGTTTAATGCTATTTTGTGAACTGTA
TACCCTCTGAAAGCGCTTATTTTTACATGCTACACAACAGTTCCAATTTTAAGGAGTGTCTCCTAAAATTGGGATGAAAATCTACTGTAG
TCTGTTTTAAAGTATGCTATACTATGTTCATTGGTTACTTAACTGGATATTAATATAAAGGTTATTACAAGAAAAATGATGAAGAGCAAA
AGGAGAAGAAAATATTTGCAAGTGAATCCACAATTCTTGCAGAACTATTTGAGTTGATACTAAAGATTTTATGTTCACTCCTTTACCTTA
GAACTGTCAAGCTTGGGAATGAGGAAAGTGCCTTGGCTGTGCTTGAAACCTGAATTTTAGTGCTTCCCTTATTACATTCATTGTTTTCAA
TGATTGATTTATAAAATTAAGACATACTGGTAGTACAAGTTGAAAGTTGGTTTGAATACATTTTAATTAAATGATAATATGTTAATATGC

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000361195_chr6_163956014_+_3171nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAACAGCCCAGGCTGCTCCAAGGA
TCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTGATCAGACAAA
TACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATCTATACACCCT
ATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGGTGCGGTGGCTACTAAAG
TTCGAAGGCACGATATGCGTGTCCATCCTTACCAAAGGATTGTGACCGCAGACCGAGCCGCCACCGGCAACTAACCTATGACCTTCTGAC

>In-frame_PCDHGC3_ENST00000308177_chr5_140858113_+_QKI_ENST00000424802_chr6_163956014_+_3086nt
GTCGGACTCGGCGCCCAGCGCCCAAGCGCTAACCCGCTGAAAGTTTCTCAGCGAAATCTCAGGGACGATCTGGACCCCGCTGAGAGGAAC
TGCTTTTGAGTGAGATGGTCCCAGAGGCCTGGAGGAGCGGACTGGTAAGCACCGGGAGGGTAGTGGGAGTTTTGCTTCTGCTTGGTGCCT
TGAACAAGGCTTCCACGGTCATTCACTATGAGATCCCGGAGGAAAGAGAGAAGGGTTTCGCTGTGGGCAACGTGGTCGCGAACCTTGGTT
TGGATCTCGGTAGCCTCTCAGCCCGCAGGTTCCGGGTGGTGTCTGGAGCTAGCCGAAGATTCTTTGAGGTGAACCGGGAGACCGGAGAGA
TGTTTGTGAACGACCGTCTGGATCGAGAGGAGCTGTGTGGGACACTGCCCTCTTGCACTGTAACTCTGGAGTTGGTAGTGGAGAACCCGC
TGGAGCTGTTCAGCGTGGAAGTGGTGATCCAGGACATCAACGACAACAATCCTGCTTTCCCTACCCAGGAAATGAAATTGGAGATTAGCG
AGGCCGTGGCTCCGGGGACGCGCTTTCCGCTCGAGAGCGCGCACGATCCCGATGTGGGAAGCAACTCTTTACAAACCTATGAGCTGAGCC
GAAATGAATACTTTGCGCTTCGCGTGCAGACGCGGGAGGACAGCACCAAGTACGCGGAGCTGGTGTTGGAGCGCGCCCTGGACCGAGAAC
GGGAGCCTAGTCTCCAGTTAGTGCTGACGGCGTTGGACGGAGGGACCCCAGCTCTCTCCGCCAGCCTGCCTATTCACATCAAGGTGCTGG
ACGCGAATGACAATGCGCCTGTCTTCAACCAGTCCTTGTACCGGGCGCGCGTCCTGGAGGATGCACCCTCCGGCACGCGCGTGGTACAAG
TCCTTGCAACGGATCTGGATGAAGGCCCCAACGGTGAAATTATTTACTCCTTCGGCAGCCACAACCGCGCCGGCGTGCGGCAACTATTCG
CCTTAGACCTTGTAACCGGGATGCTGACAATCAAGGGTCGGCTGGACTTCGAGGACACCAAACTCCATGAGATTTACATCCAGGCCAAAG
ACAAGGGCGCCAATCCCGAAGGAGCACATTGCAAAGTGTTGGTGGAGGTTGTGGATGTGAATGACAACGCCCCGGAGATCACAGTCACCT
CCGTGTACAGCCCAGTACCCGAGGATGCCCCTCTGGGGACTGTCATCGCTTTGCTCAGTGTGACTGACCTGGATGCTGGCGAGAACGGGC
TGGTGACCTGCGAAGTTCCACCGGGTCTCCCTTTCAGCCTTACTTCTTCCCTCAAGAATTACTTCACTTTGAAAACCAGTGCAGACCTGG
ATCGGGAGACTGTGCCAGAATACAACCTCAGCATCACCGCCCGAGACGCCGGAACCCCTTCCCTCTCAGCCCTTACAATAGTGCGTGTTC
AAGTGTCCGACATCAATGACAACCCTCCACAATCTTCTCAATCTTCCTACGACGTTTACATTGAAGAAAACAACCTCCCCGGGGCTCCAA
TACTAAACCTAAGTGTCTGGGACCCCGACGCCCCGCAGAATGCTCGGCTTTCTTTCTTTCTCTTGGAGCAAGGAGCTGAAACCGGGCTAG
TGGGTCGCTATTTCACAATAAATCGTGACAATGGCATAGTGTCATCCTTAGTGCCCCTAGACTATGAGGATCGGCGGGAATTTGAATTAA
CAGCTCATATCAGCGATGGGGGCACCCCGGTCCTAGCCACCAACATCAGCGTGAACATATTTGTCACTGATCGCAATGACAATGCCCCCC
AGGTCCTATATCCTCGGCCAGGTGGGAGCTCGGTGGAGATGCTGCCTCGAGGTACCTCAGCTGGCCACCTAGTGTCACGGGTGGTAGGCT
GGGACGCGGATGCAGGGCACAATGCCTGGCTCTCCTACAGTCTCTTGGGATCCCCTAACCAGAGCCTTTTTGCCATAGGGCTGCACACTG
GTCAAATCAGTACTGCCCGTCCAGTCCAAGACACAGATTCACCCAGGCAGACTCTCACGGTCTTGATCAAAGACAATGGGGAGCCTTCGC
TCTCCACCACTGCTACCCTCACTGTGTCAGTAACCGAGGACTCTCCTGAAGCCCGAGCCGAGTTCCCCTCTGGCTCTGCCCCCCGGGAGC
AGAAAAAAAATCTCACCTTTTATCTACTTCTTTCTCTAATCCTGGTTTCTGTGGGGTTTGTGGTCACAGTGTTCGGAGTAATCATATTCA
AAGTTTACAAGTGGAAGCAGTCTAGAGACCTATACCGAGCCCCGGTGAGCTCACTGTACCGAACACCAGGGCCCTCCTTGCACGCGGACG
CCGTGCGGGGAGGCCTGATGTCGCCGCACCTTTACCATCAGGTGTATCTCACCACGGACTCCCGCCGCAGCGACCCGCTGCTGAAGAAAC
CTGGTGCAGCCAGTCCACTGGCCAGCCGCCAGAACACGCTGCGGAGCTGTGATCCGGTGTTCTATAGGCAGGTGTTGGGTGCAGAGAGCG
CCCCTCCCGGACAGGAGGAGCAAAATAGAGGCAAGCCCAATTGGGAGCATCTAAATGAAGATTTACATGTACTAATCACTGTGGAAGATG
CTCAGAACAGAGCAGAAATCAAATTGAAGAGAGCAGTTGAAGAAGTGAAGAAATTATTGGTACCTGCAGCAGAAGGAGAAGACAGCCTGA
AGAAGATGCAGCTGATGGAGCTTGCGATTCTGAATGGCACCTACAGAGATGCCAACATTAAATCACCAACAGCCCAGGCTGCTCCAAGGA
TCATTACTGGGCCTGCGCCGGTTCTCCCACCAGCTGCCCTGCGTACTCCTACGCCAGCTGGCCCTACCATAATGCCTTTGATCAGACAAA
TACAGACCGCTGTCATGCCAAACGGAACTCCTCACCCAACTGCTGCAATAGTTCCTCCAGGGCCCGAAGCTGGTTTAATCTATACACCCT
ATGAGTACCCCTACACATTGGCACCAGCTACATCAATCCTTGAGTATCCTATTGAACCTAGTGGTGTATTAGAGTGGATTGAAATGCCAG


Top

FusionGenePPI for PCDHGC3_QKI


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCDHGC3APP, HGD, MFSD3, CEACAM21, C2orf48, NTRK1, PCDHGB3, PCDHGB1, GRTP1, PCDH12, TMEM30B, XAGE1B, NRN1, FLRT1, SPTBN4, SIRT6, EEPD1, ERICH5, SRC, CNTN1, PTPRG, PAG1, PCDHA4, FYN, HRAS, GAP43, UBTD2, CDCA3, YES1, GNAZ, PROCR, GNAQ, CHRNA9, CD109, AHNAK, CDH1QKIHNRNPK, USP30, MED12, MED13, MED25, MED16, MED17, MED1, MED24, MED23, MED4, MED29, MED31, MED15, MED14, MED26, MED10, POLR2A, MED27, ELAVL1, PSMF1, C10orf10, FUBP3, HCLS1, PCBP2, PTBP1, PTBP2, RBM14, RBFOX2, RBPMS, RNF138, SERF2, THAP1, USH1C, RBFOX1, PCBP1, PCBP4, APP, NDUFA7, CDV3, ATXN1, FN1, U2AF2, RBM23, RALY, WDR77, HNRNPH2, QKI, DAZ1, IL7R, CARM1, SNRPA, RBM11, NABP1, HNRNPLL, OIP5, RBMX, ZACN, CYP1A1, NTRK1, EWSR1, HYPK, DUSP22, DUSP4, ATE1, RBM42, FBXW11, SLC39A12, VAC14, TRIM11, SYNCRIP, SNRNP27


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PCDHGC3_QKI


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for PCDHGC3_QKI


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneQKIC0036341Schizophrenia5PSYGENET
TgeneQKIC0017638Glioma1CTD_human
TgeneQKIC0041696Unipolar Depression1PSYGENET
TgeneQKIC1269683Major Depressive Disorder1PSYGENET