FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 2615

FusionGeneSummary for ARID1A_RPS6KA1

check button Fusion gene summary
Fusion gene informationFusion gene name: ARID1A_RPS6KA1
Fusion gene ID: 2615
HgeneTgene
Gene symbol

ARID1A

RPS6KA1

Gene ID

8289

6195

Gene nameAT-rich interaction domain 1Aribosomal protein S6 kinase A1
SynonymsB120|BAF250|BAF250a|BM029|C1orf4|CSS2|ELD|MRD14|OSA1|P270|SMARCF1|hELD|hOSA1HU-1|MAPKAPK1A|RSK|RSK1|p90Rsk
Cytomap

1p36.11

1p36.11

Type of geneprotein-codingprotein-coding
DescriptionAT-rich interactive domain-containing protein 1AARID domain-containing protein 1AAT rich interactive domain 1A (SWI-like)BRG1-associated factor 250aOSA1 nuclear proteinSWI-like proteinSWI/SNF complex protein p270SWI/SNF-related, matrix-associated, ribosomal protein S6 kinase alpha-190 kDa ribosomal protein S6 kinase 1MAP kinase-activated protein kinase 1aMAPK-activated protein kinase 1aMAPKAP kinase 1aMAPKAPK-1aRSK-1S6K-alpha 1dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1)p9
Modification date2018051920180523
UniProtAcc

O14497

Q15418

Ensembl transtripts involved in fusion geneENST00000324856, ENST00000457599, 
ENST00000374152, ENST00000540690, 
ENST00000374168, ENST00000374166, 
ENST00000526792, ENST00000374162, 
ENST00000530003, ENST00000531382, 
ENST00000488985, 
Fusion gene scores* DoF score21 X 13 X 13=35493 X 4 X 4=48
# samples 314
** MAII scorelog2(31/3549*10)=-3.51707245378671
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ARID1A [Title/Abstract] AND RPS6KA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneARID1A

GO:0006337

nucleosome disassembly

8895581

HgeneARID1A

GO:0006338

chromatin remodeling

11726552

HgeneARID1A

GO:0030520

intracellular estrogen receptor signaling pathway

12200431

HgeneARID1A

GO:0030521

androgen receptor signaling pathway

12200431

HgeneARID1A

GO:0042921

glucocorticoid receptor signaling pathway

12200431

HgeneARID1A

GO:0045893

positive regulation of transcription, DNA-templated

12200431

TgeneRPS6KA1

GO:0043154

negative regulation of cysteine-type endopeptidase activity involved in apoptotic process

18402937


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLAMLTCGA-AB-2981-03BARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
TCGARVSTADTCGA-HU-A4GH-01AARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000324856ENST00000374168ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
Frame-shiftENST00000324856ENST00000374166ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-5UTRENST00000324856ENST00000526792ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000324856ENST00000374162ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000324856ENST00000530003ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000324856ENST00000531382ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000324856ENST00000488985ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
Frame-shiftENST00000457599ENST00000374168ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
Frame-shiftENST00000457599ENST00000374166ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-5UTRENST00000457599ENST00000526792ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000457599ENST00000374162ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000457599ENST00000530003ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000457599ENST00000531382ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000457599ENST00000488985ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
In-frameENST00000374152ENST00000374168ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
In-frameENST00000374152ENST00000374166ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-5UTRENST00000374152ENST00000526792ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000374152ENST00000374162ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000374152ENST00000530003ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000374152ENST00000531382ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000374152ENST00000488985ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
Frame-shiftENST00000540690ENST00000374168ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
Frame-shiftENST00000540690ENST00000374166ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-5UTRENST00000540690ENST00000526792ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000540690ENST00000374162ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000540690ENST00000530003ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000540690ENST00000531382ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
5CDS-intronENST00000540690ENST00000488985ARID1Achr1

27105774

+RPS6KA1chr1

26873403

+
In-frameENST00000324856ENST00000374168ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000324856ENST00000374166ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000324856ENST00000526792ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000324856ENST00000374162ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000324856ENST00000530003ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000324856ENST00000531382ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
5CDS-intronENST00000324856ENST00000488985ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000374168ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000374166ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000526792ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000374162ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000530003ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000457599ENST00000531382ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
5CDS-intronENST00000457599ENST00000488985ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000374168ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000374166ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000526792ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000374162ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000530003ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000374152ENST00000531382ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
5CDS-intronENST00000374152ENST00000488985ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000374168ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000374166ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000526792ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000374162ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000530003ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
In-frameENST00000540690ENST00000531382ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+
5CDS-intronENST00000540690ENST00000488985ARID1Achr1

27102198

+RPS6KA1chr1

26897940

+

Top

FusionProtFeatures for ARID1A_RPS6KA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ARID1A

O14497

RPS6KA1

Q15418


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19201327_140417082286Compositional biasNote=Gln-rich
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+1920479_48217082286Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+1920561_56717082286Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+1920998_100117082286Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+1819479_48213251903Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+1819561_56713251903Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+1819998_100113251903Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19201327_140414912069Compositional biasNote=Gln-rich
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+1920479_48214912069Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+1920561_56714912069Compositional biasNote=Poly-Gln
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+1920998_100114912069Compositional biasNote=Poly-Ser
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19201017_110817082286DomainARID
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18191017_110813251903DomainARID
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19201017_110814912069DomainARID
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19201368_138717082286MotifNuclear localization signal
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+1920295_29917082286MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+1819295_29913251903MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19201368_138714912069MotifNuclear localization signal
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+1920295_29914912069MotifNote=LXXLL

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18191327_140413251903Compositional biasNote=Gln-rich
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19201709_171317082286MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19201967_197117082286MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000324856+19202085_208917082286MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18191368_138713251903MotifNuclear localization signal
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18191709_171313251903MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18191967_197113251903MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000374152+18192085_208913251903MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19201709_171314912069MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19201967_197114912069MotifNote=LXXLL
HgeneARID1Achr1:27102198chr1:26897940ENST00000457599+19202085_208914912069MotifNote=LXXLL
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374162+1521322_391438644DomainNote=AGC-kinase C-terminal
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374162+1521418_675438644DomainProtein kinase 2
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374162+152162_321438644DomainProtein kinase 1
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374168+1622322_391530736DomainNote=AGC-kinase C-terminal
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374168+1622418_675530736DomainProtein kinase 2
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374168+162262_321530736DomainProtein kinase 1
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000526792+1622322_391438644DomainNote=AGC-kinase C-terminal
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000526792+1622418_675438644DomainProtein kinase 2
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000526792+162262_321438644DomainProtein kinase 1
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000531382+1521322_391539745DomainNote=AGC-kinase C-terminal
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000531382+1521418_675539745DomainProtein kinase 2
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000531382+152162_321539745DomainProtein kinase 1
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374162+1521424_432438644Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374162+152168_76438644Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374168+1622424_432530736Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000374168+162268_76530736Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000526792+1622424_432438644Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000526792+162268_76438644Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000531382+1521424_432539745Nucleotide bindingATP
TgeneRPS6KA1chr1:27102198chr1:26897940ENST00000531382+152168_76539745Nucleotide bindingATP


Top

FusionGeneSequence for ARID1A_RPS6KA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374168_chr1_26873403_+_2603aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKE
YEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPF
VVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDD
MLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSK
HPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAV
CPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAAR
AIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQ
VICDVLFLIGQSXDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMER
DILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKL
TDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLL
RALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVA
TGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNII
TLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQ
LRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVS

>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374166_chr1_26873403_+_2592aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKE
YEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPF
VVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDD
MLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSK
HPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAV
CPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAAR
AIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQ
VICDVLFLIGQSXDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMER
DILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKL
TDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANR
LGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPR
APQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKH
VYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTP
CYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRL

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_1914aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATAT
AATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTD
EMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPV
PASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVV
HRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTP
EEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTP

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_1697aa
MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGS
GGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPG
LAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQR
FGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHA
PMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQ
IPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQST
TQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNL
SLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVP
GNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYP
RQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVA
MHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPK
TESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNL
NVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPH
SQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPY
SRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPS
GSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRR
RLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENG
LLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVD

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_1531aa
MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQ
QSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQ
QPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGT
EGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQ
SSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGIN
PMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGM
MGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYE
LGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAF
ECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFND
GSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGG
PYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPM
DGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDR
VSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQP
PYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPP
GSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRI
CDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVS
ETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_242aa
MMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPE
VLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374168_chr1_26873403_+_7809nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGCTCCCAGGGTTGCTAGAGCTCCTTGTAGAATATTTCCGACGATGCCTGATTGAGATCTTTGGCATTTTAAAGGAG
TATGAGGTGGGTGACCCAGGACAGAGAACGCTACTGGATCCTGGGAGGTTCAGCAAGGTGTCTAGTCCAGCTCCCATGGAGGGTGGGGAA
GAAGAAGAAGAACTTCTAGGTCCTAAACTAGAAGAGGAAGAAGAAGAGGAAGTAGTTGAAAATGATGAGGAGATAGCCTTTTCAGGCAAG
GACAAGCCAGCTTCAGAGAATAGTGAGGAGAAGCTGATCAGTAAGTTTGACAAGCTTCCAGTAAAGATCGTACAGAAGAATGATCCATTT
GTGGTGGACTGCTCAGATAAGCTTGGGCGTGTGCAGGAGTTTGACAGTGGCCTGCTGCACTGGCGGATTGGTGGGGGGGACACCACTGAG
CATATCCAGACCCACTTCGAGAGCAAGACAGAGCTGCTGCCTTCCCGGCCTCACGCACCCTGCCCACCAGCCCCTCGGAAGCATGTGACA
ACAGCAGAGGGTACACCAGGGACAACAGACCAGGAGGGGCCCCCACCTGATGGACCTCCAGAAAAACGGATCACAGCCACTATGGATGAC
ATGTTGTCTACTCGGTCTAGCACCTTGACCGAGGATGGAGCTAAGAGTTCAGAGGCCATCAAGGAGAGCAGCAAGTTTCCATTTGGCATT
AGCCCAGCACAGAGCCACCGGAACATCAAGATCCTAGAGGACGAACCCCACAGTAAGGATGAGACCCCACTGTGTACCCTTCTGGACTGG
CAGGATTCTCTTGCCAAGCGCTGCGTCTGTGTGTCCAATACCATTCGAAGCCTGTCATTTGTGCCAGGCAATGACTTTGAGATGTCCAAA
CACCCAGGGCTGCTGCTCATCCTGGGCAAGCTGATCCTGCTGCACCACAAGCACCCAGAACGGAAGCAGGCACCACTAACTTATGAAAAG
GAGGAGGAACAGGACCAAGGGGTGAGCTGCAACAAAGTGGAGTGGTGGTGGGACTGCTTGGAGATGCTCCGGGAAAACACCTTGGTTACA
CTCGCCAACATCTCGGGGCAGTTGGACCTATCTCCATACCCCGAGAGCATTTGCCTGCCTGTCCTGGACGGACTCCTACACTGGGCAGTT
TGCCCTTCAGCTGAAGCCCAGGACCCCTTTTCCACCCTGGGCCCCAATGCCGTCCTTTCCCCGCAGAGACTGGTCTTGGAAACCCTCAGC
AAACTCAGCATCCAGGACAACAATGTGGACCTGATTCTGGCCACACCCCCCTTCAGCCGCCTGGAGAAGTTGTATAGCACTATGGTGCGC
TTCCTCAGTGACCGAAAGAACCCGGTGTGCCGGGAGATGGCTGTGGTACTGCTGGCCAACCTGGCTCAGGGGGACAGCCTGGCAGCTCGT
GCCATTGCAGTGCAGAAGGGCAGTATCGGCAACCTCCTGGGCTTCCTAGAGGACAGCCTTGCCGCCACACAGTTCCAGCAGAGCCAGGCC
AGCCTCCTCCACATGCAGAACCCACCCTTTGAGCCAACTAGTGTGGACATGATGCGGCGGGCTGCCCGCGCGCTGCTTGCCTTGGCCAAG
GTGGACGAGAACCACTCAGAGTTTACTCTGTACGAATCACGGCTGTTGGACATCTCGGTATCACCGTTGATGAACTCATTGGTTTCACAA
GTCATTTGTGATGTACTGTTTTTGATTGGCCAGTCATGAGATGAGGGCGTCCTCAAGGAGATCTCCATCACGCACCACGTCAAGGCTGGC
TCTGAGAAGGCTGATCCATCCCATTTCGAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGGAAAGTCACC
CGGCCTGACAGTGGGCACCTGTATGCTATGAAGGTGCTGAAGAAGGCAACGCTGAAAGTACGTGACCGCGTCCGGACCAAGATGGAGAGA
GACATCCTGGCTGATGTAAATCACCCATTCGTGGTGAAGCTGCACTATGCCTTCCAGACCGAGGGCAAGCTCTATCTCATTCTGGACTTC
CTGCGTGGTGGGGACCTCTTCACCCGGCTCTCAAAAGAGGTGATGTTCACGGAGGAGGATGTGAAGTTTTACCTGGCTGAGCTGGCTCTG
GGCCTGGATCACCTGCACAGCCTGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCACATCAAACTC
ACTGACTTTGGCCTGAGCAAAGAGGCCATTGACCACGAGAAGAAGGCCTATTCTTTCTGCGGGACAGTGGAGTACATGGCCCCTGAGGTC
GTCAACCGCCAGGGCCACTCCCATAGTGCGGACTGGTGGTCCTATGGGGTGTTGATGTTTGAGATGCTGACGGGCTCCCTGCCCTTCCAG
GGGAAGGACCGGAAGGAGACCATGACACTGATTCTGAAGGCGAAGCTAGGCATGCCCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTG
CGGGCCCTGTTCAAGCGGAATCCTGCCAACCGGCTCGGCTCCGGCCCTGATGGGGCAGAGGAAATCAAGCGGCATGTCTTCTACTCCACC
ATTGACTGGAATAAGCTATACCGTCGTGAGATCAAGCCACCCTTCAAGCCAGCAGTGGCTCAGCCTGATGACACCTTCTACTTTGACACC
GAGTTCACGTCCCGCACACCCAAGGATTCCCCAGGCATCCCCCCCAGCGCTGGGGCCCATCAGCTGTTCCGGGGCTTCAGCTTCGTGGCC
ACCGGCCTGATGGAAGACGACGGCAAGCCTCGTGCCCCGCAGGCACCCCTGCACTCGGTGGTACAGCAACTCCATGGGAAGAACCTGGTT
TTTAGTGACGGCTACGTGGTAAAGGAGACAATTGGTGTGGGCTCCTACTCTGAGTGCAAGCGCTGTGTCCACAAGGCCACCAACATGGAG
TATGCTGTCAAGGTCATTGATAAGAGCAAGCGGGATCCTTCAGAAGAGATTGAGATTCTTCTGCGGTATGGCCAGCACCCCAACATCATC
ACTCTGAAAGATGTGTATGATGATGGCAAACACGTGTACCTGGTGACAGAGCTGATGCGGGGTGGGGAGCTGCTGGACAAGATCCTGCGG
CAGAAGTTCTTCTCAGAGCGGGAGGCCAGCTTTGTCCTGCACACCATTGGCAAAACTGTGGAGTATCTGCACTCACAGGGGGTTGTGCAC
AGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAG
CTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAA
GGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAG
GAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCC
AAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAA
AGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAG

>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374166_chr1_26873403_+_7776nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGCTCCCAGGGTTGCTAGAGCTCCTTGTAGAATATTTCCGACGATGCCTGATTGAGATCTTTGGCATTTTAAAGGAG
TATGAGGTGGGTGACCCAGGACAGAGAACGCTACTGGATCCTGGGAGGTTCAGCAAGGTGTCTAGTCCAGCTCCCATGGAGGGTGGGGAA
GAAGAAGAAGAACTTCTAGGTCCTAAACTAGAAGAGGAAGAAGAAGAGGAAGTAGTTGAAAATGATGAGGAGATAGCCTTTTCAGGCAAG
GACAAGCCAGCTTCAGAGAATAGTGAGGAGAAGCTGATCAGTAAGTTTGACAAGCTTCCAGTAAAGATCGTACAGAAGAATGATCCATTT
GTGGTGGACTGCTCAGATAAGCTTGGGCGTGTGCAGGAGTTTGACAGTGGCCTGCTGCACTGGCGGATTGGTGGGGGGGACACCACTGAG
CATATCCAGACCCACTTCGAGAGCAAGACAGAGCTGCTGCCTTCCCGGCCTCACGCACCCTGCCCACCAGCCCCTCGGAAGCATGTGACA
ACAGCAGAGGGTACACCAGGGACAACAGACCAGGAGGGGCCCCCACCTGATGGACCTCCAGAAAAACGGATCACAGCCACTATGGATGAC
ATGTTGTCTACTCGGTCTAGCACCTTGACCGAGGATGGAGCTAAGAGTTCAGAGGCCATCAAGGAGAGCAGCAAGTTTCCATTTGGCATT
AGCCCAGCACAGAGCCACCGGAACATCAAGATCCTAGAGGACGAACCCCACAGTAAGGATGAGACCCCACTGTGTACCCTTCTGGACTGG
CAGGATTCTCTTGCCAAGCGCTGCGTCTGTGTGTCCAATACCATTCGAAGCCTGTCATTTGTGCCAGGCAATGACTTTGAGATGTCCAAA
CACCCAGGGCTGCTGCTCATCCTGGGCAAGCTGATCCTGCTGCACCACAAGCACCCAGAACGGAAGCAGGCACCACTAACTTATGAAAAG
GAGGAGGAACAGGACCAAGGGGTGAGCTGCAACAAAGTGGAGTGGTGGTGGGACTGCTTGGAGATGCTCCGGGAAAACACCTTGGTTACA
CTCGCCAACATCTCGGGGCAGTTGGACCTATCTCCATACCCCGAGAGCATTTGCCTGCCTGTCCTGGACGGACTCCTACACTGGGCAGTT
TGCCCTTCAGCTGAAGCCCAGGACCCCTTTTCCACCCTGGGCCCCAATGCCGTCCTTTCCCCGCAGAGACTGGTCTTGGAAACCCTCAGC
AAACTCAGCATCCAGGACAACAATGTGGACCTGATTCTGGCCACACCCCCCTTCAGCCGCCTGGAGAAGTTGTATAGCACTATGGTGCGC
TTCCTCAGTGACCGAAAGAACCCGGTGTGCCGGGAGATGGCTGTGGTACTGCTGGCCAACCTGGCTCAGGGGGACAGCCTGGCAGCTCGT
GCCATTGCAGTGCAGAAGGGCAGTATCGGCAACCTCCTGGGCTTCCTAGAGGACAGCCTTGCCGCCACACAGTTCCAGCAGAGCCAGGCC
AGCCTCCTCCACATGCAGAACCCACCCTTTGAGCCAACTAGTGTGGACATGATGCGGCGGGCTGCCCGCGCGCTGCTTGCCTTGGCCAAG
GTGGACGAGAACCACTCAGAGTTTACTCTGTACGAATCACGGCTGTTGGACATCTCGGTATCACCGTTGATGAACTCATTGGTTTCACAA
GTCATTTGTGATGTACTGTTTTTGATTGGCCAGTCATGAGATGAGGGCGTCCTCAAGGAGATCTCCATCACGCACCACGTCAAGGCTGGC
TCTGAGAAGGCTGATCCATCCCATTTCGAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGGAAAGTCACC
CGGCCTGACAGTGGGCACCTGTATGCTATGAAGGTGCTGAAGAAGGCAACGCTGAAAGTACGTGACCGCGTCCGGACCAAGATGGAGAGA
GACATCCTGGCTGATGTAAATCACCCATTCGTGGTGAAGCTGCACTATGCCTTCCAGACCGAGGGCAAGCTCTATCTCATTCTGGACTTC
CTGCGTGGTGGGGACCTCTTCACCCGGCTCTCAAAAGAGGTGATGTTCACGGAGGAGGATGTGAAGTTTTACCTGGCTGAGCTGGCTCTG
GGCCTGGATCACCTGCACAGCCTGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCACATCAAACTC
ACTGACTTTGGCCTGAGCAAAGAGGCCATTGACCACGAGAAGAAGGCCTATTCTTTCTGCGGGACAGTGGAGTACATGGCCCCTGAGGTC
GTCAACCGCCAGGGCCACTCCCATAGTGCGGACTGGTGGTCCTATGGGGTGTTGATGGGGAAGGACCGGAAGGAGACCATGACACTGATT
CTGAAGGCGAAGCTAGGCATGCCCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTGCGGGCCCTGTTCAAGCGGAATCCTGCCAACCGG
CTCGGCTCCGGCCCTGATGGGGCAGAGGAAATCAAGCGGCATGTCTTCTACTCCACCATTGACTGGAATAAGCTATACCGTCGTGAGATC
AAGCCACCCTTCAAGCCAGCAGTGGCTCAGCCTGATGACACCTTCTACTTTGACACCGAGTTCACGTCCCGCACACCCAAGGATTCCCCA
GGCATCCCCCCCAGCGCTGGGGCCCATCAGCTGTTCCGGGGCTTCAGCTTCGTGGCCACCGGCCTGATGGAAGACGACGGCAAGCCTCGT
GCCCCGCAGGCACCCCTGCACTCGGTGGTACAGCAACTCCATGGGAAGAACCTGGTTTTTAGTGACGGCTACGTGGTAAAGGAGACAATT
GGTGTGGGCTCCTACTCTGAGTGCAAGCGCTGTGTCCACAAGGCCACCAACATGGAGTATGCTGTCAAGGTCATTGATAAGAGCAAGCGG
GATCCTTCAGAAGAGATTGAGATTCTTCTGCGGTATGGCCAGCACCCCAACATCATCACTCTGAAAGATGTGTATGATGATGGCAAACAC
GTGTACCTGGTGACAGAGCTGATGCGGGGTGGGGAGCTGCTGGACAAGATCCTGCGGCAGAAGTTCTTCTCAGAGCGGGAGGCCAGCTTT
GTCCTGCACACCATTGGCAAAACTGTGGAGTATCTGCACTCACAGGGGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTG
GACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCT
TGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTG
TACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTT
ACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTC
ACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTG
AAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAG

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_5742nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCT
GCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCC
CAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACA
GCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACC
AATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGG
CGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGAT
GAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCT
GTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCC
CTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTA
CCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAG
CCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTC
CTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTG
CACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAA
CAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGAT
GAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCA
GAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTG
TCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCC
CAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCC

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_5091nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_4593nt
ATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAA
GGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGC
GGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAG
CAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAG
CCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCA
TACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAG
CAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCC
CAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGA
GGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACA
GAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCT
CATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCA
CTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAA
TCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCG
CGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTAT
GGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAAC
CCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATG
GGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAA
ACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATG
ATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACC
ATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAAC
AAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAG
CTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCT
GTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGG
CGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTT
GAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCC
TCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCA
ACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGAT
GGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGC
ATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAAC
GGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGT
CCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAAC
CCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTC
TCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATG
GATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAG
CAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAAT
GCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGT
GTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAG
CAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTAT
CATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCC
CCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCT
CAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATG
CAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCT
GGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATG
ATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACC
TTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATC
TGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTG
CTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCC
AACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCA
GAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTC
ACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTC
AACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_726nt
ATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATG
ACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGC
ATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAG
GTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTT
GCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTT
TCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGG
GTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCA
CTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374168_chr1_26873403_+_8521nt
AGAGAGAGGGAGGGAGCGAGAGGGAGAGCAAAAGAAGGAAAGGATCCAAGAAAAAAAAGCCCCAACCACACACCAGCGGCTGCAGGACTG
GGCACAGCATGAGATCCAAAGGCAGGGCAAGGAAACTGGCCACAAATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAG
GGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCAT
GCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCT
CCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAG
GCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAG
CAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCC
CCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCA
ATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAAT
CCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGT
GTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGC
ATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCC
CAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGC
TATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGT
GCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCA
GGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCC
CCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTAC
CCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGA
CCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTA
ACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAAT
GAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCC
ATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACT
CAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAG
TATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAG
TCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCA
GAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTT
GGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATG
AATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTC
ATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCA
CGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCA
CAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGA
CATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAA
CAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACT
GGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAA
GATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTT
CCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATA
CAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGC
TCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGG
CCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCA
CCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCA
TTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATT
CGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGA
ACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTG
TATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGCTCCCAGGGTTGCTAGAGCTCCTTGTAGAATATTTCCGACGATGCCTGATT
GAGATCTTTGGCATTTTAAAGGAGTATGAGGTGGGTGACCCAGGACAGAGAACGCTACTGGATCCTGGGAGGTTCAGCAAGGTGTCTAGT
CCAGCTCCCATGGAGGGTGGGGAAGAAGAAGAAGAACTTCTAGGTCCTAAACTAGAAGAGGAAGAAGAAGAGGAAGTAGTTGAAAATGAT
GAGGAGATAGCCTTTTCAGGCAAGGACAAGCCAGCTTCAGAGAATAGTGAGGAGAAGCTGATCAGTAAGTTTGACAAGCTTCCAGTAAAG
ATCGTACAGAAGAATGATCCATTTGTGGTGGACTGCTCAGATAAGCTTGGGCGTGTGCAGGAGTTTGACAGTGGCCTGCTGCACTGGCGG
ATTGGTGGGGGGGACACCACTGAGCATATCCAGACCCACTTCGAGAGCAAGACAGAGCTGCTGCCTTCCCGGCCTCACGCACCCTGCCCA
CCAGCCCCTCGGAAGCATGTGACAACAGCAGAGGGTACACCAGGGACAACAGACCAGGAGGGGCCCCCACCTGATGGACCTCCAGAAAAA
CGGATCACAGCCACTATGGATGACATGTTGTCTACTCGGTCTAGCACCTTGACCGAGGATGGAGCTAAGAGTTCAGAGGCCATCAAGGAG
AGCAGCAAGTTTCCATTTGGCATTAGCCCAGCACAGAGCCACCGGAACATCAAGATCCTAGAGGACGAACCCCACAGTAAGGATGAGACC
CCACTGTGTACCCTTCTGGACTGGCAGGATTCTCTTGCCAAGCGCTGCGTCTGTGTGTCCAATACCATTCGAAGCCTGTCATTTGTGCCA
GGCAATGACTTTGAGATGTCCAAACACCCAGGGCTGCTGCTCATCCTGGGCAAGCTGATCCTGCTGCACCACAAGCACCCAGAACGGAAG
CAGGCACCACTAACTTATGAAAAGGAGGAGGAACAGGACCAAGGGGTGAGCTGCAACAAAGTGGAGTGGTGGTGGGACTGCTTGGAGATG
CTCCGGGAAAACACCTTGGTTACACTCGCCAACATCTCGGGGCAGTTGGACCTATCTCCATACCCCGAGAGCATTTGCCTGCCTGTCCTG
GACGGACTCCTACACTGGGCAGTTTGCCCTTCAGCTGAAGCCCAGGACCCCTTTTCCACCCTGGGCCCCAATGCCGTCCTTTCCCCGCAG
AGACTGGTCTTGGAAACCCTCAGCAAACTCAGCATCCAGGACAACAATGTGGACCTGATTCTGGCCACACCCCCCTTCAGCCGCCTGGAG
AAGTTGTATAGCACTATGGTGCGCTTCCTCAGTGACCGAAAGAACCCGGTGTGCCGGGAGATGGCTGTGGTACTGCTGGCCAACCTGGCT
CAGGGGGACAGCCTGGCAGCTCGTGCCATTGCAGTGCAGAAGGGCAGTATCGGCAACCTCCTGGGCTTCCTAGAGGACAGCCTTGCCGCC
ACACAGTTCCAGCAGAGCCAGGCCAGCCTCCTCCACATGCAGAACCCACCCTTTGAGCCAACTAGTGTGGACATGATGCGGCGGGCTGCC
CGCGCGCTGCTTGCCTTGGCCAAGGTGGACGAGAACCACTCAGAGTTTACTCTGTACGAATCACGGCTGTTGGACATCTCGGTATCACCG
TTGATGAACTCATTGGTTTCACAAGTCATTTGTGATGTACTGTTTTTGATTGGCCAGTCATGACTGGCTCTGAGAAGGCTGATCCATCCC
ATTTCGAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGGAAAGTCACCCGGCCTGACAGTGGGCACCTGT
ATGCTATGAAGGTGCTGAAGAAGGCAACGCTGAAAGTACGTGACCGCGTCCGGACCAAGATGGAGAGAGACATCCTGGCTGATGTAAATC
ACCCATTCGTGGTGAAGCTGCACTATGCCTTCCAGACCGAGGGCAAGCTCTATCTCATTCTGGACTTCCTGCGTGGTGGGGACCTCTTCA
CCCGGCTCTCAAAAGAGGTGATGTTCACGGAGGAGGATGTGAAGTTTTACCTGGCTGAGCTGGCTCTGGGCCTGGATCACCTGCACAGCC
TGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCACATCAAACTCACTGACTTTGGCCTGAGCAAAG
AGGCCATTGACCACGAGAAGAAGGCCTATTCTTTCTGCGGGACAGTGGAGTACATGGCCCCTGAGGTCGTCAACCGCCAGGGCCACTCCC
ATAGTGCGGACTGGTGGTCCTATGGGGTGTTGATGTTTGAGATGCTGACGGGCTCCCTGCCCTTCCAGGGGAAGGACCGGAAGGAGACCA
TGACACTGATTCTGAAGGCGAAGCTAGGCATGCCCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTGCGGGCCCTGTTCAAGCGGAATC
CTGCCAACCGGCTCGGCTCCGGCCCTGATGGGGCAGAGGAAATCAAGCGGCATGTCTTCTACTCCACCATTGACTGGAATAAGCTATACC
GTCGTGAGATCAAGCCACCCTTCAAGCCAGCAGTGGCTCAGCCTGATGACACCTTCTACTTTGACACCGAGTTCACGTCCCGCACACCCA
AGGATTCCCCAGGCATCCCCCCCAGCGCTGGGGCCCATCAGCTGTTCCGGGGCTTCAGCTTCGTGGCCACCGGCCTGATGGAAGACGACG
GCAAGCCTCGTGCCCCGCAGGCACCCCTGCACTCGGTGGTACAGCAACTCCATGGGAAGAACCTGGTTTTTAGTGACGGCTACGTGGTAA
AGGAGACAATTGGTGTGGGCTCCTACTCTGAGTGCAAGCGCTGTGTCCACAAGGCCACCAACATGGAGTATGCTGTCAAGGTCATTGATA
AGAGCAAGCGGGATCCTTCAGAAGAGATTGAGATTCTTCTGCGGTATGGCCAGCACCCCAACATCATCACTCTGAAAGATGTGTATGATG
ATGGCAAACACGTGTACCTGGTGACAGAGCTGATGCGGGGTGGGGAGCTGCTGGACAAGATCCTGCGGCAGAAGTTCTTCTCAGAGCGGG
AGGCCAGCTTTGTCCTGCACACCATTGGCAAAACTGTGGAGTATCTGCACTCACAGGGGGTTGTGCACAGGGACCTGAAGCCCAGCAACA
TCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCC
TCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGG
GCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCA
GTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCC
ACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACC
TACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCA
TCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACAC
AGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAA
CACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTG
TATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTG
CGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACGATTG
GCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCC
CCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGC
TTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTT
TGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTT

>In-frame_ARID1A_ENST00000374152_chr1_27105774_+_RPS6KA1_ENST00000374166_chr1_26873403_+_8477nt
AGAGAGAGGGAGGGAGCGAGAGGGAGAGCAAAAGAAGGAAAGGATCCAAGAAAAAAAAGCCCCAACCACACACCAGCGGCTGCAGGACTG
GGCACAGCATGAGATCCAAAGGCAGGGCAAGGAAACTGGCCACAAATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAG
GGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCAT
GCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCT
CCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAG
GCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAG
CAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCC
CCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCA
ATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAAT
CCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGT
GTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGC
ATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCC
CAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGC
TATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGT
GCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCA
GGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCC
CCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTAC
CCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGA
CCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTA
ACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAAT
GAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCC
ATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACT
CAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAG
TATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAG
TCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCA
GAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTT
GGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATG
AATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTC
ATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCA
CGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCA
CAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGA
CATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAA
CAGCAGAATTACAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACT
GGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAA
GATGTATACAACCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTT
CCATTCCAGTTTGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATA
CAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGC
TCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGG
CCTTCCCATGGCACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCA
CCAAGCATGCAGAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCA
TTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATT
CGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGA
ACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTG
TATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGCTCCCAGGGTTGCTAGAGCTCCTTGTAGAATATTTCCGACGATGCCTGATT
GAGATCTTTGGCATTTTAAAGGAGTATGAGGTGGGTGACCCAGGACAGAGAACGCTACTGGATCCTGGGAGGTTCAGCAAGGTGTCTAGT
CCAGCTCCCATGGAGGGTGGGGAAGAAGAAGAAGAACTTCTAGGTCCTAAACTAGAAGAGGAAGAAGAAGAGGAAGTAGTTGAAAATGAT
GAGGAGATAGCCTTTTCAGGCAAGGACAAGCCAGCTTCAGAGAATAGTGAGGAGAAGCTGATCAGTAAGTTTGACAAGCTTCCAGTAAAG
ATCGTACAGAAGAATGATCCATTTGTGGTGGACTGCTCAGATAAGCTTGGGCGTGTGCAGGAGTTTGACAGTGGCCTGCTGCACTGGCGG
ATTGGTGGGGGGGACACCACTGAGCATATCCAGACCCACTTCGAGAGCAAGACAGAGCTGCTGCCTTCCCGGCCTCACGCACCCTGCCCA
CCAGCCCCTCGGAAGCATGTGACAACAGCAGAGGGTACACCAGGGACAACAGACCAGGAGGGGCCCCCACCTGATGGACCTCCAGAAAAA
CGGATCACAGCCACTATGGATGACATGTTGTCTACTCGGTCTAGCACCTTGACCGAGGATGGAGCTAAGAGTTCAGAGGCCATCAAGGAG
AGCAGCAAGTTTCCATTTGGCATTAGCCCAGCACAGAGCCACCGGAACATCAAGATCCTAGAGGACGAACCCCACAGTAAGGATGAGACC
CCACTGTGTACCCTTCTGGACTGGCAGGATTCTCTTGCCAAGCGCTGCGTCTGTGTGTCCAATACCATTCGAAGCCTGTCATTTGTGCCA
GGCAATGACTTTGAGATGTCCAAACACCCAGGGCTGCTGCTCATCCTGGGCAAGCTGATCCTGCTGCACCACAAGCACCCAGAACGGAAG
CAGGCACCACTAACTTATGAAAAGGAGGAGGAACAGGACCAAGGGGTGAGCTGCAACAAAGTGGAGTGGTGGTGGGACTGCTTGGAGATG
CTCCGGGAAAACACCTTGGTTACACTCGCCAACATCTCGGGGCAGTTGGACCTATCTCCATACCCCGAGAGCATTTGCCTGCCTGTCCTG
GACGGACTCCTACACTGGGCAGTTTGCCCTTCAGCTGAAGCCCAGGACCCCTTTTCCACCCTGGGCCCCAATGCCGTCCTTTCCCCGCAG
AGACTGGTCTTGGAAACCCTCAGCAAACTCAGCATCCAGGACAACAATGTGGACCTGATTCTGGCCACACCCCCCTTCAGCCGCCTGGAG
AAGTTGTATAGCACTATGGTGCGCTTCCTCAGTGACCGAAAGAACCCGGTGTGCCGGGAGATGGCTGTGGTACTGCTGGCCAACCTGGCT
CAGGGGGACAGCCTGGCAGCTCGTGCCATTGCAGTGCAGAAGGGCAGTATCGGCAACCTCCTGGGCTTCCTAGAGGACAGCCTTGCCGCC
ACACAGTTCCAGCAGAGCCAGGCCAGCCTCCTCCACATGCAGAACCCACCCTTTGAGCCAACTAGTGTGGACATGATGCGGCGGGCTGCC
CGCGCGCTGCTTGCCTTGGCCAAGGTGGACGAGAACCACTCAGAGTTTACTCTGTACGAATCACGGCTGTTGGACATCTCGGTATCACCG
TTGATGAACTCATTGGTTTCACAAGTCATTTGTGATGTACTGTTTTTGATTGGCCAGTCATGACTGGCTCTGAGAAGGCTGATCCATCCC
ATTTCGAGCTCCTCAAGGTTCTGGGCCAGGGATCCTTTGGCAAAGTCTTCCTGGTGCGGAAAGTCACCCGGCCTGACAGTGGGCACCTGT
ATGCTATGAAGGTGCTGAAGAAGGCAACGCTGAAAGTACGTGACCGCGTCCGGACCAAGATGGAGAGAGACATCCTGGCTGATGTAAATC
ACCCATTCGTGGTGAAGCTGCACTATGCCTTCCAGACCGAGGGCAAGCTCTATCTCATTCTGGACTTCCTGCGTGGTGGGGACCTCTTCA
CCCGGCTCTCAAAAGAGGTGATGTTCACGGAGGAGGATGTGAAGTTTTACCTGGCTGAGCTGGCTCTGGGCCTGGATCACCTGCACAGCC
TGGGTATCATTTACAGAGACCTCAAGCCTGAGAACATCCTTCTGGATGAGGAGGGCCACATCAAACTCACTGACTTTGGCCTGAGCAAAG
AGGCCATTGACCACGAGAAGAAGGCCTATTCTTTCTGCGGGACAGTGGAGTACATGGCCCCTGAGGTCGTCAACCGCCAGGGCCACTCCC
ATAGTGCGGACTGGTGGTCCTATGGGGTGTTGATGGGGAAGGACCGGAAGGAGACCATGACACTGATTCTGAAGGCGAAGCTAGGCATGC
CCCAGTTTCTGAGCACTGAAGCCCAGAGCCTCTTGCGGGCCCTGTTCAAGCGGAATCCTGCCAACCGGCTCGGCTCCGGCCCTGATGGGG
CAGAGGAAATCAAGCGGCATGTCTTCTACTCCACCATTGACTGGAATAAGCTATACCGTCGTGAGATCAAGCCACCCTTCAAGCCAGCAG
TGGCTCAGCCTGATGACACCTTCTACTTTGACACCGAGTTCACGTCCCGCACACCCAAGGATTCCCCAGGCATCCCCCCCAGCGCTGGGG
CCCATCAGCTGTTCCGGGGCTTCAGCTTCGTGGCCACCGGCCTGATGGAAGACGACGGCAAGCCTCGTGCCCCGCAGGCACCCCTGCACT
CGGTGGTACAGCAACTCCATGGGAAGAACCTGGTTTTTAGTGACGGCTACGTGGTAAAGGAGACAATTGGTGTGGGCTCCTACTCTGAGT
GCAAGCGCTGTGTCCACAAGGCCACCAACATGGAGTATGCTGTCAAGGTCATTGATAAGAGCAAGCGGGATCCTTCAGAAGAGATTGAGA
TTCTTCTGCGGTATGGCCAGCACCCCAACATCATCACTCTGAAAGATGTGTATGATGATGGCAAACACGTGTACCTGGTGACAGAGCTGA
TGCGGGGTGGGGAGCTGCTGGACAAGATCCTGCGGCAGAAGTTCTTCTCAGAGCGGGAGGCCAGCTTTGTCCTGCACACCATTGGCAAAA
CTGTGGAGTATCTGCACTCACAGGGGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGT
GCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGG
CGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATA
CTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGA
ACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGC
ATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGT
ACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCAT
CCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGA
ACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTC
CTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCA
ACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGG
CTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGA
CAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGG
GAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAG
TGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACA
GAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCCAT

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_6937nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA
GGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCT
GGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTC
TCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAG
ATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGC
AGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTC
AGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTG
CTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCT
GGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGG
GCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCCATGGCCTTTCTAATAAACTGTTG

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_6926nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA
GGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCT
GGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTC
TCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAG
ATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGC
AGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTC
AGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTG
CTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCT
GGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGG

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_6343nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA
GGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCT
GGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_6343nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA
GGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCT
GGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTC

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_6926nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA
GGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCT
GGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTC
TCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAG
ATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGC
AGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTC
AGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTG
CTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCT
GGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGG

>In-frame_ARID1A_ENST00000324856_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_6188nt
GAAAGCGGAGAGTCACAGCGGGGCCAGGCCCTGGGGAGCGGAGCCTCCACCGCCCCCCTCATTCCCAGGCAAGGGCTTGGGGGGAATGAG
CCGGGAGAGCCGGGTCCCGAGCCTACAGAGCCGGGAGCAGCTGAGCCGCCGGCGCCTCGGCCGCCGCCGCCGCCTCCTCCTCCTCCGCCG
CCGCCAGCCCGGAGCCTGAGCCGGCGGGGCGGGGGGGAGAGGAGCGAGCGCAGCGCAGCAGCGGAGCCCCGCGAGGCCCGCCCGGGCGGG
TGGGGAGGGCAGCCCGGGGGACTGGGCCCCGGGGCGGGGTGGGAGGGGGGGAGAAGACGAAGACAGGGCCGGGTCTCTCCGCGGACGAGA
CAGCGGGGATCATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAG
CCGAGCAGCAGCAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGG
AAAGCGAGGGCCCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCG
GAGCCGGCAGCGGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACC
TCACGGAGCCGCCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAG
CCTACGGCTTCGGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAAC
AAAGCCCTGGCCTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCT
TCCCCAACCACCAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTG
GCACTCCGGGCTCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCG
CTCAGCAGCGCTTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACC
AACTGCTCACGTCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCA
AGGGCCCGGCGGACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGA
GCCACCACGCGCCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGA
TGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGT
ACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTT
ATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTC
ACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTC
AACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCC
AGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGC
AGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCT
TCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAG
ATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTC
TGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCC
CTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTG
CTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTG
CCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTT
CCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAG
GTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTG
CCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGC
CTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAA
CTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTG
GACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACA
ATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATG
GGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTG
AGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGA
AACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTG
CAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGA
TTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGG
GATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCAT
CCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACT
CCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATG
AGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGG
GTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACA
GAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGG
GGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAG
GCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTACAAGCGGCCAATGGATGGCACAT
ATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCAGCCTCAGCAGCAGCAGTTGCCCC
CAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAACCAGTATGGCAATGCCTATCCTG
CCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTTTGGCCGAGACCGTGTCTCTGCAC
CCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGCTGAGGTTGCTCAGCAAGGCACCA
TGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCAGGGCCCCGCCTATCATGGCGTGA
ACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGGCACACGCCAGCCCCCATATGGTC
CCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCAGAATCACATTCCTCAGGTATCCA
GCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAG
GTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTG
AAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCA
AGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCA
GTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTG
GTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCC
AGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCA
GTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCA
AGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAG
ACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCA
AGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCA

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_5915nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG
ACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCC
AGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTC
ACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCC
ATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACG
ATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCT
ATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTC
CAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCAC
TTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATT

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_5904nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG
ACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCC
AGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTC
ACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCC
ATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACG
ATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCT
ATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTC
CAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCAC
TTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATT

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_5321nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG
ACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCC
AGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTC

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_5321nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG
ACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCC
AGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTC

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_5904nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG
ACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCC
AGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTC
ACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCC
ATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACG
ATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCT
ATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTC
CAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCAC
TTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATT

>In-frame_ARID1A_ENST00000457599_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_5166nt
ATGGCCGCGCAGGTCGCCCCCGCCGCCGCCAGCAGCCTGGGCAACCCGCCGCCGCCGCCGCCCTCGGAGCTGAAGAAAGCCGAGCAGCAG
CAGCGGGAGGAGGCGGGGGGCGAGGCGGCGGCGGCGGCAGCGGCCGAGCGCGGGGAAATGAAGGCAGCCGCCGGGCAGGAAAGCGAGGGC
CCCGCCGTGGGGCCGCCGCAGCCGCTGGGAAAGGAGCTGCAGGACGGGGCCGAGAGCAATGGGGGTGGCGGCGGCGGCGGAGCCGGCAGC
GGCGGCGGGCCCGGCGCGGAGCCGGACCTGAAGAACTCGAACGGGAACGCGGGCCCTAGGCCCGCCCTGAACAATAACCTCACGGAGCCG
CCCGGCGGCGGCGGTGGCGGCAGCAGCGATGGGGTGGGGGCGCCTCCTCACTCAGCCGCGGCCGCCTTGCCGCCCCCAGCCTACGGCTTC
GGGCAACCCTACGGCCGGAGCCCGTCTGCCGTCGCCGCCGCCGCGGCCGCCGTCTTCCACCAACAACATGGCGGACAACAAAGCCCTGGC
CTGGCAGCGCTGCAGAGCGGCGGCGGCGGGGGCCTGGAGCCCTACGCGGGGCCCCAGCAGAACTCTCACGACCACGGCTTCCCCAACCAC
CAGTACAACTCCTACTACCCCAACCGCAGCGCCTACCCCCCGCCCGCCCCGGCCTACGCGCTGAGCTCCCCGAGAGGTGGCACTCCGGGC
TCCGGCGCGGCGGCGGCTGCCGGCTCCAAGCCGCCTCCCTCCTCCAGCGCCTCCGCCTCCTCGTCGTCTTCGTCCTTCGCTCAGCAGCGC
TTCGGGGCCATGGGGGGAGGCGGCCCCTCCGCGGCCGGCGGGGGAACTCCCCAGCCCACCGCCACCCCCACCCTCAACCAACTGCTCACG
TCGCCCAGCTCGGCCCGGGGCTACCAGGGCTACCCCGGGGGCGACTACAGTGGCGGGCCCCAGGACGGGGGCGCCGGCAAGGGCCCGGCG
GACATGGCCTCGCAGTGTTGGGGGGCTGCGGCGGCGGCAGCTGCGGCGGCGGCCGCCTCGGGAGGGGCCCAACAAAGGAGCCACCACGCG
CCCATGAGCCCCGGGAGCAGCGGCGGCGGGGGGCAGCCGCTCGCCCGGACCCCTCAGCCATCCAGTCCAATGGATCAGATGGGCAAGATG
AGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTCAGGACCGCAGCAAGGACATGGGTACCCAGGGCAG
CCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCAGAGTGCCATGGGCGGCCTCTCTTATACACAGCAG
ATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCCATATTACAACCAGCAAAGTCCTCACCCTCAGCAG
CAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTCGTATCAGCAGCAGCCACAGTCTCAACCACCACAG
CTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCAGTCCCCGGCTCCATACCCCTCCCAGCAGTCGACG
ACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCCTTACCAGCAGCAGCAACCTCAGCAGCCAGCACCC
TCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCAAACTGCCTATTCCCAGCAGCGCTTCCCTCCACCG
CAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGACCTCCAGTAAGGGAGGGCAAGAAGATATGAACCTG
AGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCTCCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGA
GTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTCTCCTTTCTCTCCTCATACCTCCCCTCACCTGCCT
GGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTCTCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCA
GGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCCTTCCATGAACCAATCAAGCATTGCCCAAGATCGA
GGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTCAGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAG
ATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCAGGGGGGTCAGTATGGCCCACAAGGTGGCTACCCC
AGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGCTGGAGGCATAAACCCCATGGGTGCCGGAGGTCAA
ATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAGTCACGCCTCCATGGGCAACCGGCCTTATGGCCCT
AACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGGCATGAACCGGAAAACCCAAGAAACTGCTGTCGCC
ATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAATCAAGGGGGCATGATGGGAACTGGACCTCCTTAT
GGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTCCATGGGTGGAACCATGGCCAACAATTCTGCAGGG
ATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCACCAAAATGAACAACAAGGCAGATGGGACACCCAAG
ACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCACCAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGG
AAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGACAAATCTGCCTGCTGTGGGTAGGAAACCTCTGGAC
CTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAAGAACAAAAAATGGCGGGAACTTGCAACCAACCTC
AATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTGTCTCTATGCCTTTGAATGCAAGATTGAACGGGGA
GAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAAGATCCAGCCTCCCTCTCCTGCGGGATCAGGATCT
ATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGACTTAAAGCCACCAACTCCAGCATCCACACCACAC
AGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGATGCCTTTAATGATGGAAGTGACTCCACATTCCAG
AAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGACATGATGGGGCGCATGTCCTATGAGCCAAATAAG
GATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTAC
AGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACG
GAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCT
CCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCT
GGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAAC
CGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTCTGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCT
GCCCCTGTGCAGCCCCCCATGATTCGGCGGGATATCACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGG
CGGCTCACAATGAAAGACATTGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCA
TTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGC
AACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGG
CTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGC
CTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATC
GGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGAT
CCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAG
GACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCA
TCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTG

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_5700nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG
GAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTC
TCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCAT
CAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGG
GGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGA
GACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCT
GGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCC
AGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGA
CAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCC

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_5689nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG
GAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTC
TCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCAT
CAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGG
GGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGA
GACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCT
GGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCC
AGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGA
CAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCC

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_5106nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG
GAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTC

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_5106nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG
GAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTC

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_5689nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG
GAACCACAGGGCCAGAGGGAGCTGGAACCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTC
TCCTTCCCCAGGATGGACTCTTCTCGGCTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCAT
CAACCACCATGGATTTTTACAAGATCCATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGG
GGCTCTCTGAGACTCTTTAGAGCAGCTTTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGA
GACAGTCCAGTGTCACCTCTCTCAGAGCATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCT
GGGAGTTCTAGAACCACTTCCTGCTACAGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCC
AGTGGATCCCCTGCGGTCAGGCTGGGCAGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGA
CAGAGTTCACAGGAGGCCAGTGGGCGGGCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCC

>In-frame_ARID1A_ENST00000374152_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_4951nt
TGGATCTCAAGCAGTACCACAGTTACAAAGTAGTTTTTAGCTTACAAGGTGTTTTCACAAATAGGTGGTATTTTCATTTTTCAAATGACA
AAATTAGGGTTCTGAGGCGGGTCAGTTGACTTAAAGGTTACTAGGTTGGTCTCATTGCTCTTTCAAAGTAACTGTATTTCTTTATAGCAT
ACAGACTAAAAAAACCTGTGTACTTGGGTTATATATTCAGTGGCCAGAGGCCATCAAAGCTCAGGTTAATGAAATGCTCTTTATTTTGTA
GCCATCCAGTCCAATGGATCAGATGGGCAAGATGAGACCTCAGCCATATGGCGGGACTAACCCATACTCGCAGCAACAGGGACCTCCGTC
AGGACCGCAGCAAGGACATGGGTACCCAGGGCAGCCATACGGGTCCCAGACCCCGCAGCGGTACCCGATGACCATGCAGGGCCGGGCGCA
GAGTGCCATGGGCGGCCTCTCTTATACACAGCAGATTCCTCCTTATGGACAACAAGGCCCCAGCGGGTATGGTCAACAGGGCCAGACTCC
ATATTACAACCAGCAAAGTCCTCACCCTCAGCAGCAGCAGCCACCCTACTCCCAGCAACCACCGTCCCAGACCCCTCATGCCCAACCTTC
GTATCAGCAGCAGCCACAGTCTCAACCACCACAGCTCCAGTCCTCTCAGCCTCCATACTCCCAGCAGCCATCCCAGCCTCCACATCAGCA
GTCCCCGGCTCCATACCCCTCCCAGCAGTCGACGACACAGCAGCACCCCCAGAGCCAGCCCCCCTACTCACAGCCACAGGCTCAGTCTCC
TTACCAGCAGCAGCAACCTCAGCAGCCAGCACCCTCGACGCTCTCCCAGCAGGCTGCGTATCCTCAGCCCCAGTCTCAGCAGTCCCAGCA
AACTGCCTATTCCCAGCAGCGCTTCCCTCCACCGCAGGAGCTATCTCAAGATTCATTTGGGTCTCAGGCATCCTCAGCCCCCTCAATGAC
CTCCAGTAAGGGAGGGCAAGAAGATATGAACCTGAGCCTTCAGTCAAGACCCTCCAGCTTGCCTGATCTATCTGGTTCAATAGATGACCT
CCCCATGGGGACAGAAGGAGCTCTGAGTCCTGGAGTGAGCACATCAGGGATTTCCAGCAGCCAAGGAGAGCAGAGTAATCCAGCTCAGTC
TCCTTTCTCTCCTCATACCTCCCCTCACCTGCCTGGCATCCGAGGCCCTTCCCCGTCCCCTGTTGGCTCTCCCGCCAGTGTTGCTCAGTC
TCGCTCAGGACCACTCTCGCCTGCTGCAGTGCCAGGCAACCAGATGCCACCTCGGCCACCCAGTGGCCAGTCGGACAGCATCATGCATCC
TTCCATGAACCAATCAAGCATTGCCCAAGATCGAGGTTATATGCAGAGGAACCCCCAGATGCCCCAGTACAGTTCCCCCCAGCCCGGCTC
AGCCTTATCTCCGCGTCAGCCTTCCGGAGGACAGATACACACAGGCATGGGCTCCTACCAGCAGAACTCCATGGGGAGCTATGGTCCCCA
GGGGGGTCAGTATGGCCCACAAGGTGGCTACCCCAGGCAGCCAAACTATAATGCCTTGCCCAATGCCAACTACCCCAGTGCAGGCATGGC
TGGAGGCATAAACCCCATGGGTGCCGGAGGTCAAATGCATGGACAGCCTGGCATCCCACCTTATGGCACACTCCCTCCAGGGAGGATGAG
TCACGCCTCCATGGGCAACCGGCCTTATGGCCCTAACATGGCCAATATGCCACCTCAGGTTGGGTCAGGGATGTGTCCCCCACCAGGGGG
CATGAACCGGAAAACCCAAGAAACTGCTGTCGCCATGCATGTTGCTGCCAACTCTATCCAAAACAGGCCGCCAGGCTACCCCAATATGAA
TCAAGGGGGCATGATGGGAACTGGACCTCCTTATGGACAAGGGATTAATAGTATGGCTGGCATGATCAACCCTCAGGGACCCCCATATTC
CATGGGTGGAACCATGGCCAACAATTCTGCAGGGATGGCAGCCAGCCCAGAGATGATGGGCCTTGGGGATGTAAAGTTAACTCCAGCCAC
CAAAATGAACAACAAGGCAGATGGGACACCCAAGACAGAATCCAAATCCAAGAAATCCAGTTCTTCTACTACAACCAATGAGAAGATCAC
CAAGTTGTATGAGCTGGGTGGTGAGCCTGAGAGGAAGATGTGGGTGGACCGTTATCTGGCCTTCACTGAGGAGAAGGCCATGGGCATGAC
AAATCTGCCTGCTGTGGGTAGGAAACCTCTGGACCTCTATCGCCTCTATGTGTCTGTGAAGGAGATTGGTGGATTGACTCAGGTCAACAA
GAACAAAAAATGGCGGGAACTTGCAACCAACCTCAATGTGGGCACATCAAGCAGTGCTGCCAGCTCCTTGAAAAAGCAGTATATCCAGTG
TCTCTATGCCTTTGAATGCAAGATTGAACGGGGAGAAGACCCTCCCCCAGACATCTTTGCAGCTGCTGATTCCAAGAAGTCCCAGCCCAA
GATCCAGCCTCCCTCTCCTGCGGGATCAGGATCTATGCAGGGGCCCCAGACTCCCCAGTCAACCAGCAGTTCCATGGCAGAAGGAGGAGA
CTTAAAGCCACCAACTCCAGCATCCACACCACACAGTCAGATCCCCCCATTGCCAGGCATGAGCAGGAGCAATTCAGTTGGGATCCAGGA
TGCCTTTAATGATGGAAGTGACTCCACATTCCAGAAGCGGAATTCCATGACTCCAAACCCTGGGTATCAGCCCAGTATGAATACCTCTGA
CATGATGGGGCGCATGTCCTATGAGCCAAATAAGGATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGG
GCAGGGCCCCAACGGCGGGATGGGTGACCCCTACAGTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTA
TCCCTATGGAGGTCCTTATGACAGAGTGAGGACGGAGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCT
CATGCCTTCCAACCCAGACTCGGGGATGTATTCTCCTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTA
TGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTGGCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGAATTA
CAAGCGGCCAATGGATGGCACATATGGCCCTCCTGCCAAGCGGCACGAAGGGGAGATGTACAGCGTGCCATACAGCACTGGGCAGGGGCA
GCCTCAGCAGCAGCAGTTGCCCCCAGCCCAGCCCCAGCCTGCCAGCCAGCAACAAGCTGCCCAGCCTTCCCCTCAGCAAGATGTATACAA
CCAGTATGGCAATGCCTATCCTGCCACTGCCACAGCTGCTACTGAGCGCCGACCAGCAGGCGGCCCCCAGAACCAATTTCCATTCCAGTT
TGGCCGAGACCGTGTCTCTGCACCCCCTGGCACCAATGCCCAGCAAAACATGCCACCACAAATGATGGGCGGCCCCATACAGGCATCAGC
TGAGGTTGCTCAGCAAGGCACCATGTGGCAGGGGCGTAATGACATGACCTATAATTATGCCAACAGGCAGAGCACGGGCTCTGCCCCCCA
GGGCCCCGCCTATCATGGCGTGAACCGAACAGATGAAATGCTGCACACAGATCAGAGGGCCAACCACGAAGGCTCGTGGCCTTCCCATGG
CACACGCCAGCCCCCATATGGTCCCTCTGCCCCTGTGCCCCCCATGACAAGGCCCCCTCCATCTAACTACCAGCCCCCACCAAGCATGCA
GAATCACATTCCTCAGGTATCCAGCCCTGCTCCCCTGCCCCGGCCAATGGAGAACCGCACCTCTCCTAGCAAGTCTCCATTCCTGCACTC
TGGGATGAAAATGCAGAAGGCAGGTCCCCCAGTACCTGCCTCGCACATAGCACCTGCCCCTGTGCAGCCCCCCATGATTCGGCGGGATAT
CACCTTCCCACCTGGCTCTGTTGAAGCCACACAGCCTGTGTTGAAGCAGAGGAGGCGGCTCACAATGAAAGACATTGGAACCCCGGAGGC
ATGGCGGGTAATGATGTCCCTCAAGTCTGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAA
CAGCATCATGACCTTCAACCTCAGTCAGGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGA
GTGCCTGCGCATCTGTGACTTTGGTTTTGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGT
GGCGCCTGAGGTGCTGAAGCGCCAGGGCTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATA
TACTCCATTTGCCAACGGTCCCAGTGACACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTG
GAACACAGTTTCAGAGACAGCCAAGGACCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCA
GCATCCATGGGTCACCCAGAAAGACAAGCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCAC
GTACTCCGCACTCAACAGCTCCAAGCCCACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCC
ATCCACCACCCTGTGAGGCACCAGGGCATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374168_chr1_26897940_+_1983nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC
ATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAA
CCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGG
CTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCC
ATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCT
TTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAG
CATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTAC
AGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGC
AGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGG
GCCATGAGGGACAGGGTCTTTTTTCATTTCTTCCTCAGCTGGTTACTCAGGGTTCATCTGTCCATGGCCTTTCTAATAAACTGTTGAGTT

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374166_chr1_26897940_+_1972nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC
ATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAA
CCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGG
CTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCC
ATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCT
TTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAG
CATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTAC
AGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGC
AGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000526792_chr1_26897940_+_1389nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC
ATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAA
CCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000374162_chr1_26897940_+_1389nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC
ATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAA
CCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000530003_chr1_26897940_+_1972nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC
ATTCGGGCCACAGGGCGGTGCTAGCTTGACACAGTCAGCATGCTTCCCAGAGGGAGCAGGCCGGAACCACAGGGCCAGAGGGAGCTGGAA
CCCGAGGGGCCGGGGAAGCTGCCAGCCCAGAACACCCCTAATGAGGGTGTGAGAAGTGCCTTCTCCTTCCCCAGGATGGACTCTTCTCGG
CTCAGGCTCTGCTGGTGGAAAGCGATTCACTGTATAAACTTTTTTTTATGAAAAAAATGGCATCAACCACCATGGATTTTTACAAGATCC
ATTTGCCTTTCTGGGAGCAGAAACAGCCATTGCGGCCCCAGGAGGGGAACTGAGTCACGCTGGGGCTCTCTGAGACTCTTTAGAGCAGCT
TTGGGATCCCACCCTGGGGACCCCCACGATTGGCCACCTGTAGCCATCTGCACACACCTCCGAGACAGTCCAGTGTCACCTCTCTCAGAG
CATCTGGCTGTTTAGCAGAACTCATTCTATCCCCAATCAGCTCCTTTTCCGTTCTGTTCTGCTGGGAGTTCTAGAACCACTTCCTGCTAC
AGGAGGGGTCTCATGTCCTGCTGGCTTCCAGCTTCAGGCACCAGCATCCACCTTGGCTCTGCCAGTGGATCCCCTGCGGTCAGGCTGGGC
AGCCCCAGAGAGAGGATGTGGAAAGCACTTTTTGGCTGACTTCATCTGGGGTTGGCAACAGGACAGAGTTCACAGGAGGCCAGTGGGCGG

>In-frame_ARID1A_ENST00000540690_chr1_27102198_+_RPS6KA1_ENST00000531382_chr1_26897940_+_1234nt
ATCCTTATGGCAGCATGAGGAAAGCTCCAGGGAGTGATCCCTTCATGTCCTCAGGGCAGGGCCCCAACGGCGGGATGGGTGACCCCTACA
GTCGTGCTGCCGGCCCTGGGCTAGGAAATGTGGCGATGGGACCACGACAGCACTATCCCTATGGAGGTCCTTATGACAGAGTGAGGACGG
AGCCTGGAATAGGGCCTGAGGGAAACATGAGCACTGGGGCCCCACAGCCGAATCTCATGCCTTCCAACCCAGACTCGGGGATGTATTCTC
CTAGCCGCTACCCCCCGCAGCAGCAGCAGCAGCAGCAGCAACGACATGATTCCTATGGCAATCAGTTCTCCACCCAAGGCACCCCTTCTG
GCAGCCCCTTCCCCAGCCAGCAGACTACAATGTATCAACAGCAACAGCAGGAACCCCGGAGGCATGGCGGGTAATGATGTCCCTCAAGTC
TGGTCTCCTGGCAGAGAGCACATGGGCATTAGATACCATCAACATCCTGCTGTATGATGACAACAGCATCATGACCTTCAACCTCAGTCA
GGTTGTGCACAGGGACCTGAAGCCCAGCAACATCCTGTATGTGGACGAGTCCGGGAATCCCGAGTGCCTGCGCATCTGTGACTTTGGTTT
TGCCAAACAGCTGCGGGCTGAGAATGGGCTCCTCATGACACCTTGCTACACAGCCAACTTTGTGGCGCCTGAGGTGCTGAAGCGCCAGGG
CTACGATGAAGGCTGCGACATCTGGAGCCTGGGCATTCTGCTGTACACCATGCTGGCAGGATATACTCCATTTGCCAACGGTCCCAGTGA
CACACCAGAGGAAATCCTAACCCGGATCGGCAGTGGGAAGTTTACCCTCAGTGGGGGAAATTGGAACACAGTTTCAGAGACAGCCAAGGA
CCTGGTGTCCAAGATGCTACACGTGGATCCCCACCAGCGCCTCACAGCTAAGCAGGTTCTGCAGCATCCATGGGTCACCCAGAAAGACAA
GCTTCCCCAAAGCCAGCTGTCCCACCAGGACCTACAGCTTGTGAAGGGAGCCATGGCTGCCACGTACTCCGCACTCAACAGCTCCAAGCC
CACCCCCCAGCTGAAGCCCATCGAGTCATCCATCCTGGCCCAGCGGCGAGTGAGGAAGTTGCCATCCACCACCCTGTGAGGCACCAGGGC


Top

FusionGenePPI for ARID1A_RPS6KA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ARID1AKLF1, GATA1, SMARCB1, SMARCA4, SMARCA2, ING1, SMARCE1, PBRM1, SMARCC2, SMARCC1, PGR, BCL7C, HIC1, CUL2, ARID1B, SMAD2, SMAD3, CARM1, ADNP, RARA, SOX2, CHD7, SMARCD1, TP53, ELAVL1, SIRT7, TFAP4, CUL3, SMARCD2, ACTL6A, SMARCD3, PHF10, ECT2, YAP1, ITCH, NEDD4, SHMT2, MOV10, NXF1, EED, DPF3, DPF2, SS18, UNK, BCL7A, BCL7B, ESR1, NCOA1, RARB, RARG, EWSR1, SNW1, CDC5L, CUL1, SKP1, NFATC1, NFATC2, TOP1, CHEK1, VHL, EYA2, NR3C1, AR, ALDH2, TRIM25RPS6KA1MAPK3, MAPK1, YWHAB, BAD, TSC1, TSC2, CARHSP1, EEF2K, NFKBIA, TOB1, CREBBP, ESR1, DDAH2, ATXN3, MPP1, PPM1G, TTK, GBP2, SRSF5, PHAX, VCP, CFL1, CCT4, MXD1, YBX1, PDCD4, RPTOR, MAPT, HSP90AA1, GSK3B, CDKN1B, CREB1, EIF4H, GINS2, CAPN1, CASP7, CNDP2, EEF2, GNS, GSR, KYNU, LDHA, LDHB, MVD, NPEPPS, PEPD, PGD, HSP90AB1, GRN, RPS6KA3, CSNK2B, ACACA, RPS6KA2, TLK2, MASTL, POLDIP3, DLC1, ILKAP, NTRK1, SCLT1, CDC37, DEPTOR, FGFR1, UBE2T, MISP, FYN, IRGC, IL17RA, FGFR2, FAM136A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ARID1A_RPS6KA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ARID1A_RPS6KA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneARID1AC0038356Stomach Neoplasms3CTD_human
HgeneARID1AC2239176Liver carcinoma3CTD_human
HgeneARID1AC0001418Adenocarcinoma1CTD_human
HgeneARID1AC0005695Bladder Neoplasm1CTD_human
HgeneARID1AC0006413Burkitt Lymphoma1CTD_human
HgeneARID1AC0007138Carcinoma, Transitional Cell1CTD_human
HgeneARID1AC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneARID1AC0014170Endometrial Neoplasms1CTD_human
HgeneARID1AC0027819Neuroblastoma1CTD_human
HgeneARID1AC0036920Sezary Syndrome1CTD_human
HgeneARID1AC0079772T-Cell Lymphoma1CTD_human
HgeneARID1AC0079773Lymphoma, T-Cell, Cutaneous1CTD_human
HgeneARID1AC0206698Cholangiocarcinoma1CTD_human
HgeneARID1AC0265338Coffin-Siris syndrome1CTD_human;ORPHANET
HgeneARID1AC0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneARID1AC0920269Microsatellite Instability1CTD_human
HgeneARID1AC2931822Nasopharyngeal carcinoma1CTD_human
TgeneRPS6KA1C0036920Sezary Syndrome1CTD_human