FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 26181

FusionGeneSummary for PCCB_DLG1

check button Fusion gene summary
Fusion gene informationFusion gene name: PCCB_DLG1
Fusion gene ID: 26181
HgeneTgene
Gene symbol

PCCB

DLG1

Gene ID

5096

1739

Gene namepropionyl-CoA carboxylase subunit betadiscs large MAGUK scaffold protein 1
Synonyms-DLGH1|SAP-97|SAP97|dJ1061C18.1.1|hdlg
Cytomap

3q22.3

3q29

Type of geneprotein-codingprotein-coding
Descriptionpropionyl-CoA carboxylase beta chain, mitochondrialPCCase subunit betapropanoyl-CoA:carbon dioxide ligase subunit betapropionyl CoA carboxylase, beta polypeptidepropionyl Coenzyme A carboxylase, beta polypeptidepropionyl-CoA carboxylase beta subunitdisks large homolog 1discs large homolog 1, scribble cell polarity complex componentdiscs, large homolog 1 transcript variant 6-v1discs, large homolog 1 transcript variant 6-v2presynaptic protein SAP97synapse-associated protein 97
Modification date2018052220180523
UniProtAcc

P05166

Q12959

Ensembl transtripts involved in fusion geneENST00000471595, ENST00000478469, 
ENST00000251654, ENST00000483687, 
ENST00000490504, ENST00000466072, 
ENST00000482086, ENST00000468777, 
ENST00000462637, ENST00000469217, 
ENST00000474833, 
ENST00000357674, 
ENST00000314062, ENST00000346964, 
ENST00000419354, ENST00000452595, 
ENST00000422288, ENST00000448528, 
ENST00000443183, ENST00000450955, 
ENST00000392382, ENST00000485409, 
Fusion gene scores* DoF score3 X 3 X 3=276 X 7 X 6=252
# samples 47
** MAII scorelog2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/252*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: PCCB [Title/Abstract] AND DLG1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDLG1

GO:0001935

endothelial cell proliferation

14699157

TgeneDLG1

GO:0007015

actin filament organization

14699157

TgeneDLG1

GO:0030866

cortical actin cytoskeleton organization

14699157

TgeneDLG1

GO:0042391

regulation of membrane potential

12970345

TgeneDLG1

GO:0043268

positive regulation of potassium ion transport

12970345

TgeneDLG1

GO:0070830

bicellular tight junction assembly

17332497

TgeneDLG1

GO:0098609

cell-cell adhesion

14699157

TgeneDLG1

GO:1903078

positive regulation of protein localization to plasma membrane

12970345


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A8-A08P-01APCCBchr3

136048826

+DLG1chr3

196921460

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000471595ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000471595ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000471595ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000471595ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000471595ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000471595ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000478469ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000478469ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000478469ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000478469ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000478469ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-5UTRENST00000478469ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000251654ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000251654ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000251654ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000251654ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000251654ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000251654ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000483687ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000483687ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000483687ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000483687ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000483687ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000483687ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000490504ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000490504ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000490504ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000490504ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000490504ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000490504ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000466072ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000466072ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000466072ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000466072ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000466072ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000466072ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000482086ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000482086ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000482086ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000482086ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000482086ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000482086ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000468777ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000468777ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000468777ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000468777ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000468777ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000468777ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000462637ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000462637ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000462637ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
Frame-shiftENST00000462637ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000462637ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000462637ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000469217ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000469217ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000469217ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
In-frameENST00000469217ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-intronENST00000469217ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
5CDS-5UTRENST00000469217ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000474833ENST00000357674PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000474833ENST00000314062PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000474833ENST00000346964PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-3CDSENST00000474833ENST00000419354PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000452595PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000422288PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000448528PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000443183PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000450955PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-intronENST00000474833ENST00000392382PCCBchr3

136048826

+DLG1chr3

196921460

-
intron-5UTRENST00000474833ENST00000485409PCCBchr3

136048826

+DLG1chr3

196921460

-

Top

FusionProtFeatures for PCCB_DLG1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
PCCB

P05166

DLG1

Q12959


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324224_310106854DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324319_405106854DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324466_546106854DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324581_651106854DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324714_889106854DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326224_310106927DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326319_405106927DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326466_546106927DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326581_651106927DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326714_889106927DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325224_310106894DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325319_405106894DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325466_546106894DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325581_651106894DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325714_889106894DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325224_310106872DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325319_405106872DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325466_546106872DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325581_651106872DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325714_889106872DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326224_310106905DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326319_405106905DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326466_546106905DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326581_651106905DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326714_889106905DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223224_310106854DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223319_405106854DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223466_546106854DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223581_651106854DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223714_889106854DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022224_310-17801DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022319_405-17801DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022466_546-17801DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-0224_64-17801DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022581_651-17801DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022714_889-17801DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326224_310106905DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326319_405106905DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326466_546106905DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326581_651106905DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326714_889106905DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224224_310106894DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224319_405106894DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224466_546106894DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224581_651106894DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224714_889106894DomainGuanylate kinase-like
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021224_310-108789DomainPDZ 1
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021319_405-108789DomainPDZ 2
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021466_546-108789DomainPDZ 3
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-0214_64-108789DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021581_651-108789DomainSH3
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021714_889-108789DomainGuanylate kinase-like

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgenePCCBchr3:136048826chr3:196921460ENST00000251654+115294_533-24540DomainCoA carboxyltransferase C-terminal
HgenePCCBchr3:136048826chr3:196921460ENST00000251654+11532_290-24540DomainCoA carboxyltransferase N-terminal
HgenePCCBchr3:136048826chr3:196921460ENST00000469217+116294_533-6560DomainCoA carboxyltransferase C-terminal
HgenePCCBchr3:136048826chr3:196921460ENST00000469217+11632_290-6560DomainCoA carboxyltransferase N-terminal
HgenePCCBchr3:136048826chr3:196921460ENST00000251654+115325_358-24540RegionAcyl-CoA binding
HgenePCCBchr3:136048826chr3:196921460ENST00000251654+11532_533-24540RegionCarboxyltransferase
HgenePCCBchr3:136048826chr3:196921460ENST00000469217+116325_358-6560RegionAcyl-CoA binding
HgenePCCBchr3:136048826chr3:196921460ENST00000469217+11632_533-6560RegionCarboxyltransferase
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-3244_64106854DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-3264_64106927DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-3254_64106894DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-3254_64106872DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-3264_64106905DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-2234_64106854DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-3264_64106905DomainL27
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-2244_64106894DomainL27


Top

FusionGeneSequence for PCCB_DLG1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_1314aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCN
LRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGD
TNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTD
NPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSI
AGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSS
SQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRII
SVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQ
GLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQS
EQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYH
FVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQAR

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_1274aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCN
LRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGD
TNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITG
GAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVT
KIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTP
ASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAA
LKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDD
EWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEV
NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAE
KGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQ

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_1347aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCN
LRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGD
TNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETP
TYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTA
LKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSIS
SGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRIN
DDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRL

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_1325aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLNDSGGARIQEGVESLAGYADIF
LRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTHTTMSGVAHRAFENDVDALCN
LRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNIIVGFARMNGRTVGIVGNQPK
VASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSSKHLCGD
TNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLDVLASKKKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETP
TYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTA
LKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSIS
SGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPK
RDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIME

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_1396aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQQIIGWAQWLPLVISALWEAEDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLND
SGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTH
TTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNI
IVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVI
TRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLD
VLASKKVQRPWRKHANIPLXTNQRKRNQELNYCLPIHIPFLPFAIMKPGNPNSWITXNNXVYXILERSKYRYQDEDTPPQEHISPQITNE
VIGPELVHVSEKNLSEIENVHGFVSHSHISPIKANPPPVLVNTDSLETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDS
SIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQH
IPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHV
SPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLR
AASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGD
ILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDAD
QHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQM
EKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMK

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_1356aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQQIIGWAQWLPLVISALWEAEDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLND
SGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTH
TTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNI
IVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVI
TRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLD
VLASKKVQRPWRKHANIPLXTNQRKRNQELNYCLPIHIPFLPFAIMKPGNPNSWITXNNXVYXILERSKYRYQDEDTPPQEHISPQITNE
VIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGR
LRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAA
HKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSP
VSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAV
TIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQV
TPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVII
LGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILD
VSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQVKQIIEEQSGSYIWVP

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_1429aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQQIIGWAQWLPLVISALWEAEDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLND
SGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTH
TTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNI
IVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVI
TRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLD
VLASKKVQRPWRKHANIPLXTNQRKRNQELNYCLPIHIPFLPFAIMKPGNPNSWITXNNXVYXILERSKYRYQDEDTPPQEHISPQITNE
VIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDA
DYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVK
RRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFV
YLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEG
IFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRT
SQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKG
QSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFP
DKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPI

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_1407aa
MAAALRVAAVGARLSVLASGLRAAVRSLCSQATSVNERIENKRRTALLGGGQRRIDAQHKRGKLTARERISLLLDPGSFVESDMFVEHRC
ADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQQIIGWAQWLPLVISALWEAEDFTVFGGSLSGAHAQKICKIMDQAITVGAPVIGLND
SGGARIQEGVESLAGYADIFLRNVTASGVIPQISLIMGPCAGGAVYSPALTDFTFMVKDTSYLFITGPDVVKSVTNEDVTQEELGGAKTH
TTMSGVAHRAFENDVDALCNLRDFFNYLPLSSQDPAPVRECHDPSDRLVPELDTIVPLESTKAYNMVDIIHSVVDEREFFEIMPNYAKNI
IVGFARMNGRTVGIVGNQPKVASGCLDINSSVKGARFVRFCDAFNIPLITFVDVPGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVI
TRKAYGGAYDVMSSKHLCGDTNYAWPTAEIAVMGAKGAVEIIFKGHENVEAAQAEYIEKFANPFPAAVRGFVDDIIQPSSTRARICCDLD
VLASKKVQRPWRKHANIPLXTNQRKRNQELNYCLPIHIPFLPFAIMKPGNPNSWITXNNXVYXILERSKYRYQDEDTPPQEHISPQITNE
VIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVLPSPPTVPVIPVLPVPAENTVILPTIPQANPPPVLVNTDSLETPTYVNGTDA
DYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVK
RRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFV
YLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNIVGGEDGEG
IFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRT
SQKRSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKG
EIPDDMGSKGLKHVTSNASDSESSYRGQEEYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGR
DYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKPKSMENIMEMNKRLTEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_3942nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACG
GTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTT
CTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTA
ACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACC
CAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAAT
CTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCT
GAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTT
GAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAG
GTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACT
TTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCT
GAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGAT
ACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAA
GCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCC
ACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTT
AATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGAC
AACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAAT
GACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTA
CGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATT
GCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGC
AAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAAC
ACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCT
TCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCA
GTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGA
GAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATA
TCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCA
CAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCA
GGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAG
GGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGT
GAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAA
ACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGT
GAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTA
TCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTG
ATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCAT
TTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACA
AGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCA
CAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGA
AAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTAC

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_3822nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACG
GTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTT
CTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTA
ACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACC
CAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAAT
CTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCT
GAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTT
GAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAG
GTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACT
TTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCT
GAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGAT
ACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAA
GCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCC
ACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAAT
TCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGG
GGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAA
GCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAG
CTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACC
AAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAA
GTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAAT
GATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCA
GCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGT
GGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGAT
CTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCA
TTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGG
GAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGAT
TATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGAT
GAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAA
CGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCAT
GTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTT
AATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCC
TGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAA
GATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAA
AAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAA
CCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAA
CAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAA

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_4041nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACG
GTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTT
CTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTA
ACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACC
CAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAAT
CTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCT
GAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTT
GAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAG
GTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACT
TTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCT
GAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGAT
ACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAA
GCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCC
ACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCA
GTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCA
ACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGA
GGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTG
CGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGG
TCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGG
TTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACAT
AAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCC
TTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACC
AACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTT
TCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATT
GTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGAT
CGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACA
ATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGT
TCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTT
CCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACA
CCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTC
AATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAG
GACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAA
TACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAAT
GATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGA
GATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTA
TATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTA
CAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAA
CAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAA

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_3975nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACG
GTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTT
CTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTA
ACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACC
CAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAAT
CTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCT
GAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTT
GAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAG
GTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACT
TTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCT
GAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGAT
ACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAA
GCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCC
ACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCAT
ATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGA
TTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCA
GTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCA
ACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGA
GGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTG
CGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGG
TCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGG
TTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACAT
AAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCC
TTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACC
AACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTT
TCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATT
GTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGAT
CGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACA
ATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGT
TCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTT
CCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACA
CCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTC
AATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAA
AGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTG
GGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAA
CGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAA
GCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTG
TCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAA
ATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCT
ATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCA

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_4188nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAGGATTTTACAGTTTTTGGA
GGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGAC
TCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATC
CCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACC
TCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCAC
ACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTG
AGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCA
ACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATC
ATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCA
TCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGC
ACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATC
ACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATT
GCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTT
GCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGAT
GTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGGAAAAGAAACCAAGAACTG
AATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGGATAACTTAGAATAACTAA
GTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAA
GTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCA
CCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAA
TATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCA
AGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAA
GTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAA
CCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCAT
ATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTT
TTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAA
GTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTT
AGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACA
AGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATT
TCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGA
GCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGT
CGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAG
CGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGAT
ATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATT
CCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTC
AATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGAC
CAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAA
GAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTT
GGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATG
GAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTA
GCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTT
ATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAA
CTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAA

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_4068nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAGGATTTTACAGTTTTTGGA
GGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGAC
TCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATC
CCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACC
TCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCAC
ACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTG
AGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCA
ACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATC
ATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCA
TCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGC
ACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATC
ACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATT
GCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTT
GCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGAT
GTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGGAAAAGAAACCAAGAACTG
AATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGGATAACTTAGAATAACTAA
GTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAA
GTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCA
CCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCA
GGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGA
TTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCA
GGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTT
GGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCA
CATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACT
GCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATC
ACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCA
GTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAAC
ATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGA
GATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTC
ACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATT
AGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGG
CTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTT
ACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAA
TTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGT
GAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATA
TTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCA
AAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATT
GAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGAT
GTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATG
GAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACA
GCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCG

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_4287nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAGGATTTTACAGTTTTTGGA
GGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGAC
TCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATC
CCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACC
TCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCAC
ACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTG
AGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCA
ACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATC
ATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCA
TCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGC
ACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATC
ACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATT
GCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTT
GCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGAT
GTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGGAAAAGAAACCAAGAACTG
AATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGGATAACTTAGAATAACTAA
GTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAA
GTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCA
CCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCAGTCCCTGCTGAGAATACTGTCATC
CTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCA
GATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGA
GATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGA
GTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAA
AGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGA
AATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGA
GATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTT
TATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGAT
AACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGAT
GAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGA
ATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTT
GACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAA
GAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACT
AGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAA
TTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTC
GGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGG
CAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGT
GATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTG
AATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCT
GACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGA
GAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTA
CGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATC
TCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGA
GCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAG

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_4221nt
ATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCGGTCCGCAGCCTTTGCAGC
CAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGTATTGACGCGCAGCACAAG
CGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATGTTTGTGGAACACAGATGT
GCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATCAATGGAAGATTGGTTTAT
GTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAGGATTTTACAGTTTTTGGA
GGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGAC
TCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATC
CCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACC
TCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCAC
ACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTG
AGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCA
ACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATC
ATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCA
TCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGC
ACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATC
ACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATT
GCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTT
GCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGAT
GTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGGAAAAGAAACCAAGAACTG
AATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGGATAACTTAGAATAACTAA
GTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAA
GTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCA
CCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCAGTCCCTGCTGAGAATACTGTCATC
CTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCA
GATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGA
GATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGA
GTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAA
AGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGA
AATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGA
GATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTT
TATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGAT
AACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGAT
GAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGA
ATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTT
GACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAA
GAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACT
AGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAA
TTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTC
GGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGG
GAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAA
TACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAAT
GATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGA
GATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTA
TATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTA
CAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAA
CAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_6023nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATC
ATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCT
GGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCC
GTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTC
ACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGAT
GTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCC
AGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTT
GATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATT
GTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTC
AATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAG
CTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCT
AAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAA
GGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGAC
ATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGAT
ACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAG
ATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTG
GAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGC
ATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGAT
GGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAA
GAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAA
GGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGT
GCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCA
GTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCT
GATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATAC
TCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGT
TTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGA
AAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAG
GCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGT
AGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGAC
AGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGG
CAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACA
GTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTAC
AAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGT
CAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGAC
AGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTA
GATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAAC
AATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATA
AAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTA
ACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGAT
ACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGA
AAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGA
TTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTT
AATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGT
GGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATG
AAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTC
AAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTG
AGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTA
GGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTT
CGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATC
AGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCA
GATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGT
AACTATGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTAC
TCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGG
TCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCC
TGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTT
TATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACA
AATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATA
ATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTT
GTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGT
CTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGA
GCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACAC
ACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCA

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_5903nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATC
ATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCT
GGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCC
GTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTC
ACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGAT
GTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCC
AGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTT
GATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATT
GTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTC
AATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAG
CTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCT
AAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAA
GGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGAC
ATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGAT
ACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAG
ATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATC
ACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATT
ACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGT
GATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAA
AAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGAT
AATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAAT
AACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCC
ACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCC
TTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGA
AAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTA
GCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCAT
GAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCT
AAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTAT
GTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTT
ATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGC
AGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGA
TCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCA
GTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTT
CCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCA
AGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCT
GTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCT
ATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAG
AGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAA
CAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCA
CAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCAT
GGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTC
AGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGT
AACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAG
ACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATC
AAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTT
CCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCT
ACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAG
GAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATC
ATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGC
TGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTT
GCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAA
ATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAG
ATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTA
CTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCAT
TTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATG
TTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTT
GTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCAT
TTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTG
CAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACAT
TGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCT
CAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGG

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_6122nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATC
ATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCT
GGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCC
GTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTC
ACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGAT
GTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCC
AGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTT
GATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATT
GTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTC
AATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAG
CTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCT
AAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAA
GGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGAC
ATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGAT
ACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAG
ATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCT
GTGATCCCTGTCCTGCCAGTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACA
GATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTT
GGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCC
GCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAA
GCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAA
GGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATT
GAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCAT
GAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTAT
GCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCA
GCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACG
GGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGA
GAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAAT
GCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATG
ATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAG
ACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGG
CAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGA
TTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTC
CCCTTCTACAAGAACAAGGACCAGAGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGT
TACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCT
ATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGAT
TATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGC
CAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGA
AATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAAT
AAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTA
CAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAA
AAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTT
GAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGT
GTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGC
AGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCA
GTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGT
ATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAAT
TCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGA
CATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATC
ATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATAC
AGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCT
TAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCT
TTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTT
GCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGG
GCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCA
AATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAG
TTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAG
AATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATA
TTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAG
TACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGT
TAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCG
AATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACA
TAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAG
TATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTATAAAAGGATGCCATTTATATATTAAAATTTACATAACATTGTTTTCTG

>In-frame_PCCB_ENST00000471595_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_4985nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGGATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATC
ATGGACCAGGCCATAACGGTGGGGGCTCCAGTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCT
GGCTATGCAGACATCTTTCTGAGGAATGTTACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCC
GTCTACTCCCCAGCCCTAACAGACTTCACGTTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTC
ACCAATGAGGATGTTACCCAGGAGGAGCTCGGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGAT
GTTGATGCCTTGTGTAATCTCCGGGATTTCTTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCC
AGTGACCGTCTGGTTCCTGAGCTTGACACAATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTT
GATGAGCGTGAATTTTTTGAGATCATGCCCAATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATT
GTTGGCAACCAACCTAAGGTGGCCTCAGGATGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTC
AATATTCCACTCATCACTTTTGTTGATGTCCCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAG
CTTCTCTACGCATTTGCTGAGGCAACTGTACCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCT
AAGCACCTTTGTGGTGATACCAACTATGCCTGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAA
GGGCATGAGAATGTGGAAGCTGCTCAGGCAGAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGAC
ATCATCCAACCTTCTTCCACACGTGCCCGAATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGAAATACAGGTATCAGGATGAAGAT
ACACCTCCTCAAGAGCATATTTCCCCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAG
ATTGAGAATGTCCATGGATTTGTTTCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCT
GTGATCCCTGTCCTGCCAGTCCCTGCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACA
GATAGCTTGGAAACACCAACTTACGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTT
GGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCC
GCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAA
GCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAA
GGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATT
GAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCAT
GAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTAT
GCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCA
GCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACG
GGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGA
GAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAAT
GCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATG
ATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAG
ACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGG
CAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGA
TTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCT
AATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACT
CGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCT
CATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAG
GAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAA
CACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCC
ATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTT
ACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCT
TACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTT
GCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAG
TGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCA
GCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTT
TATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGT
TTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAAT
AAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTA
TTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACA
AAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTG
AGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCAT
AGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATAT

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000357674_chr3_196921460_-_6269nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAG
GATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCA
GTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTT
ACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACG
TTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTC
GGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTC
TTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACA
ATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCC
AATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGA
TGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTC
CCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTA
CCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCC
TGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCA
GAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGA
ATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGG
AAAAGAAACCAAGAACTGAATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGG
ATAACTTAGAATAACTAAGTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCC
CCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTT
TCTCATTCTCATATTTCACCAATAAAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTACGTTAATGGC
ACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCA
CACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGT
ATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTG
TATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGA
GGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTT
CAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAGAACACATCT
GATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCTTCTTCTCAG
CCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTT
GGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGAT
GGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTA
AACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTTGCACAATAT
CGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCT
CTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTG
AACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGC
GATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCTAAAACGAGA
GATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAGAGTGAGCAG
GAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTAT
GAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCA
GAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTG
ACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTT
CAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTT
TACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACA
TTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAA
GTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCT
TTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACA
CATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCA
TTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGG
GAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATT
TAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCT
ATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCA
TTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTT
TAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGT
GCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTA
ACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCAC
AATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTAC
ATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTA
AATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGA
AATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTG
TTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAG
CCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAA
GAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTT
GGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCA
TTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATAT
ATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTA
CCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTA
AAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATC

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000314062_chr3_196921460_-_6149nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAG
GATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCA
GTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTT
ACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACG
TTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTC
GGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTC
TTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACA
ATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCC
AATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGA
TGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTC
CCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTA
CCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCC
TGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCA
GAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGA
ATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGG
AAAAGAAACCAAGAACTGAATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGG
ATAACTTAGAATAACTAAGTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCC
CCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTT
TCTCATTCTCATATTTCACCAATAAAGGTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGG
CTTGGTTTCAGCATTGCAGGAGGTACGGACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCA
GCCGCCCAAGATGGAAGATTGCGGGTCAATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTT
GAAGCGTTGAAAGAAGCAGGGTCTATTGTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATT
AAAGGTCCTAAAGGTCTTGGGTTTAGCATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATA
ATTGAAGGAGGTGCAGCACATAAGGATGGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACT
CATGAAGAAGCAGTAACTGCCTTAAAGAACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGC
TATGCACCACCTGATATCACCAACTCTTCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCT
CCAGCCAGATACTCCCCAGTTTCTAAAGCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCA
ACGGGCCTTGGTTTCAACATTGTAGGAGGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGT
GGAGAGCTCAGAAAAGGAGATCGTATTATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAA
AATGCTGGCCAGGCTGTCACAATTGTTGCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAG
ATGATGAATAGTAGTATTAGTTCAGGGTCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGAC
AAGACTAAAGACAGTGGGCTTCCCAGTCAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGG
TGGCAAGCCAGGCAGGTTACACCAGATGGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCC
CGATTAAAAACAGTGAAATTCAATTCTAAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACT
TCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTAT
ACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTT
CCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATC
CAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGC
AAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAA
TCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAG
TTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGT
TCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTC
TTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATG
TAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGA
CCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAG
CTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTC
AGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATA
AATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTA
GTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTT
ACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGA
TTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATT
CATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATA
TATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTATTTTCTTTACATAGTTGCGCACACACACAAACATATATAT
ATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTTTGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTT
CCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAACATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATA
TTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTGTTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTG
ATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGCAGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGA
CAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAGCAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTC
ACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCATTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGAC
AACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAACATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTA
ATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAGAAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAA
TTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAGAGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAG
ACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAAACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTAC
AAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTGTAAAATATCAAGTGGTTATAAAAGGATGCCATTTATATA

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000346964_chr3_196921460_-_6368nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAG
GATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCA
GTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTT
ACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACG
TTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTC
GGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTC
TTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACA
ATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCC
AATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGA
TGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTC
CCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTA
CCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCC
TGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCA
GAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGA
ATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGG
AAAAGAAACCAAGAACTGAATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGG
ATAACTTAGAATAACTAAGTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCC
CCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTT
TCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCAGTCCCT
GCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTAC
GTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACG
GACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTC
AATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATT
GTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGC
ATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGAT
GGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAG
AACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCT
TCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAA
GCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGA
GGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATT
ATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTT
GCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGG
TCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGT
CAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGAT
GGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCT
AAAACGAGAGATAAAGGGCAGTCATTCAATGACAAGCGTAAAAAGAACCTCTTTTCCCGAAAATTCCCCTTCTACAAGAACAAGGACCAG
AGTGAGCAGGAAACAAGTGATGCTGACCAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGTTACCGTGGTCAAGAAGAATACGTC
TTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCTATGAAAGACAGGATAAATGATGAC
TTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGATTATGAGGTAGATGGAAGAGATTAT
CATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGCCAGTATAACAATCATCTATATGGA
ACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGAAATGCCATAAAGAGATTACAGATT
GCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAATAAGCGTCTAACAGAAGAACAAGCC
AGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTACAGGGGGATACGCTGGAAGACATT
TACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAAAAGCTATGAAAACTCATGTTTCTC
TGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTTGAGTACTGATTTCATGTTGAATTG
TATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGTGTATTATTTAATGTCACTATTGGT
TAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGCAGAAATTGTGGTAAAATTCCTTAA
TGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCAGTACAAATGAAAAAGTGGTTTTAA
TCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGTATTACTCTCAAGTCCTTTTCTCAA
TCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAATTCATGTCTGAGTTGACTTTCATAA
GGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGACATTTGCTAGGAATAACAACGTTT
CAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATCATCACATTTCGTGAATTGAGGCCA
TGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATACAGATAAATCAGACGTTACAGTGGT
GACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCTTAGGAGTCAGATTTTACTGAATAT
TTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCTTTAAACTGTAACTATGGGAATTAT
TTTCTTTACATAGTTGCGCACACACACAAACATATATATATATTTAAAATATATTTTGTTTCTTTTGCCACCTACTCCTAACTTTTTGTT
TGGTTTTTAAATTAAATATTAATTGAATAGACTTATCTTCCTTAATCATGTGAACTGAAAATGGGGGCATGGTGGTCATGAGGAGGAAAC
ATTTAGGGAAATTAGATTATAAGTAAAAGTGTGGGCATATTCTCCTCTTTTCTACAAAGGTTTTCAAATGGTTCCTGAGGTTTTTTGTTG
TTGTCCGTGTTGTTACTGTTGTTCTTGTCATCAGGTTTGATTTTGGTCCTTGCCCTTTCCTTCTAGTTCTCCTTTTATTAATAGGAAGGC
AGGCAAAAGCCCCATTTATGTGTGTGTTTTCCCCTCAGACAGCTTTCATCCACTGCTCTGCACTAGAATTGCACAAATCTTCATGGTGAG
CAATTTTAAGAAATGTTAGTGAAAGGTAGAAATTATTTCACAAATCAGTTTCTCTGGTCCTTCATATTAATAATAATATTTGGCTTCCCA
TTGCTCTTTGGAGTTGTTTATTAAATATGTGTTTTTGACAACCTCCTCATTAGTTTCTTAAATGAGTACTGGTTTGTAAAGAATTATCAA
CATTATCCATTCCATTTATGAAGAAGAGGAGAACAGCTAATAAACTGTATTGTAAAATCCATATGTTAAGTGTGTCTTGAATTTTGAAAG
AAAAAATATATTTTGCAAGCTAACATTTTCTTGAAACAATTTGAGGCATCATGTAACTTATAACCGAATCCAAGAGCCGTTAGGCAGCAG
AGTGTGTTACCACATTGAAATACACAGTGCTGCTGTTAGACTAAATGTCGTAGGTTGTTAACCACATAGAAACACACTAGTATGAAGAAA
ACTGTTGTAAAATCTCAAGAGCTTCAGAAACTGCCTTACAAGACCGCAGCATAAGCTATTTTGAAGTATTTACCAAATAGTCACATGTTG

>In-frame_PCCB_ENST00000469217_chr3_136048826_+_DLG1_ENST00000419354_chr3_196921460_-_5231nt
CGCGCCGGCACAGCAAAAATGGCGGCGGCATTACGGGTGGCGGCGGTCGGGGCAAGGCTCAGCGTTCTGGCGAGCGGTCTCCGCGCCGCG
GTCCGCAGCCTTTGCAGCCAGGCCACCTCTGTTAACGAACGCATCGAAAACAAGCGCCGGACCGCGCTGCTGGGAGGGGGCCAACGCCGT
ATTGACGCGCAGCACAAGCGAGGAAAGCTAACAGCCAGGGAGAGGATCAGTCTCTTGCTGGACCCTGGCAGCTTTGTTGAGAGCGACATG
TTTGTGGAACACAGATGTGCAGATTTTGGAATGGCTGCTGATAAGAATAAGTTTCCTGGAGACAGCGTGGTCACTGGACGAGGCCGAATC
AATGGAAGATTGGTTTATGTCTTCAGTCAGCAAATAATAGGCTGGGCACAGTGGCTCCCGCTTGTCATCTCAGCACTTTGGGAGGCCGAG
GATTTTACAGTTTTTGGAGGCAGTCTGTCAGGAGCACATGCCCAAAAGATCTGCAAAATCATGGACCAGGCCATAACGGTGGGGGCTCCA
GTGATTGGGCTGAATGACTCTGGGGGAGCACGGATCCAAGAAGGAGTGGAGTCTTTGGCTGGCTATGCAGACATCTTTCTGAGGAATGTT
ACGGCATCCGGAGTCATCCCTCAGATTTCTCTGATCATGGGCCCATGTGCTGGTGGGGCCGTCTACTCCCCAGCCCTAACAGACTTCACG
TTCATGGTAAAGGACACCTCCTACCTGTTCATCACTGGCCCTGATGTTGTGAAGTCTGTCACCAATGAGGATGTTACCCAGGAGGAGCTC
GGTGGTGCCAAGACCCACACCACCATGTCAGGTGTGGCCCACAGAGCTTTTGAAAATGATGTTGATGCCTTGTGTAATCTCCGGGATTTC
TTCAACTACCTGCCCCTGAGCAGTCAGGACCCGGCTCCCGTCCGTGAGTGCCACGATCCCAGTGACCGTCTGGTTCCTGAGCTTGACACA
ATTGTCCCTTTGGAATCAACCAAAGCCTACAACATGGTGGACATCATACACTCTGTTGTTGATGAGCGTGAATTTTTTGAGATCATGCCC
AATTATGCCAAGAACATCATTGTTGGTTTTGCAAGAATGAATGGGAGGACTGTTGGAATTGTTGGCAACCAACCTAAGGTGGCCTCAGGA
TGCTTGGATATTAATTCATCTGTGAAAGGGGCTCGTTTTGTCAGATTCTGTGATGCATTCAATATTCCACTCATCACTTTTGTTGATGTC
CCTGGCTTTCTACCTGGCACAGCACAGGAATACGGGGGCATCATCCGGCATGGTGCCAAGCTTCTCTACGCATTTGCTGAGGCAACTGTA
CCCAAAGTCACAGTCATCACCAGGAAGGCCTATGGAGGTGCCTATGATGTCATGAGCTCTAAGCACCTTTGTGGTGATACCAACTATGCC
TGGCCCACCGCAGAGATTGCAGTCATGGGAGCAAAGGGCGCTGTGGAGATCATCTTCAAAGGGCATGAGAATGTGGAAGCTGCTCAGGCA
GAGTACATCGAGAAGTTTGCCAACCCTTTCCCTGCAGCAGTGCGAGGGTTTGTGGATGACATCATCCAACCTTCTTCCACACGTGCCCGA
ATCTGCTGTGACCTGGATGTCTTGGCCAGCAAGAAGGTACAACGTCCTTGGAGAAAACATGCAAATATTCCATTGTAAACAAATCAAAGG
AAAAGAAACCAAGAACTGAATTACTGTCTGCCCATTCACATCCCATTCCTGCCTTTTGCAATCATGAAACCTGGGAATCCAAATAGTTGG
ATAACTTAGAATAACTAAGTTTATTAAATTCTAGAAAGATCTAAATACAGGTATCAGGATGAAGATACACCTCCTCAAGAGCATATTTCC
CCACAAATCACAAATGAAGTGATAGGTCCAGAATTGGTTCATGTCTCAGAGAAGAACTTATCAGAGATTGAGAATGTCCATGGATTTGTT
TCTCATTCTCATATTTCACCAATAAAGCCAACAGAAGCTGTTCTTCCCTCTCCTCCCACTGTCCCTGTGATCCCTGTCCTGCCAGTCCCT
GCTGAGAATACTGTCATCCTACCCACCATACCACAGGCAAATCCTCCCCCAGTACTGGTCAACACAGATAGCTTGGAAACACCAACTTAC
GTTAATGGCACAGATGCAGATTATGAATATGAAGAAATCACACTTGAAAGGGGAAATTCAGGGCTTGGTTTCAGCATTGCAGGAGGTACG
GACAACCCACACATTGGAGATGACTCAAGTATTTTCATTACCAAAATTATCACAGGGGGAGCAGCCGCCCAAGATGGAAGATTGCGGGTC
AATGACTGTATATTACGAGTAAATGAAGTAGATGTTCGTGATGTAACACATAGCAAAGCAGTTGAAGCGTTGAAAGAAGCAGGGTCTATT
GTACGCTTGTATGTAAAAAGAAGGAAACCAGTGTCAGAAAAAATAATGGAAATAAAGCTCATTAAAGGTCCTAAAGGTCTTGGGTTTAGC
ATTGCTGGAGGTGTTGGAAATCAGCATATTCCTGGGGATAATAGCATCTATGTAACCAAAATAATTGAAGGAGGTGCAGCACATAAGGAT
GGCAAACTTCAGATTGGAGATAAACTTTTAGCAGTGAATAACGTATGTTTAGAAGAAGTTACTCATGAAGAAGCAGTAACTGCCTTAAAG
AACACATCTGATTTTGTTTATTTGAAAGTGGCAAAACCCACAAGTATGTATATGAATGATGGCTATGCACCACCTGATATCACCAACTCT
TCTTCTCAGCCTGTTGATAACCATGTTAGCCCATCTTCCTTCTTGGGCCAGACACCAGCATCTCCAGCCAGATACTCCCCAGTTTCTAAA
GCAGTACTTGGAGATGATGAAATTACAAGGGAACCTAGAAAAGTTGTTCTTCATCGTGGCTCAACGGGCCTTGGTTTCAACATTGTAGGA
GGAGAAGATGGAGAAGGAATATTTATTTCCTTTATCTTAGCCGGAGGACCTGCTGATCTAAGTGGAGAGCTCAGAAAAGGAGATCGTATT
ATATCGGTAAACAGTGTTGACCTCAGAGCTGCTAGTCATGAGCAGGCAGCAGCTGCATTGAAAAATGCTGGCCAGGCTGTCACAATTGTT
GCACAATATCGACCTGAAGAATACAGTCGTTTTGAAGCTAAAATACATGATTTACGGGAGCAGATGATGAATAGTAGTATTAGTTCAGGG
TCAGGTTCTCTTCGAACTAGCCAGAAGCGATCCCTCTATGTCAGAGCCCTTTTTGATTATGACAAGACTAAAGACAGTGGGCTTCCCAGT
CAGGGACTGAACTTCAAATTTGGAGATATCCTCCATGTTATTAATGCTTCTGATGATGAATGGTGGCAAGCCAGGCAGGTTACACCAGAT
GGTGAGAGCGATGAGGTCGGAGTGATTCCCAGTAAACGCAGAGTTGAGAAGAAAGAACGAGCCCGATTAAAAACAGTGAAATTCAATTCT
AAAACGAGAGATAAAGGGGAGATCCCTGACGACATGGGATCAAAAGGCCTGAAGCATGTAACTTCTAATGCCAGCGATAGTGAAAGTAGT
TACCGTGGTCAAGAAGAATACGTCTTATCTTATGAACCAGTGAATCAACAAGAAGTTAATTATACTCGACCAGTGATCATATTGGGACCT
ATGAAAGACAGGATAAATGATGACTTGATCTCAGAATTTCCTGACAAATTTGGATCCTGTGTTCCTCATACAACTAGACCAAAACGAGAT
TATGAGGTAGATGGAAGAGATTATCATTTTGTGACTTCAAGAGAGCAGATGGAAAAAGATATCCAGGAACATAAATTCATTGAAGCTGGC
CAGTATAACAATCATCTATATGGAACAAGTGTTCAGTCTGTACGAGAAGTAGCAGAAAAGGGCAAACACTGTATCCTTGATGTGTCTGGA
AATGCCATAAAGAGATTACAGATTGCACAGCTTTACCCTATCTCCATTTTTATTAAACCCAAATCCATGGAAAATATCATGGAAATGAAT
AAGCGTCTAACAGAAGAACAAGCCAGAAAAACATTTGAGAGAGCCATGAAACTGGAACAGGAGTTTACTGAACATTTCACAGCTATTGTA
CAGGGGGATACGCTGGAAGACATTTACAACCAAGTGAAACAGATCATAGAAGAACAATCTGGTTCTTACATCTGGGTTCCGGCAAAAGAA
AAGCTATGAAAACTCATGTTTCTCTGTTTCTCTTTTCCACAATTCCATTTTCTTTGGCATCTCTTTGCCCTTTCCTCTGGAGTCTTTCTT
GAGTACTGATTTCATGTTGAATTGTATCCCACACATCATGGTCTGCAGCTTCTTTTTCACATGTAGTGTCTCCTTCAAGTTACATCGTGT
GTATTATTTAATGTCACTATTGGTTAGTGGCCATTTTTCAGAACTGAAGATGGAATGGCCTGACCAGCTATTAAGAACGTGGGGAGACGC
AGAAATTGTGGTAAAATTCCTTAATGTTTAAGGGAAAGTAACTTTAAGAGATTTTTGGAAAAGCTTTATATACATTCTTTTCAAATTTCA
GTACAAATGAAAAAGTGGTTTTAATCAGTGATTTAGTAGACTTTGAGCAACTGTGCACGCTTCAGTTTAATAGCATGGTTTGGCCAGTGT
ATTACTCTCAAGTCCTTTTCTCAATCAACTTCTATCATCAAAGCAATTGTTTCATTATAGATAAATAAGGACATTTTTTAATTTAAAAAT
TCATGTCTGAGTTGACTTTCATAAGGGATTTCATTTTTTCCTCAACATTCTTAAAGCCTTTTAGTATTTGACGGTTCTTTTTTCCCAGGA
CATTTGCTAGGAATAACAACGTTTCAATGTTTTTAATCTACTTGAGCAACACTATCGTGTCTTACAAAAGTTGTTCATATGTAAATGATC
ATCACATTTCGTGAATTGAGGCCATGTTCAGGTGCTAAGGAAGTTCGCCTTTTACACAGAAGATTGAGAAAATTTCCTAGATATAAATAC
AGATAAATCAGACGTTACAGTGGTGACGTAGTAACCATCATGGCAATGGAAAGGAGTCCAATTCATAGCCTAAAACTTCAAATGTATTCT
TAGGAGTCAGATTTTACTGAATATTTTACCCACAATAGCTGCCTATTTTGTTATAATAAAATATATATAAATATATATATAAAACTTTCT


Top

FusionGenePPI for PCCB_DLG1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
PCCBICT1, UBE2N, INPPL1, EPS15, IFIT1, PARK2, HUWE1, MOV10, NXF1, PPA2, LYPLA1, PCCA, PTEN, WWP2, ZNF746, TRIM25DLG1KCNA4, ADAM17, KCNJ12, KCNJ4, GPR124, CASK, LIN7A, LIN7C, APBA1, KCNA5, GRIN2A, CAMK2A, GRIA1, BTRC, ACTN2, CACNG2, GRIN2B, EPB41, ATP2B4, CRIPT, DLGAP1, KCNJ6, GRIK2, TJAP1, LRRC1, ERBB4, ATP2B2, EZR, KIF13B, CTNNA1, KCNJ2, GUCY1A2, LCK, KCNA3, MARCH2, AMOT, UBE3A, NET1, KHDRBS1, KCNC1, MAP1A, BAI1, HUWE1, ADAM10, NTRK1, TMEM17, DLG3, KIF26B, MAPK12, PARK2, CDH1, TGFA, PTPRE, PTEN, MPP2, EFNB3, GJB7, PRDM1, GPRC5B, WWC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneDLG1chr3:136048826chr3:196921460ENST00000314062-324162_212106854SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000346964-326162_212106927SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000357674-325162_212106894SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000392382-325162_212106872SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000419354-326162_212106905SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000422288-223162_212106854SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000443183-022162_212-17801SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000448528-326162_212106905SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000450955-224162_212106894SH3 domains
TgeneDLG1chr3:136048826chr3:196921460ENST00000452595-021162_212-108789SH3 domains


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for PCCB_DLG1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgenePCCBP05166DB00121BiotinPropionyl-CoA carboxylase beta chain, mitochondrialsmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for PCCB_DLG1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgenePCCBC0268579Propionic acidemia5CTD_human;HPO;ORPHANET;UNIPROT
TgeneDLG1C0036341Schizophrenia3CTD_human
TgeneDLG1C0008925Cleft Palate1CTD_human